Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P14270

- PDE4D_RAT

UniProt

P14270 - PDE4D_RAT

Protein

cAMP-specific 3',5'-cyclic phosphodiesterase 4D

Gene

Pde4d

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 127 (01 Oct 2014)
      Sequence version 4 (04 Jan 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.

    Catalytic activityi

    Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.

    Cofactori

    Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity.By similarity

    Enzyme regulationi

    Activated by phosphatidic acid By similarity. Inhibited by rolipram.By similarity1 Publication

    Kineticsi

      Vmax=18 pmol/min/mg enzyme for cAMP (in the absence of follicle-stimulating hormone (FSH))1 Publication

      Vmax=5 pmol/min/mg enzyme for cAMP (in the presence of follicle-stimulating hormone (FSH))1 Publication

      Pathwayi

      Sites

      Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
      Active sitei457 – 4571Proton donorBy similarity
      Metal bindingi461 – 4611Divalent metal cation 1By similarity
      Metal bindingi497 – 4971Divalent metal cation 1By similarity
      Metal bindingi498 – 4981Divalent metal cation 1By similarity
      Metal bindingi498 – 4981Divalent metal cation 2By similarity
      Binding sitei498 – 4981cAMPBy similarity
      Metal bindingi615 – 6151Divalent metal cation 1By similarity
      Sitei618 – 6181Binds AMP, but not cAMPBy similarity

      Regions

      Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
      Nucleotide bindingi457 – 4615cAMPBy similarity

      GO - Molecular functioni

      1. 3',5'-cyclic-AMP phosphodiesterase activity Source: RGD
      2. beta-2 adrenergic receptor binding Source: BHF-UCL
      3. cAMP binding Source: RGD
      4. cyclic-nucleotide phosphodiesterase activity Source: RGD
      5. enzyme binding Source: BHF-UCL
      6. metal ion binding Source: UniProtKB-KW
      7. protein binding Source: IntAct
      8. protein domain specific binding Source: RGD
      9. SH3 domain binding Source: RGD

      GO - Biological processi

      1. adrenergic receptor signaling pathway Source: BHF-UCL
      2. adrenergic receptor signaling pathway involved in positive regulation of heart rate Source: BHF-UCL
      3. cAMP catabolic process Source: UniProtKB
      4. cellular protein complex assembly Source: RGD
      5. establishment of endothelial barrier Source: UniProtKB
      6. lung development Source: RGD
      7. memory Source: RGD
      8. positive regulation of smooth muscle cell migration Source: RGD
      9. positive regulation of smooth muscle cell proliferation Source: RGD
      10. regulation of cardiac muscle cell contraction Source: BHF-UCL
      11. regulation of G-protein coupled receptor protein signaling pathway Source: RGD
      12. regulation of protein kinase A signaling Source: RGD
      13. regulation of receptor activity Source: BHF-UCL

      Keywords - Molecular functioni

      Hydrolase

      Keywords - Ligandi

      cAMP, Metal-binding

      Enzyme and pathway databases

      UniPathwayiUPA00762; UER00747.

      Names & Taxonomyi

      Protein namesi
      Recommended name:
      cAMP-specific 3',5'-cyclic phosphodiesterase 4D (EC:3.1.4.53)
      Alternative name(s):
      DPDE3
      Gene namesi
      Name:Pde4d
      OrganismiRattus norvegicus (Rat)
      Taxonomic identifieri10116 [NCBI]
      Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
      ProteomesiUP000002494: Chromosome 2

      Organism-specific databases

      RGDi3281. Pde4d.

      Subcellular locationi

      Apical cell membrane. Cytoplasm. Membrane. Cytoplasmcytoskeleton. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome
      Note: Found in the soluble fraction, associated with membranes, and associated with the cytoskeleton and the centrosome. Colocalized with SHANK2 to the apical membrane of colonic crypt cells.

      GO - Cellular componenti

      1. apical plasma membrane Source: UniProtKB-SubCell
      2. centrosome Source: RGD
      3. Golgi apparatus Source: RGD
      4. myofibril Source: RGD

      Keywords - Cellular componenti

      Cell membrane, Cytoplasm, Cytoskeleton, Membrane

      PTM / Processingi

      Molecule processing

      Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
      Chaini1 – 803803cAMP-specific 3',5'-cyclic phosphodiesterase 4DPRO_0000198816Add
      BLAST

      Amino acid modifications

      Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
      Modified residuei294 – 2941PhosphoserineBy similarity
      Modified residuei296 – 2961PhosphoserineBy similarity
      Cross-linki382 – 382Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity

      Post-translational modificationi

      Isoform 1 and isoform 9 are rapidly activated by PKA through phosphorylation. Long isoforms that share a conserved PKA phosphorylation site in the N-terminus are also activated.1 Publication
      Sumoylation of long isoforms by PIAS4 augments their activation by PKA phosphorylation and represses their inhibition by ERK phosphorylation.By similarity

      Keywords - PTMi

      Isopeptide bond, Phosphoprotein, Ubl conjugation

      Proteomic databases

      PRIDEiP14270.

      PTM databases

      PhosphoSiteiP14270.

      Expressioni

      Tissue specificityi

      Expressed in epithelial cells. Isoform 33, isoform 4, isoform 5 and isoform 9 are expressed in brain. Isoform 33, isoform 5, isoform 8 and isoform 9 are expressed in heart (at protein level). Isoform 4 and isoform 6 are strongly expressed in cortex and cerebellum. Isoform 7 is strongly expressed in cortex and testis; weakly expressed in kidney, lung, spleen and cerebellum. Isoform 8 is strongly expressed in lung, heart and liver. Isoform 31, isoform 32, isoform 33, isoform 5 and isoform 9 are widely distributed.2 Publications

      Inductioni

      Up-regulated by cAMP and follicle-stimulating hormone.1 Publication

      Gene expression databases

      GenevestigatoriP14270.

      Interactioni

      Subunit structurei

      Homodimer for the long isoforms. Isoforms with truncated N-termini are monomeric. Binds ARRB2. Isoform 33 is part of a ternary complex containing PRKAR2A, PRKAR2B and AKAP9. Identified in a complex composed of RYR1, PDE4D, PKA, FKBP1A and protein phosphatase 1 (PP1) By similarity. Interacts with PDE4DIP. Isoform 5 interacts (via N-terminal region) with SHANK2 (via proline-rich region); the interaction is increased in a PKA-dependent manner. Isoform 33, isoform 4, isoform 7, isoform 8 and isoform 9 but not isoform 32 and isoform 6 interact with SHANK2. Isoform 31 interacts weakly with SHANK2.By similarity2 Publications

      Binary interactionsi

      WithEntry#Exp.IntActNotes
      ADRB1P085882EBI-8333209,EBI-991009From a different organism.
      Shank2Q9QX744EBI-9032440,EBI-397902

      Protein-protein interaction databases

      BioGridi246765. 4 interactions.
      IntActiP14270. 2 interactions.
      STRINGi10116.ENSRNOP00000015138.

      Structurei

      3D structure databases

      ProteinModelPortaliP14270.
      SMRiP14270. Positions 376-736.
      ModBaseiSearch...
      MobiDBiSearch...

      Family & Domainsi

      Sequence similaritiesi

      Phylogenomic databases

      eggNOGiNOG122287.
      GeneTreeiENSGT00740000115148.
      HOVERGENiHBG108239.
      KOiK01120.
      OMAiQHEVEMP.
      PhylomeDBiP14270.

      Family and domain databases

      Gene3Di1.10.1300.10. 1 hit.
      InterProiIPR003607. HD/PDEase_dom.
      IPR023088. PDEase.
      IPR002073. PDEase_catalytic_dom.
      IPR023174. PDEase_CS.
      [Graphical view]
      PfamiPF00233. PDEase_I. 1 hit.
      [Graphical view]
      PRINTSiPR00387. PDIESTERASE1.
      SMARTiSM00471. HDc. 1 hit.
      [Graphical view]
      PROSITEiPS00126. PDEASE_I. 1 hit.
      [Graphical view]

      Sequences (9)i

      Sequence statusi: Complete.

      This entry describes 9 isoformsi produced by alternative splicing. Align

      Isoform 4 (identifier: P14270-5) [UniParc]FASTAAdd to Basket

      Also known as: PDE4D4

      This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

      « Hide

      MEAEGSSVPA RAGSHEGSDS SGGAALKAPK HLWRHEQHHQ YPLRQPQFRL    50
      LHPHHHLPPP PPPSPQPQLQ PPPPPPLPPP PPPPGATRGR YASSGASRVR 100
      HRGYSDTERY LYCRAMDRTS YAVETGHRPG LKKSRMSWPS SFQGLRRFDV 150
      DNGTSAGRSP LDPMTSPGSG LILQANFVHS QRRESFLYRS DSDYDLSPKS 200
      MSRNSSIASD IHGDDLIVTP FAQVLASLRT VRNNFAALTN LQDRAPSKRS 250
      PMCNQPSINK ATITEEAYQK LASETLEELD WCLDQLETLQ TRHSVSEMAS 300
      NKFKRMLNRE LTHLSEMSRS GNQVSEYISN TFLDKQHEVE IPSPTQKEKE 350
      KKKRPMSQIS GVKKLMHSSS LTNSCIPRFG VKTEQEDVLA KELEDVNKWG 400
      LHVFRIAELS GNRPLTVIMH TIFQERDLLK TFKIPVDTLI TYLMTLEDHY 450
      HADVAYHNNI HAADVVQSTH VLLSTPALEA VFTDLEILAA IFASAIHDVD 500
      HPGVSNQFLI NTNSELALMY NDSSVLENHH LAVGFKLLQE ENCDIFQNLT 550
      KKQRQSLRKM AIDIVLATDM SKHMNLLADL KTMVETKKVT SSGVLLLDNY 600
      SDRIQVLQNM VHCADLSNPT KPLQLYRQWT DRIMEEFFRQ GDRERERGME 650
      ISPMCDKHNA SVEKSQVGFI DYIVHPLWET WADLVHPDAQ DILDTLEDNR 700
      EWYQSTIPQS PSPAPDDQED GRQGQTEKFQ FELTLEEDGE SDTEKDSGSQ 750
      VEEDTSCSDS KTLCTQDSES TEIPLDEQVE EEAVAEEESQ PQTGVADDCC 800
      PDT 803
      Length:803
      Mass (Da):90,552
      Last modified:January 4, 2005 - v4
      Checksum:i13E28B257556496D
      GO
      Isoform 33 (identifier: P14270-1) [UniParc]FASTAAdd to Basket

      Also known as: PDE4D3, PDE3.3

      The sequence of this isoform differs from the canonical sequence as follows:
           1-131: Missing.
           132-147: KKSRMSWPSSFQGLRR → MMHVNTFPFRRHSWIC

      Show »
      Length:672
      Mass (Da):76,263
      Checksum:i63CE38FA654A0BDD
      GO
      Isoform 31 (identifier: P14270-2) [UniParc]FASTAAdd to Basket

      Also known as: PDE3.1

      The sequence of this isoform differs from the canonical sequence as follows:
           1-264: MEAEGSSVPA...QPSINKATIT → MKEQPSCAGT...TESPFPCLFA

      Show »
      Length:584
      Mass (Da):66,243
      Checksum:i7C0DAEB75774F2F8
      GO
      Isoform 32 (identifier: P14270-3) [UniParc]FASTAAdd to Basket

      Also known as: PDE3.2

      The sequence of this isoform differs from the canonical sequence as follows:
           1-297: Missing.

      Show »
      Length:506
      Mass (Da):57,601
      Checksum:i7DCA5A564384FC34
      GO
      Isoform 5 (identifier: P14270-8) [UniParc]FASTAAdd to Basket

      Also known as: PDE4D5

      The sequence of this isoform differs from the canonical sequence as follows:
           1-147: MEAEGSSVPA...WPSSFQGLRR → MAQQTTSPDT...QRRFTVAHTC

      Show »
      Length:745
      Mass (Da):84,335
      Checksum:i09DEADF7223F77BF
      GO
      Isoform 6 (identifier: P14270-7) [UniParc]FASTAAdd to Basket

      Also known as: PDE4D6

      The sequence of this isoform differs from the canonical sequence as follows:
           1-286: Missing.
           287-301: ETLQTRHSVSEMASN → MPEANYLLSVSWGYI

      Show »
      Length:517
      Mass (Da):58,923
      Checksum:i251BF853D7CE6870
      GO
      Isoform 7 (identifier: P14270-4) [UniParc]FASTAAdd to Basket

      Also known as: PDE4D7

      The sequence of this isoform differs from the canonical sequence as follows:
           1-56: Missing.
           57-147: LPPPPPPSPQ...WPSSFQGLRR → MERNTCDVLS...IAVTSADSTG

      Show »
      Length:747
      Mass (Da):84,430
      Checksum:iD63B9EF50AA3EFC9
      GO
      Isoform 8 (identifier: P14270-9) [UniParc]FASTAAdd to Basket

      Also known as: PDE4D8

      The sequence of this isoform differs from the canonical sequence as follows:
           1-147: MEAEGSSVPA...WPSSFQGLRR → MAFVWDPLGVTVPGPSPRTRTRLRFSKSYS

      Show »
      Length:686
      Mass (Da):77,611
      Checksum:iD1F73EAEBDC6AA66
      GO
      Isoform 9 (identifier: P14270-6) [UniParc]FASTAAdd to Basket

      Also known as: PDE4D9

      The sequence of this isoform differs from the canonical sequence as follows:
           1-125: Missing.
           126-147: GHRPGLKKSRMSWPSSFQGLRR → MSIIMKPRSRSTSSLRTTEAVC

      Show »
      Length:678
      Mass (Da):76,656
      Checksum:iE3069D16ADEBEC6C
      GO

      Experimental Info

      Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
      Sequence conflicti226 – 2261A → N in AAA56857. (PubMed:7958996)Curated
      Sequence conflicti357 – 3571S → P in AAQ90405. 1 PublicationCurated
      Sequence conflicti480 – 4867Missing in AAA18924. (PubMed:8276818)Curated
      Sequence conflicti480 – 4867Missing in AAA18925. (PubMed:8276818)Curated
      Sequence conflicti641 – 6411G → E in AAC26969. (PubMed:7958996)Curated
      Sequence conflicti757 – 7571C → Y in AAA56857. (PubMed:7958996)Curated

      Alternative sequence

      Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
      Alternative sequencei1 – 297297Missing in isoform 32. 1 PublicationVSP_004582Add
      BLAST
      Alternative sequencei1 – 286286Missing in isoform 6. 1 PublicationVSP_012404Add
      BLAST
      Alternative sequencei1 – 264264MEAEG…KATIT → MKEQPSCAGTGHPSMAGYGR MAPFELAGGPVKRLRTESPF PCLFA in isoform 31. 3 PublicationsVSP_004581Add
      BLAST
      Alternative sequencei1 – 147147MEAEG…QGLRR → MAQQTTSPDTLTVPEVDNPH VPNPWLNEDLVKSLRENLLQ HEKSKTARKSVSPKLSPVIS PRNSPRLLRRMLLSSNIPKQ RRFTVAHTC in isoform 5. 1 PublicationVSP_053485Add
      BLAST
      Alternative sequencei1 – 147147MEAEG…QGLRR → MAFVWDPLGVTVPGPSPRTR TRLRFSKSYS in isoform 8. 1 PublicationVSP_053486Add
      BLAST
      Alternative sequencei1 – 131131Missing in isoform 33. 2 PublicationsVSP_012398Add
      BLAST
      Alternative sequencei1 – 125125Missing in isoform 9. 1 PublicationVSP_012402Add
      BLAST
      Alternative sequencei1 – 5656Missing in isoform 7. 1 PublicationVSP_012400Add
      BLAST
      Alternative sequencei57 – 14791LPPPP…QGLRR → MERNTCDVLSRSKSASEETL HSCNDEEDPFRGMEPYLVRR LSSRSIQLPPLAFRQLEQTD LRSESENIPRPTSLPLKILP LIAVTSADSTG in isoform 7. 1 PublicationVSP_012401Add
      BLAST
      Alternative sequencei126 – 14722GHRPG…QGLRR → MSIIMKPRSRSTSSLRTTEA VC in isoform 9. 1 PublicationVSP_012403Add
      BLAST
      Alternative sequencei132 – 14716KKSRM…QGLRR → MMHVNTFPFRRHSWIC in isoform 33. 2 PublicationsVSP_012399Add
      BLAST
      Alternative sequencei287 – 30115ETLQT…EMASN → MPEANYLLSVSWGYI in isoform 6. 1 PublicationVSP_012405Add
      BLAST

      Sequence databases

      Select the link destinations:
      EMBL
      GenBank
      DDBJ
      Links Updated
      U09455 mRNA. Translation: AAA20401.1.
      U09457 mRNA. Translation: AAB81869.1.
      U09456 mRNA. Translation: AAA20393.1.
      U01280
      , U01278, U01282, U01283, U01284, U01285, U01286, U01287, U01279 Unassigned DNA. Translation: AAA18925.1.
      U01280
      , U01278, U01282, U01283, U01284, U01285, U01286, U01287, U01279 Unassigned DNA. Translation: AAA18924.1.
      AF031373 mRNA. Translation: AAB95266.1.
      AF536974 mRNA. Translation: AAN10116.1.
      EF102484 mRNA. Translation: ABK97408.1.
      EF121818 mRNA. Translation: ABL14108.1.
      AF536979 mRNA. Translation: AAN10121.1.
      AY388961 mRNA. Translation: AAQ90405.1.
      AABR06012736 Genomic DNA. No translation available.
      AABR06012737 Genomic DNA. No translation available.
      AABR06012738 Genomic DNA. No translation available.
      AABR06012739 Genomic DNA. No translation available.
      AABR06012740 Genomic DNA. No translation available.
      AABR06012741 Genomic DNA. No translation available.
      AABR06012742 Genomic DNA. No translation available.
      AABR06012743 Genomic DNA. No translation available.
      AABR06012744 Genomic DNA. No translation available.
      AABR06012745 Genomic DNA. No translation available.
      AABR06012746 Genomic DNA. No translation available.
      AABR06012747 Genomic DNA. No translation available.
      AABR06012748 Genomic DNA. No translation available.
      AABR06012749 Genomic DNA. No translation available.
      AABR06012750 Genomic DNA. No translation available.
      AABR06012751 Genomic DNA. No translation available.
      AABR06012752 Genomic DNA. No translation available.
      AABR06012753 Genomic DNA. No translation available.
      AABR06012754 Genomic DNA. No translation available.
      AABR06012755 Genomic DNA. No translation available.
      AABR06012756 Genomic DNA. No translation available.
      AABR06012757 Genomic DNA. No translation available.
      AABR06012758 Genomic DNA. No translation available.
      AABR06012759 Genomic DNA. No translation available.
      AABR06012760 Genomic DNA. No translation available.
      L27059 mRNA. Translation: AAA56857.1.
      L27060 mRNA. Translation: AAC26969.1.
      PIRiB53109.
      I61259.
      RefSeqiNP_001106799.1. NM_001113328.1.
      NP_001106800.1. NM_001113329.1. [P14270-4]
      NP_001106803.1. NM_001113332.1. [P14270-8]
      NP_001106805.1. NM_001113334.1. [P14270-9]
      NP_058728.1. NM_017032.1. [P14270-1]
      UniGeneiRn.163460.
      Rn.95959.

      Genome annotation databases

      EnsembliENSRNOT00000015138; ENSRNOP00000015138; ENSRNOG00000042536. [P14270-6]
      ENSRNOT00000066384; ENSRNOP00000063446; ENSRNOG00000042536. [P14270-9]
      ENSRNOT00000067546; ENSRNOP00000062384; ENSRNOG00000042536. [P14270-7]
      ENSRNOT00000073552; ENSRNOP00000067171; ENSRNOG00000042536. [P14270-8]
      GeneIDi24627.
      KEGGirno:24627.

      Keywords - Coding sequence diversityi

      Alternative splicing

      Cross-referencesi

      Sequence databases

      Select the link destinations:
      EMBL
      GenBank
      DDBJ
      Links Updated
      U09455 mRNA. Translation: AAA20401.1 .
      U09457 mRNA. Translation: AAB81869.1 .
      U09456 mRNA. Translation: AAA20393.1 .
      U01280
      , U01278 , U01282 , U01283 , U01284 , U01285 , U01286 , U01287 , U01279 Unassigned DNA. Translation: AAA18925.1 .
      U01280
      , U01278 , U01282 , U01283 , U01284 , U01285 , U01286 , U01287 , U01279 Unassigned DNA. Translation: AAA18924.1 .
      AF031373 mRNA. Translation: AAB95266.1 .
      AF536974 mRNA. Translation: AAN10116.1 .
      EF102484 mRNA. Translation: ABK97408.1 .
      EF121818 mRNA. Translation: ABL14108.1 .
      AF536979 mRNA. Translation: AAN10121.1 .
      AY388961 mRNA. Translation: AAQ90405.1 .
      AABR06012736 Genomic DNA. No translation available.
      AABR06012737 Genomic DNA. No translation available.
      AABR06012738 Genomic DNA. No translation available.
      AABR06012739 Genomic DNA. No translation available.
      AABR06012740 Genomic DNA. No translation available.
      AABR06012741 Genomic DNA. No translation available.
      AABR06012742 Genomic DNA. No translation available.
      AABR06012743 Genomic DNA. No translation available.
      AABR06012744 Genomic DNA. No translation available.
      AABR06012745 Genomic DNA. No translation available.
      AABR06012746 Genomic DNA. No translation available.
      AABR06012747 Genomic DNA. No translation available.
      AABR06012748 Genomic DNA. No translation available.
      AABR06012749 Genomic DNA. No translation available.
      AABR06012750 Genomic DNA. No translation available.
      AABR06012751 Genomic DNA. No translation available.
      AABR06012752 Genomic DNA. No translation available.
      AABR06012753 Genomic DNA. No translation available.
      AABR06012754 Genomic DNA. No translation available.
      AABR06012755 Genomic DNA. No translation available.
      AABR06012756 Genomic DNA. No translation available.
      AABR06012757 Genomic DNA. No translation available.
      AABR06012758 Genomic DNA. No translation available.
      AABR06012759 Genomic DNA. No translation available.
      AABR06012760 Genomic DNA. No translation available.
      L27059 mRNA. Translation: AAA56857.1 .
      L27060 mRNA. Translation: AAC26969.1 .
      PIRi B53109.
      I61259.
      RefSeqi NP_001106799.1. NM_001113328.1.
      NP_001106800.1. NM_001113329.1. [P14270-4 ]
      NP_001106803.1. NM_001113332.1. [P14270-8 ]
      NP_001106805.1. NM_001113334.1. [P14270-9 ]
      NP_058728.1. NM_017032.1. [P14270-1 ]
      UniGenei Rn.163460.
      Rn.95959.

      3D structure databases

      ProteinModelPortali P14270.
      SMRi P14270. Positions 376-736.
      ModBasei Search...
      MobiDBi Search...

      Protein-protein interaction databases

      BioGridi 246765. 4 interactions.
      IntActi P14270. 2 interactions.
      STRINGi 10116.ENSRNOP00000015138.

      Chemistry

      BindingDBi P14270.
      ChEMBLi CHEMBL2094267.

      PTM databases

      PhosphoSitei P14270.

      Proteomic databases

      PRIDEi P14270.

      Protocols and materials databases

      Structural Biology Knowledgebase Search...

      Genome annotation databases

      Ensembli ENSRNOT00000015138 ; ENSRNOP00000015138 ; ENSRNOG00000042536 . [P14270-6 ]
      ENSRNOT00000066384 ; ENSRNOP00000063446 ; ENSRNOG00000042536 . [P14270-9 ]
      ENSRNOT00000067546 ; ENSRNOP00000062384 ; ENSRNOG00000042536 . [P14270-7 ]
      ENSRNOT00000073552 ; ENSRNOP00000067171 ; ENSRNOG00000042536 . [P14270-8 ]
      GeneIDi 24627.
      KEGGi rno:24627.

      Organism-specific databases

      CTDi 5144.
      RGDi 3281. Pde4d.

      Phylogenomic databases

      eggNOGi NOG122287.
      GeneTreei ENSGT00740000115148.
      HOVERGENi HBG108239.
      KOi K01120.
      OMAi QHEVEMP.
      PhylomeDBi P14270.

      Enzyme and pathway databases

      UniPathwayi UPA00762 ; UER00747 .

      Miscellaneous databases

      NextBioi 35580187.

      Gene expression databases

      Genevestigatori P14270.

      Family and domain databases

      Gene3Di 1.10.1300.10. 1 hit.
      InterProi IPR003607. HD/PDEase_dom.
      IPR023088. PDEase.
      IPR002073. PDEase_catalytic_dom.
      IPR023174. PDEase_CS.
      [Graphical view ]
      Pfami PF00233. PDEase_I. 1 hit.
      [Graphical view ]
      PRINTSi PR00387. PDIESTERASE1.
      SMARTi SM00471. HDc. 1 hit.
      [Graphical view ]
      PROSITEi PS00126. PDEASE_I. 1 hit.
      [Graphical view ]
      ProtoNeti Search...

      Publicationsi

      1. "The mRNA encoding a high-affinity cAMP phosphodiesterase is regulated by hormones and cAMP."
        Swinnen J.V., Joseph D.R., Conti M.
        Proc. Natl. Acad. Sci. U.S.A. 86:8197-8201(1989) [PubMed] [Europe PMC] [Abstract]
        Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 31), INDUCTION.
        Tissue: Testis.
      2. "The ratPDE3/IVd phosphodiesterase gene codes for multiple proteins differentially activated by cAMP-dependent protein kinase."
        Sette C., Vicini E., Conti M.
        J. Biol. Chem. 269:18271-18274(1994) [PubMed] [Europe PMC] [Abstract]
        Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 31; 32 AND 33).
      3. Conti M.
        Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
        Cited for: SEQUENCE REVISION TO 6.
      4. "Structure of two rat genes coding for closely related rolipram-sensitive cAMP phosphodiesterases. Multiple mRNA variants originate from alternative splicing and multiple start sites."
        Monaco L., Vicini E., Conti M.
        J. Biol. Chem. 269:347-357(1994) [PubMed] [Europe PMC] [Abstract]
        Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 31 AND 32).
        Strain: Wistar.
      5. Erratum
        Monaco L., Vicini E., Conti M.
        J. Biol. Chem. 269:20806-20806(1994)
      6. "Characterization of a cAMP-specific phosphodiesterase variant (PDE4D4) expressed in the rat brain."
        Jin S.-L.C., Kuo W.-P., Conti M.
        Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
        Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
        Strain: Sprague-Dawley.
        Tissue: Brain.
      7. "Cloning and characterization of novel PDE4D isoforms PDE4D6 and PDE4D7."
        Wang D., Deng C., Bugaj-Gaweda B., Kwan M., Gunwaldsen C., Leonard C., Xin X., Hu Y., Unterbeck A., De Vivo M.
        Cell. Signal. 15:883-891(2003) [PubMed] [Europe PMC] [Abstract]
        Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 6 AND 7).
        Strain: Sprague-Dawley.
      8. "Alterations in proteoglycan synthesis selectively impair FSH-induced particulate cAMP-phosphodiesterase 4 (PDE4) activation in immature rat Sertoli cells."
        Levallet G., Levallet J., Bonnamy P.J.
        Biochim. Biophys. Acta 1770:638-648(2007) [PubMed] [Europe PMC] [Abstract]
        Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5 AND 8), BIOPHYSICOCHEMICAL PROPERTIES, ENZYME REGULATION, TISSUE SPECIFICITY.
        Strain: Sprague-Dawley.
      9. "Novel PDE4D isoform, PDE4D9."
        Gaweda B., De Vivo M., Wang D.
        Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases
        Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 9).
      10. "Genome sequence of the Brown Norway rat yields insights into mammalian evolution."
        Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J., Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G., Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G., Morgan M.
        , Hawes A., Gill R., Holt R.A., Adams M.D., Amanatides P.G., Baden-Tillson H., Barnstead M., Chin S., Evans C.A., Ferriera S., Fosler C., Glodek A., Gu Z., Jennings D., Kraft C.L., Nguyen T., Pfannkoch C.M., Sitter C., Sutton G.G., Venter J.C., Woodage T., Smith D., Lee H.-M., Gustafson E., Cahill P., Kana A., Doucette-Stamm L., Weinstock K., Fechtel K., Weiss R.B., Dunn D.M., Green E.D., Blakesley R.W., Bouffard G.G., De Jong P.J., Osoegawa K., Zhu B., Marra M., Schein J., Bosdet I., Fjell C., Jones S., Krzywinski M., Mathewson C., Siddiqui A., Wye N., McPherson J., Zhao S., Fraser C.M., Shetty J., Shatsman S., Geer K., Chen Y., Abramzon S., Nierman W.C., Havlak P.H., Chen R., Durbin K.J., Egan A., Ren Y., Song X.-Z., Li B., Liu Y., Qin X., Cawley S., Cooney A.J., D'Souza L.M., Martin K., Wu J.Q., Gonzalez-Garay M.L., Jackson A.R., Kalafus K.J., McLeod M.P., Milosavljevic A., Virk D., Volkov A., Wheeler D.A., Zhang Z., Bailey J.A., Eichler E.E., Tuzun E., Birney E., Mongin E., Ureta-Vidal A., Woodwark C., Zdobnov E., Bork P., Suyama M., Torrents D., Alexandersson M., Trask B.J., Young J.M., Huang H., Wang H., Xing H., Daniels S., Gietzen D., Schmidt J., Stevens K., Vitt U., Wingrove J., Camara F., Mar Alba M., Abril J.F., Guigo R., Smit A., Dubchak I., Rubin E.M., Couronne O., Poliakov A., Huebner N., Ganten D., Goesele C., Hummel O., Kreitler T., Lee Y.-A., Monti J., Schulz H., Zimdahl H., Himmelbauer H., Lehrach H., Jacob H.J., Bromberg S., Gullings-Handley J., Jensen-Seaman M.I., Kwitek A.E., Lazar J., Pasko D., Tonellato P.J., Twigger S., Ponting C.P., Duarte J.M., Rice S., Goodstadt L., Beatson S.A., Emes R.D., Winter E.E., Webber C., Brandt P., Nyakatura G., Adetobi M., Chiaromonte F., Elnitski L., Eswara P., Hardison R.C., Hou M., Kolbe D., Makova K., Miller W., Nekrutenko A., Riemer C., Schwartz S., Taylor J., Yang S., Zhang Y., Lindpaintner K., Andrews T.D., Caccamo M., Clamp M., Clarke L., Curwen V., Durbin R.M., Eyras E., Searle S.M., Cooper G.M., Batzoglou S., Brudno M., Sidow A., Stone E.A., Payseur B.A., Bourque G., Lopez-Otin C., Puente X.S., Chakrabarti K., Chatterji S., Dewey C., Pachter L., Bray N., Yap V.B., Caspi A., Tesler G., Pevzner P.A., Haussler D., Roskin K.M., Baertsch R., Clawson H., Furey T.S., Hinrichs A.S., Karolchik D., Kent W.J., Rosenbloom K.R., Trumbower H., Weirauch M., Cooper D.N., Stenson P.D., Ma B., Brent M., Arumugam M., Shteynberg D., Copley R.R., Taylor M.S., Riethman H., Mudunuri U., Peterson J., Guyer M., Felsenfeld A., Old S., Mockrin S., Collins F.S.
        Nature 428:493-521(2004) [PubMed] [Europe PMC] [Abstract]
        Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
        Strain: Brown Norway.
      11. "Molecular cloning of rat homologues of the Drosophila melanogaster dunce cAMP phosphodiesterase: evidence for a family of genes."
        Swinnen J.V., Joseph D.R., Conti M.
        Proc. Natl. Acad. Sci. U.S.A. 86:5325-5329(1989) [PubMed] [Europe PMC] [Abstract]
        Cited for: NUCLEOTIDE SEQUENCE OF 224-672.
        Tissue: Testis.
      12. "Differential CNS expression of alternative mRNA isoforms of the mammalian genes encoding cAMP-specific phosphodiesterases."
        Bolger G.B., Rodgers L., Riggs M.
        Gene 149:237-244(1994) [PubMed] [Europe PMC] [Abstract]
        Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 226-803 (ISOFORM 33), NUCLEOTIDE SEQUENCE [MRNA] OF 253-803 (ISOFORM 31).
      13. "Phosphorylation-mediated activation and translocation of the cyclic AMP-specific phosphodiesterase PDE4D3 by cyclic AMP-dependent protein kinase and mitogen-activated protein kinases. A potential mechanism allowing for the coordinated regulation of PDE4D activity and targeting."
        Liu H., Maurice D.H.
        J. Biol. Chem. 274:10557-10565(1999) [PubMed] [Europe PMC] [Abstract]
        Cited for: PHOSPHORYLATION, SUBCELLULAR LOCATION.
      14. "Myomegalin is a novel protein of the Golgi/centrosome that interacts with a cyclic nucleotide phosphodiesterase."
        Verde I., Pahlke G., Salanova M., Zhang G., Wang S., Coletti D., Onuffer J., Jin S.-L.C., Conti M.
        J. Biol. Chem. 276:11189-11198(2001) [PubMed] [Europe PMC] [Abstract]
        Cited for: INTERACTION WITH PDE4DIP.
      15. "Phosphodiesterase 4D and protein kinase a type II constitute a signaling unit in the centrosomal area."
        Tasken K.A., Collas P., Kemmner W.A., Witczak O., Conti M., Tasken K.
        J. Biol. Chem. 276:21999-22002(2001) [PubMed] [Europe PMC] [Abstract]
        Cited for: SUBCELLULAR LOCATION, INTERACTION WITH THE CENTROSOME (ISOFORM 33).
      16. "Splice variants of the cyclic nucleotide phosphodiesterase PDE4D are differentially expressed and regulated in rat tissue."
        Richter W., Jin S.L., Conti M.
        Biochem. J. 388:803-811(2005) [PubMed] [Europe PMC] [Abstract]
        Cited for: ALTERNATIVE SPLICING (ISOFORMS 4; 5; 6; 7; 8; 9; 31; 32 AND 33).
      17. "Dynamic regulation of cystic fibrosis transmembrane conductance regulator by competitive interactions of molecular adaptors."
        Lee J.H., Richter W., Namkung W., Kim K.H., Kim E., Conti M., Lee M.G.
        J. Biol. Chem. 282:10414-10422(2007) [PubMed] [Europe PMC] [Abstract]
        Cited for: INTERACTION WITH SHANK2, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

      Entry informationi

      Entry nameiPDE4D_RAT
      AccessioniPrimary (citable) accession number: P14270
      Secondary accession number(s): A1E347
      , A1EC59, F1M1H7, O35470, Q6TRI0, Q8CG04, Q8CG06
      Entry historyi
      Integrated into UniProtKB/Swiss-Prot: January 1, 1990
      Last sequence update: January 4, 2005
      Last modified: October 1, 2014
      This is version 127 of the entry and version 4 of the sequence. [Complete history]
      Entry statusiReviewed (UniProtKB/Swiss-Prot)
      Annotation programChordata Protein Annotation Program

      Miscellaneousi

      Keywords - Technical termi

      Complete proteome, Reference proteome

      Documents

      1. PATHWAY comments
        Index of metabolic and biosynthesis pathways
      2. SIMILARITY comments
        Index of protein domains and families

      External Data

      Dasty 3