Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P13688 (CEAM1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 156. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (7) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Carcinoembryonic antigen-related cell adhesion molecule 1
Alternative name(s):
Biliary glycoprotein 1
Short name=BGP-1
CD_antigen=CD66a
Gene names
Name:CEACAM1
Synonyms:BGP, BGP1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length526 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Isoform 1: Cell membrane; Single-pass type I membrane protein.

Isoform 2: Secreted Ref.4 Ref.6.

Isoform 3: Secreted Ref.4 Ref.6.

Isoform 4: Secreted Ref.4 Ref.6.

Isoform 5: Cell membrane; Single-pass type I membrane protein.

Isoform 6: Cell membrane; Single-pass type I membrane protein.

Isoform 7: Cell membrane; Single-pass type I membrane protein.

Isoform 8: Cell membrane; Single-pass type I membrane protein. Note: Localizes to sites of cell-cell contact. Ref.4 Ref.6

Sequence similarities

Belongs to the immunoglobulin superfamily. CEA family.

Contains 3 Ig-like C2-type (immunoglobulin-like) domains.

Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Sequence caution

The sequence AAA57141.1 differs from that shown. Reason: Erroneous gene model prediction.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

CARTPTQ165683EBI-4314481,EBI-4314526
CEACAM6P401992EBI-4314481,EBI-4314501
uspa1Q8GH8712EBI-4314481,EBI-7936357From a different organism.

Alternative products

This entry describes 11 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P13688-1)

Also known as: BGPa; CEACAM1-4L; TM1-CEA;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P13688-2)

Also known as: BGPg; CEACAM1-4C1;

The sequence of this isoform differs from the canonical sequence as follows:
     416-417: YN → CK
     418-526: Missing.
Isoform 3 (identifier: P13688-3)

Also known as: BGPh; CEACAM1-3;

The sequence of this isoform differs from the canonical sequence as follows:
     320-321: EL → GK
     322-526: Missing.
Isoform 4 (identifier: P13688-4)

Also known as: BGPi; CEACAM1-3C2;

The sequence of this isoform differs from the canonical sequence as follows:
     321-351: LSPVVAKPQIKASKTTVTGDKDSVNLTCSTN → SPVLGEDEAVPGQHHPQHKPCQEGGCWDVLV
     352-526: Missing.
Isoform 5 (identifier: P13688-5)

Also known as: BGPy; CEACAM1-3AL;

The sequence of this isoform differs from the canonical sequence as follows:
     321-416: LSPVVAKPQI...SDPIMLNVNY → RQNLTMLPRLDSNSWAQAILPSVSQSAEITD
Isoform 6 (identifier: P13688-6)

Also known as: BGPb; CEACAM1-3L; TM2-CEA;

The sequence of this isoform differs from the canonical sequence as follows:
     320-416: ELSPVVAKPQ...SDPIMLNVNY → D
Isoform 7 (identifier: P13688-7)

Also known as: BGPx; CEACAM1-1L;

The sequence of this isoform differs from the canonical sequence as follows:
     143-416: Missing.
Isoform 8 (identifier: P13688-8)

Also known as: BGPc; CEACAM1-4S; TM3-CEA;

The sequence of this isoform differs from the canonical sequence as follows:
     459-464: RASDQR → SSGPLQ
     465-526: Missing.
Isoform 9 (identifier: P13688-9)

Also known as: BGPz; CEACAM1-3AS;

The sequence of this isoform differs from the canonical sequence as follows:
     321-416: LSPVVAKPQI...SDPIMLNVNY → MAFHHVAKAGLKLLSSSNPPASTSQSAKITD
     459-464: RASDQR → SSGPLQ
     465-526: Missing.
Isoform 10 (identifier: P13688-10)

The sequence of this isoform differs from the canonical sequence as follows:
     460-468: ASDQRDLTE → TTPMTHLTR
     469-526: Missing.
Note: No experimental confirmation available.
Isoform 11 (identifier: P13688-11)

Also known as: BGPd; CEACAM1-3S;

The sequence of this isoform differs from the canonical sequence as follows:
     320-416: ELSPVVAKPQ...SDPIMLNVNY → D
     459-464: RASDQR → SSGPLQ
     465-526: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3434
Chain35 – 526492Carcinoembryonic antigen-related cell adhesion molecule 1
PRO_0000014562

Regions

Topological domain35 – 428394Extracellular Potential
Transmembrane429 – 45224Helical; Potential
Topological domain453 – 52674Cytoplasmic Potential
Domain35 – 142108Ig-like V-type
Domain145 – 23288Ig-like C2-type 1
Domain237 – 31781Ig-like C2-type 2
Domain323 – 41391Ig-like C2-type 3

Amino acid modifications

Modified residue351Pyrrolidone carboxylic acid
Glycosylation1041N-linked (GlcNAc...) Ref.16
Glycosylation1111N-linked (GlcNAc...) Ref.16
Glycosylation1151N-linked (GlcNAc...)
Glycosylation1521N-linked (GlcNAc...) Ref.17
Glycosylation1821N-linked (GlcNAc...) Potential
Glycosylation1971N-linked (GlcNAc...) Potential
Glycosylation2081N-linked (GlcNAc...) Ref.17
Glycosylation2241N-linked (GlcNAc...) Ref.17
Glycosylation2321N-linked (GlcNAc...) Potential
Glycosylation2541N-linked (GlcNAc...)
Glycosylation2741N-linked (GlcNAc...) Potential
Glycosylation2881N-linked (GlcNAc...) Potential
Glycosylation2921N-linked (GlcNAc...) Potential
Glycosylation3021N-linked (GlcNAc...) Potential
Glycosylation3091N-linked (GlcNAc...) Potential
Glycosylation3451N-linked (GlcNAc...) Potential
Glycosylation3511N-linked (GlcNAc...) Potential
Glycosylation3631N-linked (GlcNAc...) Ref.17
Glycosylation3781N-linked (GlcNAc...) Ref.17
Glycosylation4051N-linked (GlcNAc...) Ref.17
Disulfide bond167 ↔ 215 Probable
Disulfide bond259 ↔ 299 Probable
Disulfide bond348 ↔ 396 Probable

Natural variations

Alternative sequence143 – 416274Missing in isoform 7.
VSP_012222
Alternative sequence320 – 41697ELSPV…LNVNY → D in isoform 6 and isoform 11.
VSP_010938
Alternative sequence320 – 3212EL → GK in isoform 3.
VSP_002478
Alternative sequence321 – 41696LSPVV…LNVNY → RQNLTMLPRLDSNSWAQAIL PSVSQSAEITD in isoform 5.
VSP_009227
Alternative sequence321 – 41696LSPVV…LNVNY → MAFHHVAKAGLKLLSSSNPP ASTSQSAKITD in isoform 9.
VSP_040571
Alternative sequence321 – 35131LSPVV…TCSTN → SPVLGEDEAVPGQHHPQHKP CQEGGCWDVLV in isoform 4.
VSP_002480
Alternative sequence322 – 526205Missing in isoform 3.
VSP_002479
Alternative sequence352 – 526175Missing in isoform 4.
VSP_002481
Alternative sequence416 – 4172YN → CK in isoform 2.
VSP_002482
Alternative sequence418 – 526109Missing in isoform 2.
VSP_002483
Alternative sequence459 – 4646RASDQR → SSGPLQ in isoform 8, isoform 9 and isoform 11.
VSP_040572
Alternative sequence460 – 4689ASDQRDLTE → TTPMTHLTR in isoform 10.
VSP_040573
Alternative sequence465 – 52662Missing in isoform 8, isoform 9 and isoform 11.
VSP_040574
Alternative sequence469 – 52658Missing in isoform 10.
VSP_040575
Natural variant351Q → K. Ref.9
Corresponds to variant rs8111171 [ dbSNP | Ensembl ].
VAR_049844
Natural variant831A → V. Ref.9
Corresponds to variant rs8110904 [ dbSNP | Ensembl ].
VAR_049845
Natural variant1231Q → H. Ref.9
Corresponds to variant rs8111468 [ dbSNP | Ensembl ].
VAR_049846
Natural variant3761Q → R. Ref.9
Corresponds to variant rs41355544 [ dbSNP | Ensembl ].
VAR_049847

Experimental info

Sequence conflict1421P → H in AAA57142. Ref.5
Sequence conflict2461D → Y in BAA02063. Ref.7
Isoform 5:
Sequence conflict3231N → L in AAA57143. Ref.5
Sequence conflict3371Q → E in AAA57143. Ref.5
Sequence conflict3291R → G in BAA02063. Ref.7

Secondary structure

...................... 526
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (BGPa) (CEACAM1-4L) (TM1-CEA) [UniParc].

Last modified July 1, 1993. Version 2.
Checksum: CAD1B2328D069AF8

FASTA52657,560
        10         20         30         40         50         60 
MGHLSAPLHR VRVPWQGLLL TASLLTFWNP PTTAQLTTES MPFNVAEGKE VLLLVHNLPQ 

        70         80         90        100        110        120 
QLFGYSWYKG ERVDGNRQIV GYAIGTQQAT PGPANSGRET IYPNASLLIQ NVTQNDTGFY 

       130        140        150        160        170        180 
TLQVIKSDLV NEEATGQFHV YPELPKPSIS SNNSNPVEDK DAVAFTCEPE TQDTTYLWWI 

       190        200        210        220        230        240 
NNQSLPVSPR LQLSNGNRTL TLLSVTRNDT GPYECEIQNP VSANRSDPVT LNVTYGPDTP 

       250        260        270        280        290        300 
TISPSDTYYR PGANLSLSCY AASNPPAQYS WLINGTFQQS TQELFIPNIT VNNSGSYTCH 

       310        320        330        340        350        360 
ANNSVTGCNR TTVKTIIVTE LSPVVAKPQI KASKTTVTGD KDSVNLTCST NDTGISIRWF 

       370        380        390        400        410        420 
FKNQSLPSSE RMKLSQGNTT LSINPVKRED AGTYWCEVFN PISKNQSDPI MLNVNYNALP 

       430        440        450        460        470        480 
QENGLSPGAI AGIVIGVVAL VALIAVALAC FLHFGKTGRA SDQRDLTEHK PSVSNHTQDH 

       490        500        510        520 
SNDPPNKMNE VTYSTLNFEA QQPTQPTSAS PSLTATEIIY SEVKKQ 

« Hide

Isoform 2 (BGPg) (CEACAM1-4C1) [UniParc].

Checksum: 5D4B9F86184AA4B4
Show »

FASTA41745,950
Isoform 3 (BGPh) (CEACAM1-3) [UniParc].

Checksum: 81DE2F4E62AD42A7
Show »

FASTA32135,302
Isoform 4 (BGPi) (CEACAM1-3C2) [UniParc].

Checksum: 33CEF445429E8DD4
Show »

FASTA35138,578
Isoform 5 (BGPy) (CEACAM1-3AL) [UniParc].

Checksum: E7810D2559DF7A8F
Show »

FASTA46150,349
Isoform 6 (BGPb) (CEACAM1-3L) (TM2-CEA) [UniParc].

Checksum: 195DE9F171D1414F
Show »

FASTA43046,910
Isoform 7 (BGPx) (CEACAM1-1L) [UniParc].

Checksum: 6C85A702292B6367
Show »

FASTA25227,431
Isoform 8 (BGPc) (CEACAM1-4S) (TM3-CEA) [UniParc].

Checksum: 598E4D71BF05EDA9
Show »

FASTA46450,521
Isoform 9 (BGPz) (CEACAM1-3AS) [UniParc].

Checksum: 0BC49C50F3525841
Show »

FASTA39943,062
Isoform 10 [UniParc].

Checksum: 215C1A33EEFFFD68
Show »

FASTA46851,147
Isoform 11 (BGPd) (CEACAM1-3S) [UniParc].

Checksum: 23D7E54B4DC54318
Show »

FASTA36839,871

References

« Hide 'large scale' references
[1]"Molecular cloning of a cDNA coding biliary glycoprotein I: primary structure of a glycoprotein immunologically crossreactive with carcinoembryonic antigen."
Hinoda Y., Neumaier M., Hefta S.A., Drzeniek Z., Wagener C., Shively L., Hefta L.J.F., Shively J.E., Paxton R.J.
Proc. Natl. Acad. Sci. U.S.A. 85:6959-6963(1988) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, PYROGLUTAMATE FORMATION AT GLN-35.
[2]Erratum
Hinoda Y., Neumaier M., Hefta S.A., Drzeniek Z., Wagener C., Shively L., Hefta L.J.F., Shively J.E., Paxton R.J.
Proc. Natl. Acad. Sci. U.S.A. 86:1668-1668(1989)
Cited for: SEQUENCE REVISION.
[3]"Carcinoembryonic antigens: alternative splicing accounts for the multiple mRNAs that code for novel members of the carcinoembryonic antigen family."
Barnett T.R., Kretschmer A., Austen D.A., Goebel S.J., Hart J.T., Elting J.J., Kamarck M.E.
J. Cell Biol. 108:267-276(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 6 AND 8).
[4]"Three novel molecular forms of biliary glycoprotein deduced from cDNA clones from a human leukocyte library."
Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Nakazato H., Matsuoka Y.
Biochem. Biophys. Res. Commun. 176:578-585(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), SUBCELLULAR LOCATION, GLYCOSYLATION.
Tissue: Leukocyte.
[5]"Human biliary glycoprotein gene: characterization of a family of novel alternatively spliced RNAs and their expressed proteins."
Barnett T.R., Drake L., Pickle W. II
Mol. Cell. Biol. 13:1273-1282(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7), NUCLEOTIDE SEQUENCE [MRNA] OF 293-494 (ISOFORM 5), NUCLEOTIDE SEQUENCE [MRNA] OF 293-458 (ISOFORM 9), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 293-458, GLYCOSYLATION.
[6]"CD66 identifies the biliary glycoprotein (BGP) adhesion molecule: cloning, expression, and adhesion functions of the BGPc splice variant."
Watt S.M., Fawcett J., Murdoch S.J., Teixeira A.M., Gschmeissner S.E., Hajibagheri N.M., Simmons D.L.
Blood 84:200-210(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8), SUBCELLULAR LOCATION.
Tissue: Colon adenocarcinoma.
[7]"A new isoform of human biliary glycoprotein (BGP) containing a domain encoded by an Alu-like sequence."
Kuroki M., Matsuo Y., Misumi Y., Oikawa S., Matsuoka Y.
Submitted (JUN-1992) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
Tissue: Monocyte.
[8]"Isolation of the cDNA encoding a putative carcinoembryonic antigen-related cell adhesion molecule 1 short form 3 (CEACAM1-3S)."
Long S., Phillips A., Ma H., Paoni N.F., Wong-Staal F., Fan W.
Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 11).
[9]SeattleSNPs variation discovery resource
Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-35; VAL-83; HIS-123 AND ARG-376.
[10]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[11]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[12]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10).
Tissue: Skin.
[13]"Transcriptional control of the human biliary glycoprotein gene, a CEA gene family member down-regulated in colorectal carcinomas."
Hauck W., Nedellec P., Turbide C., Stanners C.P., Barnett T.R., Beauchemin N.
Eur. J. Biochem. 223:529-541(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-21, DISEASE.
[14]"Characterization and transcriptional activity of the mouse biliary glycoprotein 1 gene, a carcinoembryonic antigen-related gene."
Nedellec P., Turbide C., Beauchemin N.
Eur. J. Biochem. 231:104-114(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-21.
[15]"Redefined nomenclature for members of the carcinoembryonic antigen family."
Beauchemin N., Draber P., Dveksler G., Gold P., Gray-Owen S., Grunert F., Hammarstrom S., Holmes K.V., Karlsson A., Kuroki M., Lin S.H., Lucka L., Najjar S.M., Neumaier M., Obrink B., Shively J.E., Skubitz K.M., Stanners C.P. expand/collapse author list , Thomas P., Thompson J.A., Virji M., von Kleist S., Wagener C., Watt S., Zimmermann W.
Exp. Cell Res. 252:243-249(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NOMENCLATURE OF ALTERNATIVE SPLICING ISOFORMS.
[16]"Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-104 AND ASN-111.
Tissue: Plasma.
[17]"Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-152; ASN-208; ASN-224; ASN-363; ASN-378 AND ASN-405.
Tissue: Liver.
[18]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[19]"Structure of the N-terminal domain of human CEACAM1: binding target of the opacity proteins during invasion of Neisseria meningitidis and N. gonorrhoeae."
Fedarovich A., Tomberg J., Nicholas R.A., Davies C.
Acta Crystallogr. D 62:971-979(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 34-141.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
J03858 mRNA. Translation: AAA51826.1.
X14831 mRNA. Translation: CAA32940.1.
X16354 mRNA. Translation: CAA34404.1.
X16356 mRNA. Translation: CAA34405.1.
D90311 mRNA. Translation: BAA14341.1.
D90312 mRNA. Translation: BAA14342.1.
D90313 mRNA. Translation: BAA14343.1.
M69176 mRNA. Translation: AAA51825.1.
M72238 mRNA. Translation: AAA58393.1.
M72238 mRNA. Translation: AAA58394.1.
M76741 Genomic DNA. Translation: AAA57141.1. Sequence problems.
M76742 mRNA. Translation: AAA57142.1.
M76743 mRNA. Translation: AAA57143.1.
M76744 mRNA. Translation: AAA57144.1.
S71326 mRNA. Translation: AAB31183.1.
D12502 mRNA. Translation: BAA02063.1.
AY766113 mRNA. Translation: AAV34600.1.
DQ989182 Genomic DNA. Translation: ABI75349.1.
AC004785 Genomic DNA. Translation: AAC18433.1.
AC004785 Genomic DNA. Translation: AAC18434.1.
AC004785 Genomic DNA. Translation: AAC18435.1.
AC004785 Genomic DNA. Translation: AAC18436.1.
AC004785 Genomic DNA. Translation: AAC18437.1.
AC004785 Genomic DNA. Translation: AAC18438.1.
AC004785 Genomic DNA. Translation: AAC18439.1.
CH471126 Genomic DNA. Translation: EAW57137.1.
CH471126 Genomic DNA. Translation: EAW57140.1.
CH471126 Genomic DNA. Translation: EAW57141.1.
CH471126 Genomic DNA. Translation: EAW57143.1.
BC014473 mRNA. Translation: AAH14473.1.
X67277 Genomic DNA. Translation: CAA47694.1.
PIRA32164.
B48078.
JH0394.
JH0395.
JH0396.
RefSeqNP_001020083.1. NM_001024912.2.
NP_001171742.1. NM_001184813.1.
NP_001171744.1. NM_001184815.1.
NP_001171745.1. NM_001184816.1.
NP_001192273.1. NM_001205344.1.
NP_001703.2. NM_001712.4.
UniGeneHs.512682.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2GK2X-ray2.20A/B34-141[»]
ProteinModelPortalP13688.
SMRP13688. Positions 34-419.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107103. 10 interactions.
IntActP13688. 6 interactions.
MINTMINT-5002435.
STRING9606.ENSP00000161559.

Chemistry

DrugBankDB00113. Arcitumomab.

PTM databases

PhosphoSiteP13688.

Polymorphism databases

DMDM399116.

Proteomic databases

PaxDbP13688.
PRIDEP13688.

Protocols and materials databases

DNASU634.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000161559; ENSP00000161559; ENSG00000079385. [P13688-1]
ENST00000351134; ENSP00000325946; ENSG00000079385.
ENST00000352591; ENSP00000244291; ENSG00000079385. [P13688-6]
ENST00000358394; ENSP00000351165; ENSG00000079385. [P13688-5]
ENST00000403444; ENSP00000384709; ENSG00000079385. [P13688-8]
ENST00000403461; ENSP00000384083; ENSG00000079385. [P13688-11]
ENST00000599389; ENSP00000471918; ENSG00000079385. [P13688-9]
GeneID634.
KEGGhsa:634.
UCSCuc002otv.3. human. [P13688-1]
uc002otw.3. human. [P13688-8]
uc002otx.3. human. [P13688-5]
uc002oty.3. human. [P13688-6]
uc002otz.3. human. [P13688-11]
uc002oua.3. human. [P13688-2]
uc002oub.3. human. [P13688-4]
uc002ouc.3. human. [P13688-3]
uc010eij.3. human. [P13688-10]
uc010eik.3. human. [P13688-7]

Organism-specific databases

CTD634.
GeneCardsGC19M043009.
H-InvDBHIX0017795.
HGNCHGNC:1814. CEACAM1.
HPACAB002146.
HPA011041.
MIM109770. gene.
neXtProtNX_P13688.
PharmGKBPA26358.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG149650.
HOVERGENHBG007922.
KOK06499.
OMANTSYLWS.
OrthoDBEOG74BJS7.
PhylomeDBP13688.
TreeFamTF336859.

Gene expression databases

ArrayExpressP13688.
BgeeP13688.
CleanExHS_CEACAM1.
GenevestigatorP13688.

Family and domain databases

Gene3D2.60.40.10. 4 hits.
InterProIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR013151. Immunoglobulin.
[Graphical view]
PfamPF00047. ig. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTSM00409. IG. 2 hits.
SM00408. IGc2. 2 hits.
[Graphical view]
PROSITEPS50835. IG_LIKE. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceP13688.
GeneWikiCEACAM1.
GenomeRNAi634.
NextBio2562.
PROP13688.
SOURCESearch...

Entry information

Entry nameCEAM1_HUMAN
AccessionPrimary (citable) accession number: P13688
Secondary accession number(s): A6NE38 expand/collapse secondary AC list , A8MY49, O60430, Q069I7, Q13854, Q13857, Q13858, Q13859, Q13860, Q15600, Q15601, Q16170, Q5UB49, Q7KYP5, Q96CA7, Q9UQV9
Entry history
Integrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: July 1, 1993
Last modified: April 16, 2014
This is version 156 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries