Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-actin-capping protein subunit beta isoforms 1 and 2

Gene

CAPZB

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. May play a role in the regulation of cell morphology and cytoskeletal organization.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Actin capping

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

ReactomeiR-GGA-983231. Factors involved in megakaryocyte development and platelet production.

Names & Taxonomyi

Protein namesi
Recommended name:
F-actin-capping protein subunit beta isoforms 1 and 2
Alternative name(s):
Beta-actinin subunit II
CapZ 36/32
CapZ B1 and B2
Gene namesi
Name:CAPZB
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
Proteomesi
  • UP000000539 Componenti: Chromosome 21

Subcellular locationi

Isoform 1 :
Isoform 2 :
  • CytoplasmmyofibrilsarcomereI band 1 Publication
  • Cytoplasmcytoskeleton By similarity

  • Note: In cardiac muscle, isoform 2 is located at sarcomere intercalated disks.1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 277276F-actin-capping protein subunit beta isoforms 1 and 2PRO_0000204636Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserineBy similarity

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiP14315.
PRIDEiP14315.

Expressioni

Tissue specificityi

Isoform 1 is detected in pectoral muscle, cardiac muscle and gizzard. Isoform 2 is detected in brain and liver (at protein level). Isoform 2 is the predominant isoform of nonmuscle tissues and isoform 1 is the predominant isoform of muscle tissues.1 Publication

Gene expression databases

BgeeiENSGALG00000004034.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. Component of the WASH complex (By similarity). Isoform 2 also is a component of dynactin complex from brain, which contains the actin-related protein ARP1.By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi676667. 1 interaction.
DIPiDIP-35365N.
IntActiP14315. 3 interactions.
MINTiMINT-3390662.
STRINGi9031.ENSGALP00000006415.

Structurei

Secondary structure

1
277
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi3 – 1311Combined sources
Helixi18 – 203Combined sources
Helixi21 – 3111Combined sources
Helixi33 – 353Combined sources
Helixi36 – 427Combined sources
Beta strandi48 – 525Combined sources
Turni53 – 564Combined sources
Beta strandi57 – 615Combined sources
Helixi63 – 653Combined sources
Beta strandi70 – 723Combined sources
Turni74 – 763Combined sources
Beta strandi79 – 813Combined sources
Helixi91 – 11222Combined sources
Beta strandi113 – 12412Combined sources
Beta strandi127 – 13711Combined sources
Beta strandi142 – 15817Combined sources
Beta strandi162 – 18120Combined sources
Turni182 – 1843Combined sources
Beta strandi185 – 20218Combined sources
Beta strandi204 – 2074Combined sources
Helixi209 – 23325Combined sources
Helixi235 – 2439Combined sources
Helixi253 – 26715Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1IZNX-ray2.10B/D1-277[»]
2KXPNMR-B2-271[»]
2KZ7NMR-B1-277[»]
3AA0X-ray1.70B1-244[»]
3AA1X-ray1.90B1-244[»]
3AA6X-ray1.90B1-244[»]
3AA7X-ray1.90B1-244[»]
3AAAX-ray2.20B1-277[»]
3AAEX-ray3.30B/D/F/H/J1-277[»]
3LK2X-ray2.20B1-243[»]
3LK3X-ray2.68B1-277[»]
3LK4X-ray1.992/5/8/B/E/H/K/N/Q/T/W/Z1-277[»]
ProteinModelPortaliP14315.
SMRiP14315. Positions 2-271.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP14315.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3174. Eukaryota.
ENOG410XQYD. LUCA.
GeneTreeiENSGT00390000017957.
HOGENOMiHOG000041208.
HOVERGENiHBG050789.
InParanoidiP14315.
KOiK10365.
OMAiFDTYREM.
OrthoDBiEOG091G0EH8.
PhylomeDBiP14315.

Family and domain databases

InterProiIPR001698. CAPZB.
IPR019771. F-actin_capping_bsu_CS.
[Graphical view]
PANTHERiPTHR10619. PTHR10619. 1 hit.
PfamiPF01115. F_actin_cap_B. 1 hit.
[Graphical view]
PRINTSiPR00192. FACTINCAPB.
PROSITEiPS00231. F_ACTIN_CAPPING_BETA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P14315-1) [UniParc]FASTAAdd to basket
Also known as: Beta-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDQQLDCAL DLMRRLPPQQ IEKNLSDLID LVPSLCEDLL SSVDQPLKIA
60 70 80 90 100
RDKVVGKDYL LCDYNRDGDS YRSPWSNKYD PPLEDGAMPS ARLRKLEVEA
110 120 130 140 150
NNAFDQYRDL YFEGGVSSVY LWDLDHGFAG VILIKKAGDG SKKIKGCWDS
160 170 180 190 200
IHVVEVQEKS SGRTAHYKLT STVMLWLQTN KTGSGTMNLG GSLTRQMEKD
210 220 230 240 250
ETVSDSSPHI ANIGRLVEDM ENKIRSTLNE IYFGKTKDIV NGLRSIDAIP
260 270
DNQKYKQLQR ELSQVLTQRQ IYIQPDN
Length:277
Mass (Da):31,364
Last modified:January 23, 2007 - v3
Checksum:i55E5271EDA5454D6
GO
Isoform 2 (identifier: P14315-2) [UniParc]FASTAAdd to basket
Also known as: Beta-2

The sequence of this isoform differs from the canonical sequence as follows:
     246-277: IDAIPDNQKYKQLQRELSQVLTQRQIYIQPDN → VQTFADKSKQEALKNDLVEALKRKQQS

Show »
Length:272
Mass (Da):30,611
Checksum:iB8567604B64E23D7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei246 – 27732IDAIP…IQPDN → VQTFADKSKQEALKNDLVEA LKRKQQS in isoform 2. 1 PublicationVSP_000769Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04959 mRNA. Translation: AAA49144.1.
U07826 mRNA. Translation: AAA52222.1.
PIRiA34335.
A54819.
RefSeqiNP_001167000.1. NM_001173529.1. [P14315-2]
NP_990768.1. NM_205437.2. [P14315-1]
XP_015152321.1. XM_015296835.1. [P14315-1]
UniGeneiGga.4050.

Genome annotation databases

EnsembliENSGALT00000006424; ENSGALP00000006414; ENSGALG00000004034. [P14315-2]
ENSGALT00000006425; ENSGALP00000006415; ENSGALG00000004034. [P14315-1]
GeneIDi396418.
KEGGigga:396418.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04959 mRNA. Translation: AAA49144.1.
U07826 mRNA. Translation: AAA52222.1.
PIRiA34335.
A54819.
RefSeqiNP_001167000.1. NM_001173529.1. [P14315-2]
NP_990768.1. NM_205437.2. [P14315-1]
XP_015152321.1. XM_015296835.1. [P14315-1]
UniGeneiGga.4050.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1IZNX-ray2.10B/D1-277[»]
2KXPNMR-B2-271[»]
2KZ7NMR-B1-277[»]
3AA0X-ray1.70B1-244[»]
3AA1X-ray1.90B1-244[»]
3AA6X-ray1.90B1-244[»]
3AA7X-ray1.90B1-244[»]
3AAAX-ray2.20B1-277[»]
3AAEX-ray3.30B/D/F/H/J1-277[»]
3LK2X-ray2.20B1-243[»]
3LK3X-ray2.68B1-277[»]
3LK4X-ray1.992/5/8/B/E/H/K/N/Q/T/W/Z1-277[»]
ProteinModelPortaliP14315.
SMRiP14315. Positions 2-271.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi676667. 1 interaction.
DIPiDIP-35365N.
IntActiP14315. 3 interactions.
MINTiMINT-3390662.
STRINGi9031.ENSGALP00000006415.

Proteomic databases

PaxDbiP14315.
PRIDEiP14315.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSGALT00000006424; ENSGALP00000006414; ENSGALG00000004034. [P14315-2]
ENSGALT00000006425; ENSGALP00000006415; ENSGALG00000004034. [P14315-1]
GeneIDi396418.
KEGGigga:396418.

Organism-specific databases

CTDi832.

Phylogenomic databases

eggNOGiKOG3174. Eukaryota.
ENOG410XQYD. LUCA.
GeneTreeiENSGT00390000017957.
HOGENOMiHOG000041208.
HOVERGENiHBG050789.
InParanoidiP14315.
KOiK10365.
OMAiFDTYREM.
OrthoDBiEOG091G0EH8.
PhylomeDBiP14315.

Enzyme and pathway databases

ReactomeiR-GGA-983231. Factors involved in megakaryocyte development and platelet production.

Miscellaneous databases

EvolutionaryTraceiP14315.
PROiP14315.

Gene expression databases

BgeeiENSGALG00000004034.

Family and domain databases

InterProiIPR001698. CAPZB.
IPR019771. F-actin_capping_bsu_CS.
[Graphical view]
PANTHERiPTHR10619. PTHR10619. 1 hit.
PfamiPF01115. F_actin_cap_B. 1 hit.
[Graphical view]
PRINTSiPR00192. FACTINCAPB.
PROSITEiPS00231. F_ACTIN_CAPPING_BETA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCAPZB_CHICK
AccessioniPrimary (citable) accession number: P14315
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: January 23, 2007
Last modified: September 7, 2016
This is version 142 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.