SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P13688

- CEAM1_HUMAN

UniProt

P13688 - CEAM1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Carcinoembryonic antigen-related cell adhesion molecule 1
Gene
CEACAM1, BGP, BGP1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. protein binding Source: IntAct

GO - Biological processi

  1. angiogenesis Source: UniProtKB
  2. cell migration Source: UniProtKB
  3. homophilic cell adhesion Source: UniProtKB
  4. integrin-mediated signaling pathway Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Carcinoembryonic antigen-related cell adhesion molecule 1
Alternative name(s):
Biliary glycoprotein 1
Short name:
BGP-1
CD_antigen: CD66a
Gene namesi
Name:CEACAM1
Synonyms:BGP, BGP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:1814. CEACAM1.

Subcellular locationi

Isoform 1 : Cell membrane; Single-pass type I membrane protein 2 Publications
Isoform 2 : Secreted 2 Publications
Isoform 3 : Secreted 2 Publications
Isoform 4 : Secreted 2 Publications
Isoform 5 : Cell membrane; Single-pass type I membrane protein 2 Publications
Isoform 6 : Cell membrane; Single-pass type I membrane protein 2 Publications
Isoform 7 : Cell membrane; Single-pass type I membrane protein 2 Publications
Isoform 8 : Cell membrane; Single-pass type I membrane protein
Note: Localizes to sites of cell-cell contact.2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini35 – 428394Extracellular Reviewed prediction
Add
BLAST
Transmembranei429 – 45224Helical; Reviewed prediction
Add
BLAST
Topological domaini453 – 52674Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. integral component of membrane Source: MGI
  3. integral component of plasma membrane Source: UniProtKB
  4. membrane Source: ProtInc
  5. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26358.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3434
Add
BLAST
Chaini35 – 526492Carcinoembryonic antigen-related cell adhesion molecule 1
PRO_0000014562Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei35 – 351Pyrrolidone carboxylic acid
Glycosylationi104 – 1041N-linked (GlcNAc...)1 Publication
Glycosylationi111 – 1111N-linked (GlcNAc...)1 Publication
Glycosylationi115 – 1151N-linked (GlcNAc...)
Glycosylationi152 – 1521N-linked (GlcNAc...)1 Publication
Disulfide bondi167 ↔ 215 Inferred
Glycosylationi182 – 1821N-linked (GlcNAc...) Reviewed prediction
Glycosylationi197 – 1971N-linked (GlcNAc...) Reviewed prediction
Glycosylationi208 – 2081N-linked (GlcNAc...)1 Publication
Glycosylationi224 – 2241N-linked (GlcNAc...)1 Publication
Glycosylationi232 – 2321N-linked (GlcNAc...) Reviewed prediction
Glycosylationi254 – 2541N-linked (GlcNAc...)
Disulfide bondi259 ↔ 299 Inferred
Glycosylationi274 – 2741N-linked (GlcNAc...) Reviewed prediction
Glycosylationi288 – 2881N-linked (GlcNAc...) Reviewed prediction
Glycosylationi292 – 2921N-linked (GlcNAc...) Reviewed prediction
Glycosylationi302 – 3021N-linked (GlcNAc...) Reviewed prediction
Glycosylationi309 – 3091N-linked (GlcNAc...) Reviewed prediction
Glycosylationi345 – 3451N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi348 ↔ 396 Inferred
Glycosylationi351 – 3511N-linked (GlcNAc...) Reviewed prediction
Glycosylationi363 – 3631N-linked (GlcNAc...)1 Publication
Glycosylationi378 – 3781N-linked (GlcNAc...)1 Publication
Glycosylationi405 – 4051N-linked (GlcNAc...)1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Pyrrolidone carboxylic acid

Proteomic databases

MaxQBiP13688.
PaxDbiP13688.
PRIDEiP13688.

PTM databases

PhosphoSiteiP13688.

Expressioni

Gene expression databases

ArrayExpressiP13688.
BgeeiP13688.
CleanExiHS_CEACAM1.
GenevestigatoriP13688.

Organism-specific databases

HPAiCAB002146.
HPA011041.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CARTPTQ165683EBI-4314481,EBI-4314526
CEACAM6P401992EBI-4314481,EBI-4314501
uspa1Q8GH8712EBI-4314481,EBI-7936357From a different organism.

Protein-protein interaction databases

BioGridi107103. 11 interactions.
IntActiP13688. 6 interactions.
MINTiMINT-5002435.
STRINGi9606.ENSP00000161559.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi37 – 459
Beta strandi51 – 566
Beta strandi60 – 7213
Helixi75 – 773
Beta strandi78 – 836
Turni84 – 874
Beta strandi88 – 914
Beta strandi99 – 1013
Beta strandi107 – 1093
Helixi114 – 1163
Beta strandi118 – 1269
Beta strandi132 – 1409

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2GK2X-ray2.20A/B34-141[»]
ProteinModelPortaliP13688.
SMRiP13688. Positions 34-414.

Miscellaneous databases

EvolutionaryTraceiP13688.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 142108Ig-like V-type
Add
BLAST
Domaini145 – 23288Ig-like C2-type 1
Add
BLAST
Domaini237 – 31781Ig-like C2-type 2
Add
BLAST
Domaini323 – 41391Ig-like C2-type 3
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG149650.
HOVERGENiHBG007922.
KOiK06499.
OMAiNTSYLWS.
OrthoDBiEOG74BJS7.
PhylomeDBiP13688.
TreeFamiTF336859.

Family and domain databases

Gene3Di2.60.40.10. 4 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR013151. Immunoglobulin.
[Graphical view]
PfamiPF00047. ig. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 2 hits.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 3 hits.
[Graphical view]

Sequences (11)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 11 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P13688-1) [UniParc]FASTAAdd to Basket

Also known as: BGPa, CEACAM1-4L, TM1-CEA

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGHLSAPLHR VRVPWQGLLL TASLLTFWNP PTTAQLTTES MPFNVAEGKE    50
VLLLVHNLPQ QLFGYSWYKG ERVDGNRQIV GYAIGTQQAT PGPANSGRET 100
IYPNASLLIQ NVTQNDTGFY TLQVIKSDLV NEEATGQFHV YPELPKPSIS 150
SNNSNPVEDK DAVAFTCEPE TQDTTYLWWI NNQSLPVSPR LQLSNGNRTL 200
TLLSVTRNDT GPYECEIQNP VSANRSDPVT LNVTYGPDTP TISPSDTYYR 250
PGANLSLSCY AASNPPAQYS WLINGTFQQS TQELFIPNIT VNNSGSYTCH 300
ANNSVTGCNR TTVKTIIVTE LSPVVAKPQI KASKTTVTGD KDSVNLTCST 350
NDTGISIRWF FKNQSLPSSE RMKLSQGNTT LSINPVKRED AGTYWCEVFN 400
PISKNQSDPI MLNVNYNALP QENGLSPGAI AGIVIGVVAL VALIAVALAC 450
FLHFGKTGRA SDQRDLTEHK PSVSNHTQDH SNDPPNKMNE VTYSTLNFEA 500
QQPTQPTSAS PSLTATEIIY SEVKKQ 526
Length:526
Mass (Da):57,560
Last modified:July 1, 1993 - v2
Checksum:iCAD1B2328D069AF8
GO
Isoform 2 (identifier: P13688-2) [UniParc]FASTAAdd to Basket

Also known as: BGPg, CEACAM1-4C1

The sequence of this isoform differs from the canonical sequence as follows:
     416-417: YN → CK
     418-526: Missing.

Show »
Length:417
Mass (Da):45,950
Checksum:i5D4B9F86184AA4B4
GO
Isoform 3 (identifier: P13688-3) [UniParc]FASTAAdd to Basket

Also known as: BGPh, CEACAM1-3

The sequence of this isoform differs from the canonical sequence as follows:
     320-321: EL → GK
     322-526: Missing.

Show »
Length:321
Mass (Da):35,302
Checksum:i81DE2F4E62AD42A7
GO
Isoform 4 (identifier: P13688-4) [UniParc]FASTAAdd to Basket

Also known as: BGPi, CEACAM1-3C2

The sequence of this isoform differs from the canonical sequence as follows:
     321-351: LSPVVAKPQIKASKTTVTGDKDSVNLTCSTN → SPVLGEDEAVPGQHHPQHKPCQEGGCWDVLV
     352-526: Missing.

Show »
Length:351
Mass (Da):38,578
Checksum:i33CEF445429E8DD4
GO
Isoform 5 (identifier: P13688-5) [UniParc]FASTAAdd to Basket

Also known as: BGPy, CEACAM1-3AL

The sequence of this isoform differs from the canonical sequence as follows:
     321-416: LSPVVAKPQI...SDPIMLNVNY → RQNLTMLPRLDSNSWAQAILPSVSQSAEITD

Show »
Length:461
Mass (Da):50,349
Checksum:iE7810D2559DF7A8F
GO
Isoform 6 (identifier: P13688-6) [UniParc]FASTAAdd to Basket

Also known as: BGPb, CEACAM1-3L, TM2-CEA

The sequence of this isoform differs from the canonical sequence as follows:
     320-416: ELSPVVAKPQ...SDPIMLNVNY → D

Show »
Length:430
Mass (Da):46,910
Checksum:i195DE9F171D1414F
GO
Isoform 7 (identifier: P13688-7) [UniParc]FASTAAdd to Basket

Also known as: BGPx, CEACAM1-1L

The sequence of this isoform differs from the canonical sequence as follows:
     143-416: Missing.

Show »
Length:252
Mass (Da):27,431
Checksum:i6C85A702292B6367
GO
Isoform 8 (identifier: P13688-8) [UniParc]FASTAAdd to Basket

Also known as: BGPc, CEACAM1-4S, TM3-CEA

The sequence of this isoform differs from the canonical sequence as follows:
     459-464: RASDQR → SSGPLQ
     465-526: Missing.

Show »
Length:464
Mass (Da):50,521
Checksum:i598E4D71BF05EDA9
GO
Isoform 9 (identifier: P13688-9) [UniParc]FASTAAdd to Basket

Also known as: BGPz, CEACAM1-3AS

The sequence of this isoform differs from the canonical sequence as follows:
     321-416: LSPVVAKPQI...SDPIMLNVNY → MAFHHVAKAGLKLLSSSNPPASTSQSAKITD
     459-464: RASDQR → SSGPLQ
     465-526: Missing.

Show »
Length:399
Mass (Da):43,062
Checksum:i0BC49C50F3525841
GO
Isoform 10 (identifier: P13688-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     460-468: ASDQRDLTE → TTPMTHLTR
     469-526: Missing.

Note: No experimental confirmation available.

Show »
Length:468
Mass (Da):51,147
Checksum:i215C1A33EEFFFD68
GO
Isoform 11 (identifier: P13688-11) [UniParc]FASTAAdd to Basket

Also known as: BGPd, CEACAM1-3S

The sequence of this isoform differs from the canonical sequence as follows:
     320-416: ELSPVVAKPQ...SDPIMLNVNY → D
     459-464: RASDQR → SSGPLQ
     465-526: Missing.

Show »
Length:368
Mass (Da):39,871
Checksum:i23D7E54B4DC54318
GO

Sequence cautioni

The sequence AAA57141.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti35 – 351Q → K.1 Publication
Corresponds to variant rs8111171 [ dbSNP | Ensembl ].
VAR_049844
Natural varianti83 – 831A → V.1 Publication
Corresponds to variant rs8110904 [ dbSNP | Ensembl ].
VAR_049845
Natural varianti123 – 1231Q → H.1 Publication
Corresponds to variant rs8111468 [ dbSNP | Ensembl ].
VAR_049846
Natural varianti376 – 3761Q → R.1 Publication
Corresponds to variant rs41355544 [ dbSNP | Ensembl ].
VAR_049847

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei143 – 416274Missing in isoform 7.
VSP_012222Add
BLAST
Alternative sequencei320 – 41697ELSPV…LNVNY → D in isoform 6 and isoform 11.
VSP_010938Add
BLAST
Alternative sequencei320 – 3212EL → GK in isoform 3.
VSP_002478
Alternative sequencei321 – 41696LSPVV…LNVNY → RQNLTMLPRLDSNSWAQAIL PSVSQSAEITD in isoform 5.
VSP_009227Add
BLAST
Alternative sequencei321 – 41696LSPVV…LNVNY → MAFHHVAKAGLKLLSSSNPP ASTSQSAKITD in isoform 9.
VSP_040571Add
BLAST
Alternative sequencei321 – 35131LSPVV…TCSTN → SPVLGEDEAVPGQHHPQHKP CQEGGCWDVLV in isoform 4.
VSP_002480Add
BLAST
Alternative sequencei322 – 526205Missing in isoform 3.
VSP_002479Add
BLAST
Alternative sequencei352 – 526175Missing in isoform 4.
VSP_002481Add
BLAST
Alternative sequencei416 – 4172YN → CK in isoform 2.
VSP_002482
Alternative sequencei418 – 526109Missing in isoform 2.
VSP_002483Add
BLAST
Alternative sequencei459 – 4646RASDQR → SSGPLQ in isoform 8, isoform 9 and isoform 11.
VSP_040572
Alternative sequencei460 – 4689ASDQRDLTE → TTPMTHLTR in isoform 10.
VSP_040573
Alternative sequencei465 – 52662Missing in isoform 8, isoform 9 and isoform 11.
VSP_040574Add
BLAST
Alternative sequencei469 – 52658Missing in isoform 10.
VSP_040575Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti142 – 1421P → H in AAA57142. 1 Publication
Sequence conflicti246 – 2461D → Y in BAA02063. 1 Publication
Isoform 5 (identifier: P13688-5)
Sequence conflicti323 – 3231N → L in AAA57143. 1 Publication
Sequence conflicti329 – 3291R → G in BAA02063. 1 Publication
Sequence conflicti337 – 3371Q → E in AAA57143. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
J03858 mRNA. Translation: AAA51826.1.
X14831 mRNA. Translation: CAA32940.1.
X16354 mRNA. Translation: CAA34404.1.
X16356 mRNA. Translation: CAA34405.1.
D90311 mRNA. Translation: BAA14341.1.
D90312 mRNA. Translation: BAA14342.1.
D90313 mRNA. Translation: BAA14343.1.
M69176 mRNA. Translation: AAA51825.1.
M72238 mRNA. Translation: AAA58393.1.
M72238 mRNA. Translation: AAA58394.1.
M76741 Genomic DNA. Translation: AAA57141.1. Sequence problems.
M76742 mRNA. Translation: AAA57142.1.
M76743 mRNA. Translation: AAA57143.1.
M76744 mRNA. Translation: AAA57144.1.
S71326 mRNA. Translation: AAB31183.1.
D12502 mRNA. Translation: BAA02063.1.
AY766113 mRNA. Translation: AAV34600.1.
DQ989182 Genomic DNA. Translation: ABI75349.1.
AC004785 Genomic DNA. Translation: AAC18433.1.
AC004785 Genomic DNA. Translation: AAC18434.1.
AC004785 Genomic DNA. Translation: AAC18435.1.
AC004785 Genomic DNA. Translation: AAC18436.1.
AC004785 Genomic DNA. Translation: AAC18437.1.
AC004785 Genomic DNA. Translation: AAC18438.1.
AC004785 Genomic DNA. Translation: AAC18439.1.
CH471126 Genomic DNA. Translation: EAW57137.1.
CH471126 Genomic DNA. Translation: EAW57140.1.
CH471126 Genomic DNA. Translation: EAW57141.1.
CH471126 Genomic DNA. Translation: EAW57143.1.
BC014473 mRNA. Translation: AAH14473.1.
X67277 Genomic DNA. Translation: CAA47694.1.
CCDSiCCDS12609.1. [P13688-1]
CCDS46089.1. [P13688-8]
CCDS54272.1. [P13688-11]
CCDS54273.1. [P13688-6]
CCDS54274.1. [P13688-5]
PIRiA32164.
B48078.
JH0394.
JH0395.
JH0396.
RefSeqiNP_001020083.1. NM_001024912.2. [P13688-8]
NP_001171742.1. NM_001184813.1. [P13688-6]
NP_001171744.1. NM_001184815.1. [P13688-5]
NP_001171745.1. NM_001184816.1. [P13688-11]
NP_001192273.1. NM_001205344.1. [P13688-10]
NP_001703.2. NM_001712.4. [P13688-1]
UniGeneiHs.512682.

Genome annotation databases

EnsembliENST00000161559; ENSP00000161559; ENSG00000079385. [P13688-1]
ENST00000351134; ENSP00000325946; ENSG00000079385.
ENST00000352591; ENSP00000244291; ENSG00000079385. [P13688-6]
ENST00000358394; ENSP00000351165; ENSG00000079385. [P13688-5]
ENST00000403444; ENSP00000384709; ENSG00000079385. [P13688-8]
ENST00000403461; ENSP00000384083; ENSG00000079385. [P13688-11]
ENST00000599389; ENSP00000471918; ENSG00000079385. [P13688-9]
GeneIDi634.
KEGGihsa:634.
UCSCiuc002otv.3. human. [P13688-1]
uc002otw.3. human. [P13688-8]
uc002otx.3. human. [P13688-5]
uc002oty.3. human. [P13688-6]
uc002otz.3. human. [P13688-11]
uc002oua.3. human. [P13688-2]
uc002oub.3. human. [P13688-4]
uc002ouc.3. human. [P13688-3]
uc010eij.3. human. [P13688-10]
uc010eik.3. human. [P13688-7]

Polymorphism databases

DMDMi399116.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
J03858 mRNA. Translation: AAA51826.1 .
X14831 mRNA. Translation: CAA32940.1 .
X16354 mRNA. Translation: CAA34404.1 .
X16356 mRNA. Translation: CAA34405.1 .
D90311 mRNA. Translation: BAA14341.1 .
D90312 mRNA. Translation: BAA14342.1 .
D90313 mRNA. Translation: BAA14343.1 .
M69176 mRNA. Translation: AAA51825.1 .
M72238 mRNA. Translation: AAA58393.1 .
M72238 mRNA. Translation: AAA58394.1 .
M76741 Genomic DNA. Translation: AAA57141.1 . Sequence problems.
M76742 mRNA. Translation: AAA57142.1 .
M76743 mRNA. Translation: AAA57143.1 .
M76744 mRNA. Translation: AAA57144.1 .
S71326 mRNA. Translation: AAB31183.1 .
D12502 mRNA. Translation: BAA02063.1 .
AY766113 mRNA. Translation: AAV34600.1 .
DQ989182 Genomic DNA. Translation: ABI75349.1 .
AC004785 Genomic DNA. Translation: AAC18433.1 .
AC004785 Genomic DNA. Translation: AAC18434.1 .
AC004785 Genomic DNA. Translation: AAC18435.1 .
AC004785 Genomic DNA. Translation: AAC18436.1 .
AC004785 Genomic DNA. Translation: AAC18437.1 .
AC004785 Genomic DNA. Translation: AAC18438.1 .
AC004785 Genomic DNA. Translation: AAC18439.1 .
CH471126 Genomic DNA. Translation: EAW57137.1 .
CH471126 Genomic DNA. Translation: EAW57140.1 .
CH471126 Genomic DNA. Translation: EAW57141.1 .
CH471126 Genomic DNA. Translation: EAW57143.1 .
BC014473 mRNA. Translation: AAH14473.1 .
X67277 Genomic DNA. Translation: CAA47694.1 .
CCDSi CCDS12609.1. [P13688-1 ]
CCDS46089.1. [P13688-8 ]
CCDS54272.1. [P13688-11 ]
CCDS54273.1. [P13688-6 ]
CCDS54274.1. [P13688-5 ]
PIRi A32164.
B48078.
JH0394.
JH0395.
JH0396.
RefSeqi NP_001020083.1. NM_001024912.2. [P13688-8 ]
NP_001171742.1. NM_001184813.1. [P13688-6 ]
NP_001171744.1. NM_001184815.1. [P13688-5 ]
NP_001171745.1. NM_001184816.1. [P13688-11 ]
NP_001192273.1. NM_001205344.1. [P13688-10 ]
NP_001703.2. NM_001712.4. [P13688-1 ]
UniGenei Hs.512682.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2GK2 X-ray 2.20 A/B 34-141 [» ]
ProteinModelPortali P13688.
SMRi P13688. Positions 34-414.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107103. 11 interactions.
IntActi P13688. 6 interactions.
MINTi MINT-5002435.
STRINGi 9606.ENSP00000161559.

Chemistry

DrugBanki DB00113. Arcitumomab.

PTM databases

PhosphoSitei P13688.

Polymorphism databases

DMDMi 399116.

Proteomic databases

MaxQBi P13688.
PaxDbi P13688.
PRIDEi P13688.

Protocols and materials databases

DNASUi 634.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000161559 ; ENSP00000161559 ; ENSG00000079385 . [P13688-1 ]
ENST00000351134 ; ENSP00000325946 ; ENSG00000079385 .
ENST00000352591 ; ENSP00000244291 ; ENSG00000079385 . [P13688-6 ]
ENST00000358394 ; ENSP00000351165 ; ENSG00000079385 . [P13688-5 ]
ENST00000403444 ; ENSP00000384709 ; ENSG00000079385 . [P13688-8 ]
ENST00000403461 ; ENSP00000384083 ; ENSG00000079385 . [P13688-11 ]
ENST00000599389 ; ENSP00000471918 ; ENSG00000079385 . [P13688-9 ]
GeneIDi 634.
KEGGi hsa:634.
UCSCi uc002otv.3. human. [P13688-1 ]
uc002otw.3. human. [P13688-8 ]
uc002otx.3. human. [P13688-5 ]
uc002oty.3. human. [P13688-6 ]
uc002otz.3. human. [P13688-11 ]
uc002oua.3. human. [P13688-2 ]
uc002oub.3. human. [P13688-4 ]
uc002ouc.3. human. [P13688-3 ]
uc010eij.3. human. [P13688-10 ]
uc010eik.3. human. [P13688-7 ]

Organism-specific databases

CTDi 634.
GeneCardsi GC19M043009.
H-InvDB HIX0017795.
HGNCi HGNC:1814. CEACAM1.
HPAi CAB002146.
HPA011041.
MIMi 109770. gene.
neXtProti NX_P13688.
PharmGKBi PA26358.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG149650.
HOVERGENi HBG007922.
KOi K06499.
OMAi NTSYLWS.
OrthoDBi EOG74BJS7.
PhylomeDBi P13688.
TreeFami TF336859.

Miscellaneous databases

EvolutionaryTracei P13688.
GeneWikii CEACAM1.
GenomeRNAii 634.
NextBioi 2562.
PROi P13688.
SOURCEi Search...

Gene expression databases

ArrayExpressi P13688.
Bgeei P13688.
CleanExi HS_CEACAM1.
Genevestigatori P13688.

Family and domain databases

Gene3Di 2.60.40.10. 4 hits.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR013151. Immunoglobulin.
[Graphical view ]
Pfami PF00047. ig. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 2 hits.
SM00408. IGc2. 2 hits.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of a cDNA coding biliary glycoprotein I: primary structure of a glycoprotein immunologically crossreactive with carcinoembryonic antigen."
    Hinoda Y., Neumaier M., Hefta S.A., Drzeniek Z., Wagener C., Shively L., Hefta L.J.F., Shively J.E., Paxton R.J.
    Proc. Natl. Acad. Sci. U.S.A. 85:6959-6963(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, PYROGLUTAMATE FORMATION AT GLN-35.
  2. Erratum
    Hinoda Y., Neumaier M., Hefta S.A., Drzeniek Z., Wagener C., Shively L., Hefta L.J.F., Shively J.E., Paxton R.J.
    Proc. Natl. Acad. Sci. U.S.A. 86:1668-1668(1989)
    Cited for: SEQUENCE REVISION.
  3. "Carcinoembryonic antigens: alternative splicing accounts for the multiple mRNAs that code for novel members of the carcinoembryonic antigen family."
    Barnett T.R., Kretschmer A., Austen D.A., Goebel S.J., Hart J.T., Elting J.J., Kamarck M.E.
    J. Cell Biol. 108:267-276(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 6 AND 8).
  4. "Three novel molecular forms of biliary glycoprotein deduced from cDNA clones from a human leukocyte library."
    Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Nakazato H., Matsuoka Y.
    Biochem. Biophys. Res. Commun. 176:578-585(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), SUBCELLULAR LOCATION, GLYCOSYLATION.
    Tissue: Leukocyte.
  5. "Human biliary glycoprotein gene: characterization of a family of novel alternatively spliced RNAs and their expressed proteins."
    Barnett T.R., Drake L., Pickle W. II
    Mol. Cell. Biol. 13:1273-1282(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7), NUCLEOTIDE SEQUENCE [MRNA] OF 293-494 (ISOFORM 5), NUCLEOTIDE SEQUENCE [MRNA] OF 293-458 (ISOFORM 9), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 293-458, GLYCOSYLATION.
  6. "CD66 identifies the biliary glycoprotein (BGP) adhesion molecule: cloning, expression, and adhesion functions of the BGPc splice variant."
    Watt S.M., Fawcett J., Murdoch S.J., Teixeira A.M., Gschmeissner S.E., Hajibagheri N.M., Simmons D.L.
    Blood 84:200-210(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8), SUBCELLULAR LOCATION.
    Tissue: Colon adenocarcinoma.
  7. "A new isoform of human biliary glycoprotein (BGP) containing a domain encoded by an Alu-like sequence."
    Kuroki M., Matsuo Y., Misumi Y., Oikawa S., Matsuoka Y.
    Submitted (JUN-1992) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
    Tissue: Monocyte.
  8. "Isolation of the cDNA encoding a putative carcinoembryonic antigen-related cell adhesion molecule 1 short form 3 (CEACAM1-3S)."
    Long S., Phillips A., Ma H., Paoni N.F., Wong-Staal F., Fan W.
    Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 11).
  9. SeattleSNPs variation discovery resource
    Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-35; VAL-83; HIS-123 AND ARG-376.
  10. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  12. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10).
    Tissue: Skin.
  13. "Transcriptional control of the human biliary glycoprotein gene, a CEA gene family member down-regulated in colorectal carcinomas."
    Hauck W., Nedellec P., Turbide C., Stanners C.P., Barnett T.R., Beauchemin N.
    Eur. J. Biochem. 223:529-541(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-21, DISEASE.
  14. "Characterization and transcriptional activity of the mouse biliary glycoprotein 1 gene, a carcinoembryonic antigen-related gene."
    Nedellec P., Turbide C., Beauchemin N.
    Eur. J. Biochem. 231:104-114(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-21.
  15. Cited for: NOMENCLATURE OF ALTERNATIVE SPLICING ISOFORMS.
  16. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
    Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
    J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-104 AND ASN-111.
    Tissue: Plasma.
  17. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-152; ASN-208; ASN-224; ASN-363; ASN-378 AND ASN-405.
    Tissue: Liver.
  18. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  19. "Structure of the N-terminal domain of human CEACAM1: binding target of the opacity proteins during invasion of Neisseria meningitidis and N. gonorrhoeae."
    Fedarovich A., Tomberg J., Nicholas R.A., Davies C.
    Acta Crystallogr. D 62:971-979(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 34-141.

Entry informationi

Entry nameiCEAM1_HUMAN
AccessioniPrimary (citable) accession number: P13688
Secondary accession number(s): A6NE38
, A8MY49, O60430, Q069I7, Q13854, Q13857, Q13858, Q13859, Q13860, Q15600, Q15601, Q16170, Q5UB49, Q7KYP5, Q96CA7, Q9UQV9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: July 1, 1993
Last modified: September 3, 2014
This is version 160 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi