Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P14138

- EDN3_HUMAN

UniProt

P14138 - EDN3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Endothelin-3

Gene

EDN3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Endothelins are endothelium-derived vasoconstrictor peptides.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei117 – 1182Cleavage; by KEL

GO - Molecular functioni

  1. hormone activity Source: BHF-UCL
  2. receptor binding Source: ProtInc

GO - Biological processi

  1. blood circulation Source: ProtInc
  2. cell-cell signaling Source: ProtInc
  3. cell surface receptor signaling pathway Source: BHF-UCL
  4. inositol phosphate-mediated signaling Source: BHF-UCL
  5. melanocyte differentiation Source: Ensembl
  6. multicellular organismal development Source: ProtInc
  7. neural crest cell migration Source: Ensembl
  8. neuron differentiation Source: Ensembl
  9. neutrophil chemotaxis Source: BHF-UCL
  10. peptide hormone secretion Source: BHF-UCL
  11. positive regulation of cell proliferation Source: Ensembl
  12. positive regulation of heart rate Source: BHF-UCL
  13. positive regulation of hormone secretion Source: BHF-UCL
  14. positive regulation of leukocyte chemotaxis Source: BHF-UCL
  15. positive regulation of MAP kinase activity Source: BHF-UCL
  16. positive regulation of mitosis Source: BHF-UCL
  17. regulation of developmental pigmentation Source: Ensembl
  18. regulation of systemic arterial blood pressure by endothelin Source: BHF-UCL
  19. regulation of vasoconstriction Source: InterPro
  20. signal transduction Source: ProtInc
  21. vasoconstriction Source: BHF-UCL
  22. vein smooth muscle contraction Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Vasoactive, Vasoconstrictor

Enzyme and pathway databases

ReactomeiREACT_14819. Peptide ligand-binding receptors.
REACT_18283. G alpha (q) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Endothelin-3
Short name:
ET-3
Alternative name(s):
Preproendothelin-3
Short name:
PPET3
Gene namesi
Name:EDN3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 20

Organism-specific databases

HGNCiHGNC:3178. EDN3.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: Reactome
  2. extracellular space Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Involvement in diseasei

Hirschsprung disease 4 (HSCR4) [MIM:613712]: A disorder of neural crest development characterized by absence of enteric ganglia along a variable length of the intestine. It is the most common cause of congenital intestinal obstruction. Early symptoms range from complete acute neonatal obstruction, characterized by vomiting, abdominal distention and failure to pass stool, to chronic constipation in the older child.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti17 – 171A → T in HSCR4. 2 Publications
Corresponds to variant rs11570255 [ dbSNP | Ensembl ].
VAR_009078
Natural varianti224 – 2241A → T in HSCR4. 1 Publication
Corresponds to variant rs11570351 [ dbSNP | Ensembl ].
VAR_009079
Congenital central hypoventilation syndrome (CCHS) [MIM:209880]: Rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Waardenburg syndrome 4B (WS4B) [MIM:613265]: A disorder characterized by the association of Waardenburg features (depigmentation and deafness) with the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease).3 Publications
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti127 – 1271Y → C in WS4B. 1 Publication
VAR_015238
Natural varianti159 – 1591C → F in WS4B. 1 Publication
VAR_002353

Keywords - Diseasei

Deafness, Disease mutation, Hirschsprung disease, Waardenburg syndrome

Organism-specific databases

MIMi209880. phenotype.
613265. phenotype.
613712. phenotype.
Orphaneti388. Hirschsprung disease.
661. Ondine syndrome.
897. Waardenburg-Shah syndrome.
PharmGKBiPA27616.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616Sequence AnalysisAdd
BLAST
Propeptidei17 – 9478PRO_0000008111Add
BLAST
Peptidei97 – 11721Endothelin-3PRO_0000008112Add
BLAST
Propeptidei118 – 238121PRO_0000008113Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi97 ↔ 111
Disulfide bondi99 ↔ 107

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond

Proteomic databases

PaxDbiP14138.
PRIDEiP14138.

Miscellaneous databases

PMAP-CutDBP14138.

Expressioni

Tissue specificityi

Expressed in trophoblasts and placental stem villi vessels, but not in cultured placental smooth muscle cells.1 Publication

Gene expression databases

BgeeiP14138.
CleanExiHS_EDN3.
ExpressionAtlasiP14138. baseline and differential.
GenevestigatoriP14138.

Organism-specific databases

HPAiHPA057987.

Interactioni

Protein-protein interaction databases

BioGridi108230. 1 interaction.
STRINGi9606.ENSP00000337128.

Structurei

3D structure databases

ProteinModelPortaliP14138.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni159 – 17315Endothelin-likeAdd
BLAST

Sequence similaritiesi

Belongs to the endothelin/sarafotoxin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG41573.
GeneTreeiENSGT00530000063310.
HOGENOMiHOG000231110.
HOVERGENiHBG051442.
InParanoidiP14138.
KOiK05227.
OMAiHHRSRRC.
OrthoDBiEOG7PCJHP.
PhylomeDBiP14138.
TreeFamiTF333184.

Family and domain databases

InterProiIPR020475. Bibrotoxin/Sarafotoxin-D.
IPR019764. Endothelin_toxin_CS.
IPR001928. Endothln-like_toxin.
[Graphical view]
PfamiPF00322. Endothelin. 1 hit.
[Graphical view]
PRINTSiPR00365. ENDOTHELIN.
SMARTiSM00272. END. 2 hits.
[Graphical view]
PROSITEiPS00270. ENDOTHELIN. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform Long (identifier: P14138-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPGLWLLFG LTVTSAAGFV PCSQSGDAGR RGVSQAPTAA RSEGDCEETV
60 70 80 90 100
AGPGEETVAG PGEGTVAPTA LQGPSPGSPG QEQAAEGAPE HHRSRRCTCF
110 120 130 140 150
TYKDKECVYY CHLDIIWINT PEQTVPYGLS NYRGSFRGKR SAGPLPGNLQ
160 170 180 190 200
LSHRPHLRCA CVGRYDKACL HFCTQTLDVS SNSRTAEKTD KEEEGKVEVK
210 220 230
DQQSKQALDL HHPKLMPGSG LALAPSTCPR CLFQEGAP
Length:238
Mass (Da):25,454
Last modified:January 1, 1990 - v1
Checksum:i7D7E90BC7DE37273
GO
Isoform Short (identifier: P14138-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     181-196: SNSRTAEKTDKEEEGK → RQ

Show »
Length:224
Mass (Da):23,948
Checksum:i9A2295791A408FF3
GO
Isoform 3 (identifier: P14138-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-238: EVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP → RGANRGLCQRRLKSRTNKASRL

Show »
Length:219
Mass (Da):23,596
Checksum:iD3CF0513D34705AC
GO

Sequence cautioni

The sequence AAR16083.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti17 – 171A → T in HSCR4. 2 Publications
Corresponds to variant rs11570255 [ dbSNP | Ensembl ].
VAR_009078
Natural varianti127 – 1271Y → C in WS4B. 1 Publication
VAR_015238
Natural varianti159 – 1591C → F in WS4B. 1 Publication
VAR_002353
Natural varianti224 – 2241A → T in HSCR4. 1 Publication
Corresponds to variant rs11570351 [ dbSNP | Ensembl ].
VAR_009079

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei181 – 19616SNSRT…EEEGK → RQ in isoform Short. 1 PublicationVSP_001445Add
BLAST
Alternative sequencei198 – 23841EVKDQ…QEGAP → RGANRGLCQRRLKSRTNKAS RL in isoform 3. 1 PublicationVSP_043139Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
J05081 mRNA. Translation: AAA52405.1.
X52001 mRNA. Translation: CAA36252.1.
BT007085 mRNA. Translation: AAP35748.1.
AY444503 Genomic DNA. Translation: AAR16083.1. Sequence problems.
AL035250 Genomic DNA. Translation: CAB65996.1.
AL035250 Genomic DNA. Translation: CAB65997.2.
AL035250 Genomic DNA. Translation: CAB65998.1.
CH471077 Genomic DNA. Translation: EAW75434.1.
CH471077 Genomic DNA. Translation: EAW75435.1.
CH471077 Genomic DNA. Translation: EAW75437.1.
BC008876 mRNA. Translation: AAH08876.1.
BC053866 mRNA. Translation: AAH53866.1.
CCDSiCCDS13477.1. [P14138-1]
CCDS13478.1. [P14138-2]
CCDS13479.1. [P14138-3]
PIRiA34378.
RefSeqiNP_000105.1. NM_000114.2. [P14138-1]
NP_996915.1. NM_207032.1. [P14138-3]
NP_996916.1. NM_207033.1. [P14138-2]
NP_996917.1. NM_207034.1. [P14138-1]
UniGeneiHs.1408.

Genome annotation databases

EnsembliENST00000311585; ENSP00000311854; ENSG00000124205. [P14138-3]
ENST00000337938; ENSP00000337128; ENSG00000124205. [P14138-1]
ENST00000371028; ENSP00000360067; ENSG00000124205. [P14138-1]
ENST00000395654; ENSP00000379015; ENSG00000124205. [P14138-2]
GeneIDi1908.
KEGGihsa:1908.
UCSCiuc002yap.3. human. [P14138-1]
uc002yar.3. human. [P14138-3]
uc002yas.3. human. [P14138-2]

Polymorphism databases

DMDMi119618.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
J05081 mRNA. Translation: AAA52405.1 .
X52001 mRNA. Translation: CAA36252.1 .
BT007085 mRNA. Translation: AAP35748.1 .
AY444503 Genomic DNA. Translation: AAR16083.1 . Sequence problems.
AL035250 Genomic DNA. Translation: CAB65996.1 .
AL035250 Genomic DNA. Translation: CAB65997.2 .
AL035250 Genomic DNA. Translation: CAB65998.1 .
CH471077 Genomic DNA. Translation: EAW75434.1 .
CH471077 Genomic DNA. Translation: EAW75435.1 .
CH471077 Genomic DNA. Translation: EAW75437.1 .
BC008876 mRNA. Translation: AAH08876.1 .
BC053866 mRNA. Translation: AAH53866.1 .
CCDSi CCDS13477.1. [P14138-1 ]
CCDS13478.1. [P14138-2 ]
CCDS13479.1. [P14138-3 ]
PIRi A34378.
RefSeqi NP_000105.1. NM_000114.2. [P14138-1 ]
NP_996915.1. NM_207032.1. [P14138-3 ]
NP_996916.1. NM_207033.1. [P14138-2 ]
NP_996917.1. NM_207034.1. [P14138-1 ]
UniGenei Hs.1408.

3D structure databases

ProteinModelPortali P14138.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108230. 1 interaction.
STRINGi 9606.ENSP00000337128.

Polymorphism databases

DMDMi 119618.

Proteomic databases

PaxDbi P14138.
PRIDEi P14138.

Protocols and materials databases

DNASUi 1908.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000311585 ; ENSP00000311854 ; ENSG00000124205 . [P14138-3 ]
ENST00000337938 ; ENSP00000337128 ; ENSG00000124205 . [P14138-1 ]
ENST00000371028 ; ENSP00000360067 ; ENSG00000124205 . [P14138-1 ]
ENST00000395654 ; ENSP00000379015 ; ENSG00000124205 . [P14138-2 ]
GeneIDi 1908.
KEGGi hsa:1908.
UCSCi uc002yap.3. human. [P14138-1 ]
uc002yar.3. human. [P14138-3 ]
uc002yas.3. human. [P14138-2 ]

Organism-specific databases

CTDi 1908.
GeneCardsi GC20P057875.
GeneReviewsi EDN3.
HGNCi HGNC:3178. EDN3.
HPAi HPA057987.
MIMi 131242. gene.
209880. phenotype.
613265. phenotype.
613712. phenotype.
neXtProti NX_P14138.
Orphaneti 388. Hirschsprung disease.
661. Ondine syndrome.
897. Waardenburg-Shah syndrome.
PharmGKBi PA27616.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG41573.
GeneTreei ENSGT00530000063310.
HOGENOMi HOG000231110.
HOVERGENi HBG051442.
InParanoidi P14138.
KOi K05227.
OMAi HHRSRRC.
OrthoDBi EOG7PCJHP.
PhylomeDBi P14138.
TreeFami TF333184.

Enzyme and pathway databases

Reactomei REACT_14819. Peptide ligand-binding receptors.
REACT_18283. G alpha (q) signalling events.

Miscellaneous databases

GeneWikii Endothelin_3.
GenomeRNAii 1908.
NextBioi 7765.
PMAP-CutDB P14138.
PROi P14138.
SOURCEi Search...

Gene expression databases

Bgeei P14138.
CleanExi HS_EDN3.
ExpressionAtlasi P14138. baseline and differential.
Genevestigatori P14138.

Family and domain databases

InterProi IPR020475. Bibrotoxin/Sarafotoxin-D.
IPR019764. Endothelin_toxin_CS.
IPR001928. Endothln-like_toxin.
[Graphical view ]
Pfami PF00322. Endothelin. 1 hit.
[Graphical view ]
PRINTSi PR00365. ENDOTHELIN.
SMARTi SM00272. END. 2 hits.
[Graphical view ]
PROSITEi PS00270. ENDOTHELIN. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "cDNA cloning and chromosomal assignment of the gene encoding endothelin 3."
    Bloch K.D., Eddy R.L., Shows T.B., Quertermous T.
    J. Biol. Chem. 264:18156-18161(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
  2. "One of the endothelin gene family, endothelin 3 gene, is expressed in the placenta."
    Onda H., Ohkubo S., Ogi K., Kosaka T., Kimura C., Matsumoto H., Suzuki N., Fujino M.
    FEBS Lett. 261:327-330(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
    Tissue: Placenta.
  3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG).
  4. NIEHS SNPs program
    Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-17.
  5. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND 3).
    Tissue: Lung and Muscle.
  8. "Proteolytic processing of big endothelin-3 by the kell blood group protein."
    Lee S., Lin M., Mele A., Cao Y., Farmar J., Russo D., Redman C.
    Blood 94:1440-1450(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL PROTEIN SEQUENCE, CLEAVAGE BY KELL, IDENTIFICATION BY MASS SPECTROMETRY.
  9. "Endothelin-1 and ETA receptor expression in vascular smooth muscle cells from human placenta: a new ETA receptor messenger ribonucleic acid is generated by alternative splicing of exon 3."
    Bourgeois C., Robert B., Rebourcet R., Mondon F., Mignot T.-M., Duc-Goiran P., Ferre F.
    J. Clin. Endocrinol. Metab. 82:3116-3123(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  10. "Solution structure of endothelin-3 determined using NMR spectroscopy."
    Mills R.G., O'Donoghue S.I., Smith R., King G.F.
    Biochemistry 31:5640-5645(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF ET-3.
  11. "Mutations in Hirschsprung disease: when does a mutation contribute to the phenotype."
    Hofstra R.M.W., Osinga J., Buys C.H.C.M.
    Eur. J. Hum. Genet. 5:180-185(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW ON VARIANTS.
  12. "A homozygous mutation in the endothelin-3 gene associated with a combined Waardenburg type 2 and Hirschsprung phenotype (Shah-Waardenburg syndrome)."
    Hofstra R.M.W., Tan-Sindhunata G., Wu Y., Kamsteeg E.-J., Stulp R.P., van Ravenswaaij-Arts C., Majoor-Krakauer D., Angrist M., Chakravarti A., Meijers C., Buys C.H.C.M.
    Nat. Genet. 12:445-447(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT WS4B PHE-159.
  13. "Endothelin-3 frameshift mutation in congenital central hypoventilation syndrome."
    Bolk S., Angrist M., Xie J., Yanagisawa M., Silvestri J.M., Weese-Mayer D.E., Chakravarti A.
    Nat. Genet. 13:395-396(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN CCHS.
  14. "Endothelin-3 gene mutations in isolated and syndromic Hirschsprung disease."
    Bidaud C., Salomon R., Van Camp G., Pelet A., Attie T., Eng C., Bonduelle M., Amiel J., Nihoul-Fekete C., Willems P.J., Munnich A., Lyonnet S.
    Eur. J. Hum. Genet. 5:247-251(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS HSCR4 THR-17 AND THR-224.
  15. "A heterozygous endothelin 3 mutation in Waardenburg-Hirschsprung disease: is there a dosage effect of EDN3/EDNRB gene mutations on neurocristopathy phenotypes?"
    Pingault V., Bondurand N., Lemort N., Sancandi M., Ceccherini I., Hugot J.P., Jouk P.S., Goossens M.
    J. Med. Genet. 38:205-209(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN WS4B.
  16. "SOX10 mutations in chronic intestinal pseudo-obstruction suggest a complex physiopathological mechanism."
    Pingault V., Girard M., Bondurand N., Dorkins H., Van Maldergem L., Mowat D., Shimotake T., Verma I., Baumann C., Goossens M.
    Hum. Genet. 111:198-206(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT WS4B CYS-127.

Entry informationi

Entry nameiEDN3_HUMAN
AccessioniPrimary (citable) accession number: P14138
Secondary accession number(s): E1P5I5
, Q03229, Q7Z6D2, Q9UGT7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: January 1, 1990
Last modified: October 29, 2014
This is version 157 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3