P14138 (EDN3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 143.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Endothelin-3 Short name=ET-3 Alternative name(s): Preproendothelin-3 Short name=PPET3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 238 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Endothelins are endothelium-derived vasoconstrictor peptides. |
| Subcellular location | |
| Tissue specificity | Expressed in trophoblasts and placental stem villi vessels, but not in cultured placental smooth muscle cells. Ref.9 |
| Involvement in disease | Hirschsprung disease 4 (HSCR4) [MIM:613712]: A disorder of neural crest development characterized by absence of enteric ganglia along a variable length of the intestine. It is the most common cause of congenital intestinal obstruction. Early symptoms range from complete acute neonatal obstruction, characterized by vomiting, abdominal distention and failure to pass stool, to chronic constipation in the older child. Congenital central hypoventilation syndrome (CCHS) [MIM:209880]: Rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. Waardenburg syndrome 4B (WS4B) [MIM:613265]: A disorder characterized by the association of Waardenburg features (depigmentation and deafness) with the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease). |
| Sequence similarities | Belongs to the endothelin/sarafotoxin family. |
| Sequence caution | The sequence AAR16083.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: P14138-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: P14138-2) The sequence of this isoform differs from the canonical sequence as follows: 181-196: SNSRTAEKTDKEEEGK → RQ | ||||||
| Isoform 3 (identifier: P14138-3) The sequence of this isoform differs from the canonical sequence as follows: 198-238: EVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP → RGANRGLCQRRLKSRTNKASRL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 16 | 16 | Potential | ||||||||
| Propeptide | 17 – 94 | 78 | PRO_0000008111 | ||||||||
| Peptide | 97 – 117 | 21 | Endothelin-3 | PRO_0000008112 | |||||||
| Propeptide | 118 – 238 | 121 | PRO_0000008113 | ||||||||
Regions | |||||||||||
| Region | 159 – 173 | 15 | Endothelin-like | ||||||||
Sites | |||||||||||
| Site | 117 – 118 | 2 | Cleavage; by KEL | ||||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 97 ↔ 111 | ||||||||||
| Disulfide bond | 99 ↔ 107 | ||||||||||
Natural variations | |||||||||||
| Alternative sequence | 181 – 196 | 16 | SNSRT…EEEGK → RQ in isoform Short. | VSP_001445 | |||||||
| Alternative sequence | 198 – 238 | 41 | EVKDQ…QEGAP → RGANRGLCQRRLKSRTNKAS RL in isoform 3. | VSP_043139 | |||||||
| Natural variant | 17 | 1 | A → T in HSCR4. Ref.4 Ref.14 Corresponds to variant rs11570255 [ dbSNP | Ensembl ]. | VAR_009078 | |||||||
| Natural variant | 127 | 1 | Y → C in WS4B. Ref.16 | VAR_015238 | |||||||
| Natural variant | 159 | 1 | C → F in WS4B. Ref.12 | VAR_002353 | |||||||
| Natural variant | 224 | 1 | A → T in HSCR4. Ref.14 Corresponds to variant rs11570351 [ dbSNP | Ensembl ]. | VAR_009079 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning and chromosomal assignment of the gene encoding endothelin 3." Bloch K.D., Eddy R.L., Shows T.B., Quertermous T. J. Biol. Chem. 264:18156-18161(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [2] | "One of the endothelin gene family, endothelin 3 gene, is expressed in the placenta." Onda H., Ohkubo S., Ogi K., Kosaka T., Kimura C., Matsumoto H., Suzuki N., Fujino M. FEBS Lett. 261:327-330(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). Tissue: Placenta. |
| [3] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG). |
| [4] | NIEHS SNPs program Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-17. |
| [5] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND 3). Tissue: Lung and Muscle. |
| [8] | "Proteolytic processing of big endothelin-3 by the kell blood group protein." Lee S., Lin M., Mele A., Cao Y., Farmar J., Russo D., Redman C. Blood 94:1440-1450(1999) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE, CLEAVAGE BY KELL, MASS SPECTROMETRY. |
| [9] | "Endothelin-1 and ETA receptor expression in vascular smooth muscle cells from human placenta: a new ETA receptor messenger ribonucleic acid is generated by alternative splicing of exon 3." Bourgeois C., Robert B., Rebourcet R., Mondon F., Mignot T.-M., Duc-Goiran P., Ferre F. J. Clin. Endocrinol. Metab. 82:3116-3123(1997) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [10] | "Solution structure of endothelin-3 determined using NMR spectroscopy." Mills R.G., O'Donoghue S.I., Smith R., King G.F. Biochemistry 31:5640-5645(1992) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF ET-3. |
| [11] | "Mutations in Hirschsprung disease: when does a mutation contribute to the phenotype." Hofstra R.M.W., Osinga J., Buys C.H.C.M. Eur. J. Hum. Genet. 5:180-185(1997) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON VARIANTS. |
| [12] | "A homozygous mutation in the endothelin-3 gene associated with a combined Waardenburg type 2 and Hirschsprung phenotype (Shah-Waardenburg syndrome)." Hofstra R.M.W., Tan-Sindhunata G., Wu Y., Kamsteeg E.-J., Stulp R.P., van Ravenswaaij-Arts C., Majoor-Krakauer D., Angrist M., Chakravarti A., Meijers C., Buys C.H.C.M. Nat. Genet. 12:445-447(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT WS4B PHE-159. |
| [13] | "Endothelin-3 frameshift mutation in congenital central hypoventilation syndrome." Bolk S., Angrist M., Xie J., Yanagisawa M., Silvestri J.M., Weese-Mayer D.E., Chakravarti A. Nat. Genet. 13:395-396(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN CCHS. |
| [14] | "Endothelin-3 gene mutations in isolated and syndromic Hirschsprung disease." Bidaud C., Salomon R., Van Camp G., Pelet A., Attie T., Eng C., Bonduelle M., Amiel J., Nihoul-Fekete C., Willems P.J., Munnich A., Lyonnet S. Eur. J. Hum. Genet. 5:247-251(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HSCR4 THR-17 AND THR-224. |
| [15] | "A heterozygous endothelin 3 mutation in Waardenburg-Hirschsprung disease: is there a dosage effect of EDN3/EDNRB gene mutations on neurocristopathy phenotypes?" Pingault V., Bondurand N., Lemort N., Sancandi M., Ceccherini I., Hugot J.P., Jouk P.S., Goossens M. J. Med. Genet. 38:205-209(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN WS4B. |
| [16] | "SOX10 mutations in chronic intestinal pseudo-obstruction suggest a complex physiopathological mechanism." Pingault V., Girard M., Bondurand N., Dorkins H., Van Maldergem L., Mowat D., Shimotake T., Verma I., Baumann C., Goossens M. Hum. Genet. 111:198-206(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT WS4B CYS-127. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | J05081 mRNA. Translation: AAA52405.1. X52001 mRNA. Translation: CAA36252.1. BT007085 mRNA. Translation: AAP35748.1. AY444503 Genomic DNA. Translation: AAR16083.1. Sequence problems. AL035250 Genomic DNA. Translation: CAB65996.1. AL035250 Genomic DNA. Translation: CAB65997.2. AL035250 Genomic DNA. Translation: CAB65998.1. CH471077 Genomic DNA. Translation: EAW75434.1. CH471077 Genomic DNA. Translation: EAW75435.1. CH471077 Genomic DNA. Translation: EAW75437.1. BC008876 mRNA. Translation: AAH08876.1. BC053866 mRNA. Translation: AAH53866.1. |
| IPI | IPI00025365. IPI00220210. IPI00410367. |
| PIR | A34378. |
| RefSeq | NP_000105.1. NM_000114.2. NP_996915.1. NM_207032.1. NP_996916.1. NM_207033.1. NP_996917.1. NM_207034.1. |
| UniGene | Hs.1408. |
3D structure databases | |
| ProteinModelPortal | P14138. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000337128. |
Polymorphism databases | |
| DMDM | 119618. |
Proteomic databases | |
| PaxDb | P14138. |
| PRIDE | P14138. |
Protocols and materials databases | |
| DNASU | 1908. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000311585; ENSP00000311854; ENSG00000124205. ENST00000337938; ENSP00000337128; ENSG00000124205. ENST00000371028; ENSP00000360067; ENSG00000124205. ENST00000395654; ENSP00000379015; ENSG00000124205. |
| GeneID | 1908. |
| KEGG | hsa:1908. |
| UCSC | uc002yap.3. human. uc002yas.3. human. |
Organism-specific databases | |
| CTD | 1908. |
| GeneCards | GC20P057875. |
| HGNC | HGNC:3178. EDN3. |
| MIM | 131242. gene. 209880. phenotype. 613265. phenotype. 613712. phenotype. |
| neXtProt | NX_P14138. |
| Orphanet | 388. Hirschsprung disease. 661. Ondine syndrome. 897. Waardenburg-Shah syndrome. |
| PharmGKB | PA27616. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG41573. |
| HOGENOM | HOG000231110. |
| HOVERGEN | HBG051442. |
| InParanoid | P14138. |
| KO | K05227. |
| OMA | DCEETVA. |
| OrthoDB | EOG4Z62PG. |
| PhylomeDB | P14138. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | endothelinpathway. Endothelins. |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | P14138. |
| Bgee | P14138. |
| CleanEx | HS_EDN3. |
| Genevestigator | P14138. |
| GermOnline | ENSG00000124205. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR020475. Bibrotoxin/Sarafotoxin-D. IPR019764. Endothelin_toxin_CS. IPR001928. Endothln-like_toxin. [Graphical view] |
| Pfam | PF00322. Endothelin. 1 hit. [Graphical view] |
| PRINTS | PR00365. ENDOTHELIN. |
| SMART | SM00272. END. 2 hits. [Graphical view] |
| PROSITE | PS00270. ENDOTHELIN. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 1908. |
| NextBio | 7765. |
| PMAP-CutDB | P14138. |
| SOURCE | Search... |
Entry information
| Entry name | EDN3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P14138 Secondary accession number(s): E1P5I5 Q9UGT7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
