P14099 (PDE2A_BOVIN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: cGMP-dependent 3',5'-cyclic phosphodiesterase EC=3.1.4.17 Alternative name(s): Cyclic GMP-stimulated phosphodiesterase Short name=CGS-PDE Short name=cGSPDE | ||
| Gene names |
| ||
| Organism | Bos taurus (Bovine) [Reference proteome] | ||
| Taxonomic identifier | 9913 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Laurasiatheria › Cetartiodactyla › Ruminantia › Pecora › Bovidae › Bovinae › Bos![]() |
Protein attributes
| Sequence length | 921 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes By similarity. |
| Catalytic activity | Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate. |
| Cofactor | Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity. |
| Subunit structure | Homodimer. |
| Subcellular location | Membrane; Peripheral membrane protein Potential. |
| Domain | GAF 1 functions as a dimerization domain, whereas GAF 2 binds cGMP, which causes activation of the catalytic activity of the enzyme By similarity. |
| Miscellaneous | cGMP binds at an allosteric activator site By similarity. |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily. Contains 2 GAF domains. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform PDE2A1 (identifier: P14099-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PDE2A2 (identifier: P14099-3) The sequence of this isoform is not available. | ||||||
| Isoform PDE2A3 (identifier: P14099-2) The sequence of this isoform differs from the canonical sequence as follows: 1-25: MRRQPAASRDLFAQEPVPPGSGDGA → MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 921 | 921 | cGMP-dependent 3',5'-cyclic phosphodiesterase | PRO_0000198795 | |||||
Regions | |||||||||
| Domain | 220 – 357 | 138 | GAF 1 | ||||||
| Domain | 389 – 528 | 140 | GAF 2 | ||||||
| Region | 613 – 871 | 259 | Catalytic | ||||||
| Region | 636 – 640 | 5 | Substrate binding By similarity | ||||||
Sites | |||||||||
| Active site | 636 | 1 | Proton donor By similarity | ||||||
| Metal binding | 640 | 1 | Divalent metal cation 1 By similarity | ||||||
| Metal binding | 676 | 1 | Divalent metal cation 1 By similarity | ||||||
| Metal binding | 677 | 1 | Divalent metal cation 1 By similarity | ||||||
| Metal binding | 677 | 1 | Divalent metal cation 2 By similarity | ||||||
| Metal binding | 788 | 1 | Divalent metal cation 1 By similarity | ||||||
| Binding site | 411 | 1 | cGMP By similarity | ||||||
| Binding site | 426 | 1 | cGMP By similarity | ||||||
| Binding site | 479 | 1 | cGMP By similarity | ||||||
| Binding site | 677 | 1 | Substrate By similarity | ||||||
| Binding site | 788 | 1 | Substrate By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.3 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 25 | 25 | MRRQP…SGDGA → MGQACGHSILCRSQQYPAAR PAEPRGQQVFLKPDEPPPPP QPCADS in isoform PDE2A3. | VSP_004555 | |||||
Experimental info | |||||||||
| Sequence conflict | 204 | 1 | N → D in AAA87353. Ref.2 | ||||||
| Sequence conflict | 633 | 1 | P → L AA sequence Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Molecular cloning of a cyclic GMP-stimulated cyclic nucleotide phosphodiesterase cDNA. Identification and distribution of isozyme variants." Sonnenburg W.K., Mullaney P.J., Beavo J.A. J. Biol. Chem. 266:17655-17661(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE2A1). |
| [2] | Juilfs D.M., Sonnenburg W.K., Seraji S., Beavo J.A. Submitted (FEB-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE2A3). Tissue: Brain. |
| [3] | "Amino acid sequence of the cyclic GMP stimulated cyclic nucleotide phosphodiesterase from bovine heart." le Trong H., Beier N., Sonnenburg W.K., Stroop S.D., Walsh K.A., Beavo J.A., Charbonneau H. Biochemistry 29:10280-10288(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 592-921. Tissue: Heart. |
| [4] | "Identification of a conserved domain among cyclic nucleotide phosphodiesterases from diverse species." Charbonneau H., Beier N., Walsh K.A., Beavo J.A. Proc. Natl. Acad. Sci. U.S.A. 83:9308-9312(1986) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 613-694 AND 808-868. Tissue: Heart. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M73512 mRNA. Translation: AAA74559.1. L49503 mRNA. Translation: AAA87353.1. |
| IPI | IPI00706399. IPI00706917. |
| PIR | A40981. |
| RefSeq | NP_001137318.1. NM_001143846.1. NP_001243202.1. NM_001256273.1. |
| UniGene | Bt.4716. |
3D structure databases | |
| ProteinModelPortal | P14099. |
| SMR | P14099. Positions 202-542, 558-895. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9913.ENSBTAP00000042623. |
Proteomic databases | |
| PRIDE | P14099. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 281971. |
| KEGG | bta:281971. |
Organism-specific databases | |
| CTD | 5138. |
Phylogenomic databases | |
| eggNOG | NOG270709. |
| HOGENOM | HOG000007068. |
| HOVERGEN | HBG053540. |
| KO | K01120. |
| OrthoDB | EOG4THVS9. |
Family and domain databases | |
| Gene3D | 1.10.1300.10. 1 hit. |
| InterPro | IPR003018. GAF. IPR003607. HD/PDEase_dom. IPR023088. PDEase. IPR002073. PDEase_catalytic_dom. IPR023174. PDEase_CS. [Graphical view] |
| Pfam | PF01590. GAF. 2 hits. PF00233. PDEase_I. 1 hit. [Graphical view] |
| PRINTS | PR00387. PDIESTERASE1. |
| SMART | SM00065. GAF. 2 hits. SM00471. HDc. 1 hit. [Graphical view] |
| PROSITE | PS00126. PDEASE_I. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P14099. |
| ChEMBL | CHEMBL3477. |
| NextBio | 20805842. |
Entry information
| Entry name | PDE2A_BOVIN | ||||||||
| Accession | Primary (citable) accession number: P14099 Secondary accession number(s): Q28064 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
