P14315 (CAPZB_CHICK) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: F-actin-capping protein subunit beta isoforms 1 and 2 Alternative name(s): Beta-actinin subunit II CapZ 36/32 CapZ B1 and B2 | ||
| Gene names |
| ||
| Organism | Gallus gallus (Chicken) [Reference proteome] | ||
| Taxonomic identifier | 9031 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Archosauria › Dinosauria › Saurischia › Theropoda › Coelurosauria › Aves › Neognathae › Galliformes › Phasianidae › Phasianinae › Gallus![]() |
Protein attributes
| Sequence length | 277 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. May play a role in the regulation of cell morphology and cytoskeletal organization. |
| Subunit structure | Heterodimer of an alpha and a beta subunit. Component of the WASH complex By similarity. Isoform 2 also is a component of dynactin complex from brain, which contains the actin-related protein ARP1. |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. |
| Tissue specificity | Isoform 2 is the predominant isoform of nonmuscle tissues and isoform 1 is the predominant isoform of muscle tissues. In cardiac muscle, isoform 1 is located at Z-disks of sarcomeres while isoform 2 is enriched at intercalated disks. |
| Sequence similarities | Belongs to the F-actin-capping protein beta subunit family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing |
| Ligand | Actin-binding |
| Molecular function | Actin capping |
| PTM | Acetylation |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | actin cytoskeleton organization Inferred from electronic annotation. Source: InterPro actin filament cappingInferred from electronic annotation. Source: UniProtKB-KW cytoskeleton organizationInferred from sequence or structural similarity. Source: UniProtKB regulation of cell morphogenesisInferred from sequence or structural similarity. Source: UniProtKB |
| Cellular_component | F-actin capping protein complex Inferred from electronic annotation. Source: InterPro WASH complexInferred from electronic annotation. Source: InterPro cytosolTraceable author statement. Source: Reactome |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P14315-1) Also known as: Beta-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P14315-2) Also known as: Beta-2; The sequence of this isoform differs from the canonical sequence as follows: 246-277: IDAIPDNQKYKQLQRELSQVLTQRQIYIQPDN → VQTFADKSKQEALKNDLVEALKRKQQS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | |||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 277 | 276 | F-actin-capping protein subunit beta isoforms 1 and 2 | PRO_0000204636 | ||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 246 – 277 | 32 | IDAIP…IQPDN → VQTFADKSKQEALKNDLVEA LKRKQQS in isoform 2. | VSP_000769 | ||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 3 – 13 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 18 – 20 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 21 – 31 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 33 – 35 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 36 – 42 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 48 – 52 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 53 – 56 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 57 – 61 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 63 – 65 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 70 – 72 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 74 – 76 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 79 – 81 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 91 – 112 | 22 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 113 – 124 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 127 – 137 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 142 – 158 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 162 – 181 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 182 – 184 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 185 – 202 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 204 – 207 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 209 – 233 | 25 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 235 – 243 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 253 – 267 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "cDNAs encoding the beta subunit of cap Z, the actin-capping protein of the Z line of muscle." Caldwell J.E., Waddle J.A., Cooper J.A., Hollands J.A., Casella S.J., Casella J.F. J. Biol. Chem. 264:12648-12652(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Differential localization and sequence analysis of capping protein beta-subunit isoforms of vertebrates." Schafer D.A., Korshunova Y.O., Schroer T.A., Cooper J.A. J. Cell Biol. 127:453-465(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Beta-actinin is equivalent to Cap Z protein." Maruyama K., Kurokawa H., Oosawa M., Shimaoka S., Yamamoto H., Ito M., Maruyama K. J. Biol. Chem. 265:8712-8715(1990) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 160-168 AND 182-198. Tissue: Muscle. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | J04959 mRNA. Translation: AAA49144.1. U07826 mRNA. Translation: AAA52222.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00571469. IPI00591422. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | A34335. A54819. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001167000.1. NM_001173529.1. NP_990768.1. NM_205437.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Gga.4050. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P14315. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P14315. Positions 2-271. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-35365N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P14315. 1 interaction. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-3390662. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9031.ENSGALP00000006415. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P14315. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P14315. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSGALT00000006424; ENSGALP00000006414; ENSGALG00000004034. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 396418. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | gga:396418. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 832. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG291067. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00390000017957. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000041208. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG050789. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P14315. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K10365. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | NLLQEVY. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_96458. Hemostasis. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR019771. F-actin_capping_bsu_CS. IPR001698. WASH_F-actin_cap_beta. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR10619. PTHR10619. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF01115. F_actin_cap_B. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00192. FACTINCAPB. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00231. F_ACTIN_CAPPING_BETA. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P14315. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 20816459. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | CAPZB_CHICK | ||||||||
| Accession | Primary (citable) accession number: P14315 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
