P13688 (CEAM1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 147.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Carcinoembryonic antigen-related cell adhesion molecule 1 Alternative name(s): Biliary glycoprotein 1 Short name=BGP-1 CD_antigen=CD66a | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 526 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Isoform 1: Cell membrane; Single-pass type I membrane protein. Isoform 2: Secreted Ref.4 Ref.6. Isoform 3: Secreted Ref.4 Ref.6. Isoform 4: Secreted Ref.4 Ref.6. Isoform 5: Cell membrane; Single-pass type I membrane protein. Isoform 6: Cell membrane; Single-pass type I membrane protein. Isoform 7: Cell membrane; Single-pass type I membrane protein. Isoform 8: Cell membrane; Single-pass type I membrane protein. Note: Localizes to sites of cell-cell contact. Ref.4 Ref.6 |
| Sequence similarities | Belongs to the immunoglobulin superfamily. CEA family. Contains 3 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Sequence caution | The sequence AAA57141.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane Transmembrane helix |
| PTM | Disulfide bond Glycoprotein Pyrrolidone carboxylic acid |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | angiogenesis Non-traceable author statement PubMed 15687237. Source: UniProtKB cell migrationNon-traceable author statement PubMed 15687237. Source: UniProtKB homophilic cell adhesionNon-traceable author statement PubMed 15687237. Source: UniProtKB integrin-mediated signaling pathwayNon-traceable author statement PubMed 15687237. Source: UniProtKB |
| Cellular_component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell integral to plasma membraneNon-traceable author statement PubMed 15687237. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CARTPT | Q16568 | 3 | EBI-4314481,EBI-4314526 | |
| CEACAM6 | P40199 | 2 | EBI-4314481,EBI-4314501 |
Alternative products
| This entry describes 11 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P13688-1) Also known as: BGPa; CEACAM1-4L; TM1-CEA; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P13688-2) Also known as: BGPg; CEACAM1-4C1; The sequence of this isoform differs from the canonical sequence as follows: 416-417: YN → CK 418-526: Missing. | ||||||
| Isoform 3 (identifier: P13688-3) Also known as: BGPh; CEACAM1-3; The sequence of this isoform differs from the canonical sequence as follows: 320-321: EL → GK 322-526: Missing. | ||||||
| Isoform 4 (identifier: P13688-4) Also known as: BGPi; CEACAM1-3C2; The sequence of this isoform differs from the canonical sequence as follows: 321-351: LSPVVAKPQIKASKTTVTGDKDSVNLTCSTN → SPVLGEDEAVPGQHHPQHKPCQEGGCWDVLV 352-526: Missing. | ||||||
| Isoform 5 (identifier: P13688-5) Also known as: BGPy; CEACAM1-3AL; The sequence of this isoform differs from the canonical sequence as follows: 321-416: LSPVVAKPQI...SDPIMLNVNY → RQNLTMLPRLDSNSWAQAILPSVSQSAEITD | ||||||
| Isoform 6 (identifier: P13688-6) Also known as: BGPb; CEACAM1-3L; TM2-CEA; The sequence of this isoform differs from the canonical sequence as follows: 320-416: ELSPVVAKPQ...SDPIMLNVNY → D | ||||||
| Isoform 7 (identifier: P13688-7) Also known as: BGPx; CEACAM1-1L; The sequence of this isoform differs from the canonical sequence as follows: 143-416: Missing. | ||||||
| Isoform 8 (identifier: P13688-8) Also known as: BGPc; CEACAM1-4S; TM3-CEA; The sequence of this isoform differs from the canonical sequence as follows: 459-464: RASDQR → SSGPLQ 465-526: Missing. | ||||||
| Isoform 9 (identifier: P13688-9) Also known as: BGPz; CEACAM1-3AS; The sequence of this isoform differs from the canonical sequence as follows: 321-416: LSPVVAKPQI...SDPIMLNVNY → MAFHHVAKAGLKLLSSSNPPASTSQSAKITD 459-464: RASDQR → SSGPLQ 465-526: Missing. | ||||||
| Isoform 10 (identifier: P13688-10) The sequence of this isoform differs from the canonical sequence as follows: 460-468: ASDQRDLTE → TTPMTHLTR 469-526: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 11 (identifier: P13688-11) Also known as: BGPd; CEACAM1-3S; The sequence of this isoform differs from the canonical sequence as follows: 320-416: ELSPVVAKPQ...SDPIMLNVNY → D 459-464: RASDQR → SSGPLQ 465-526: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 34 | 34 | ||||||||||||||||||||||||||||
| Chain | 35 – 526 | 492 | Carcinoembryonic antigen-related cell adhesion molecule 1 | PRO_0000014562 | ||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||
| Topological domain | 35 – 428 | 394 | Extracellular Potential | |||||||||||||||||||||||||||
| Transmembrane | 429 – 452 | 24 | Helical; Potential | |||||||||||||||||||||||||||
| Topological domain | 453 – 526 | 74 | Cytoplasmic Potential | |||||||||||||||||||||||||||
| Domain | 35 – 142 | 108 | Ig-like V-type | |||||||||||||||||||||||||||
| Domain | 145 – 232 | 88 | Ig-like C2-type 1 | |||||||||||||||||||||||||||
| Domain | 237 – 317 | 81 | Ig-like C2-type 2 | |||||||||||||||||||||||||||
| Domain | 323 – 413 | 91 | Ig-like C2-type 3 | |||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||
| Modified residue | 35 | 1 | Pyrrolidone carboxylic acid | |||||||||||||||||||||||||||
| Glycosylation | 104 | 1 | N-linked (GlcNAc...) Ref.16 | |||||||||||||||||||||||||||
| Glycosylation | 111 | 1 | N-linked (GlcNAc...) Ref.16 | |||||||||||||||||||||||||||
| Glycosylation | 115 | 1 | N-linked (GlcNAc...) | |||||||||||||||||||||||||||
| Glycosylation | 152 | 1 | N-linked (GlcNAc...) Ref.17 | |||||||||||||||||||||||||||
| Glycosylation | 182 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||
| Glycosylation | 197 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||
| Glycosylation | 208 | 1 | N-linked (GlcNAc...) Ref.17 | |||||||||||||||||||||||||||
| Glycosylation | 224 | 1 | N-linked (GlcNAc...) Ref.17 | |||||||||||||||||||||||||||
| Glycosylation | 232 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||
| Glycosylation | 254 | 1 | N-linked (GlcNAc...) | |||||||||||||||||||||||||||
| Glycosylation | 274 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||
| Glycosylation | 288 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||
| Glycosylation | 292 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||
| Glycosylation | 302 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||
| Glycosylation | 309 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||
| Glycosylation | 345 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||
| Glycosylation | 351 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||
| Glycosylation | 363 | 1 | N-linked (GlcNAc...) Ref.17 | |||||||||||||||||||||||||||
| Glycosylation | 378 | 1 | N-linked (GlcNAc...) Ref.17 | |||||||||||||||||||||||||||
| Glycosylation | 405 | 1 | N-linked (GlcNAc...) Ref.17 | |||||||||||||||||||||||||||
| Disulfide bond | 167 ↔ 215 | Probable | ||||||||||||||||||||||||||||
| Disulfide bond | 259 ↔ 299 | Probable | ||||||||||||||||||||||||||||
| Disulfide bond | 348 ↔ 396 | Probable | ||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||
| Alternative sequence | 143 – 416 | 274 | Missing in isoform 7. | VSP_012222 | ||||||||||||||||||||||||||
| Alternative sequence | 320 – 416 | 97 | ELSPV…LNVNY → D in isoform 6 and isoform 11. | VSP_010938 | ||||||||||||||||||||||||||
| Alternative sequence | 320 – 321 | 2 | EL → GK in isoform 3. | VSP_002478 | ||||||||||||||||||||||||||
| Alternative sequence | 321 – 416 | 96 | LSPVV…LNVNY → RQNLTMLPRLDSNSWAQAIL PSVSQSAEITD in isoform 5. | VSP_009227 | ||||||||||||||||||||||||||
| Alternative sequence | 321 – 416 | 96 | LSPVV…LNVNY → MAFHHVAKAGLKLLSSSNPP ASTSQSAKITD in isoform 9. | VSP_040571 | ||||||||||||||||||||||||||
| Alternative sequence | 321 – 351 | 31 | LSPVV…TCSTN → SPVLGEDEAVPGQHHPQHKP CQEGGCWDVLV in isoform 4. | VSP_002480 | ||||||||||||||||||||||||||
| Alternative sequence | 322 – 526 | 205 | Missing in isoform 3. | VSP_002479 | ||||||||||||||||||||||||||
| Alternative sequence | 352 – 526 | 175 | Missing in isoform 4. | VSP_002481 | ||||||||||||||||||||||||||
| Alternative sequence | 416 – 417 | 2 | YN → CK in isoform 2. | VSP_002482 | ||||||||||||||||||||||||||
| Alternative sequence | 418 – 526 | 109 | Missing in isoform 2. | VSP_002483 | ||||||||||||||||||||||||||
| Alternative sequence | 459 – 464 | 6 | RASDQR → SSGPLQ in isoform 8, isoform 9 and isoform 11. | VSP_040572 | ||||||||||||||||||||||||||
| Alternative sequence | 460 – 468 | 9 | ASDQRDLTE → TTPMTHLTR in isoform 10. | VSP_040573 | ||||||||||||||||||||||||||
| Alternative sequence | 465 – 526 | 62 | Missing in isoform 8, isoform 9 and isoform 11. | VSP_040574 | ||||||||||||||||||||||||||
| Alternative sequence | 469 – 526 | 58 | Missing in isoform 10. | VSP_040575 | ||||||||||||||||||||||||||
| Natural variant | 35 | 1 | Q → K. Ref.9 Corresponds to variant rs8111171 [ dbSNP | Ensembl ]. | VAR_049844 | ||||||||||||||||||||||||||
| Natural variant | 83 | 1 | A → V. Ref.9 Corresponds to variant rs8110904 [ dbSNP | Ensembl ]. | VAR_049845 | ||||||||||||||||||||||||||
| Natural variant | 123 | 1 | Q → H. Ref.9 Corresponds to variant rs8111468 [ dbSNP | Ensembl ]. | VAR_049846 | ||||||||||||||||||||||||||
| Natural variant | 376 | 1 | Q → R. Ref.9 Corresponds to variant rs41355544 [ dbSNP | Ensembl ]. | VAR_049847 | ||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||
| Sequence conflict | 142 | 1 | P → H in AAA57142. Ref.5 | |||||||||||||||||||||||||||
| Sequence conflict | 246 | 1 | D → Y in BAA02063. Ref.7 | |||||||||||||||||||||||||||
| Isoform 5: | ||||||||||||||||||||||||||||||
| Sequence conflict | 323 | 1 | N → L in AAA57143. Ref.5 | |||||||||||||||||||||||||||
| Sequence conflict | 337 | 1 | Q → E in AAA57143. Ref.5 | |||||||||||||||||||||||||||
| Sequence conflict | 329 | 1 | R → G in BAA02063. Ref.7 | |||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||
| Beta strand | 37 – 45 | 9 | ||||||||||||||||||||||||||||
| Beta strand | 51 – 56 | 6 | ||||||||||||||||||||||||||||
| Beta strand | 60 – 72 | 13 | ||||||||||||||||||||||||||||
| Helix | 75 – 77 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 78 – 83 | 6 | ||||||||||||||||||||||||||||
| Turn | 84 – 87 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 88 – 91 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 99 – 101 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 107 – 109 | 3 | ||||||||||||||||||||||||||||
| Helix | 114 – 116 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 118 – 126 | 9 | ||||||||||||||||||||||||||||
| Beta strand | 132 – 140 | 9 | ||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of a cDNA coding biliary glycoprotein I: primary structure of a glycoprotein immunologically crossreactive with carcinoembryonic antigen." Hinoda Y., Neumaier M., Hefta S.A., Drzeniek Z., Wagener C., Shively L., Hefta L.J.F., Shively J.E., Paxton R.J. Proc. Natl. Acad. Sci. U.S.A. 85:6959-6963(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. |
| [2] | Erratum Hinoda Y., Neumaier M., Hefta S.A., Drzeniek Z., Wagener C., Shively L., Hefta L.J.F., Shively J.E., Paxton R.J. Proc. Natl. Acad. Sci. U.S.A. 86:1668-1668(1989) Cited for: SEQUENCE REVISION. |
| [3] | "Carcinoembryonic antigens: alternative splicing accounts for the multiple mRNAs that code for novel members of the carcinoembryonic antigen family." Barnett T.R., Kretschmer A., Austen D.A., Goebel S.J., Hart J.T., Elting J.J., Kamarck M.E. J. Cell Biol. 108:267-276(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 6 AND 8). |
| [4] | "Three novel molecular forms of biliary glycoprotein deduced from cDNA clones from a human leukocyte library." Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Nakazato H., Matsuoka Y. Biochem. Biophys. Res. Commun. 176:578-585(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), SUBCELLULAR LOCATION, GLYCOSYLATION. Tissue: Leukocyte. |
| [5] | "Human biliary glycoprotein gene: characterization of a family of novel alternatively spliced RNAs and their expressed proteins." Barnett T.R., Drake L., Pickle W. II Mol. Cell. Biol. 13:1273-1282(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7), NUCLEOTIDE SEQUENCE [MRNA] OF 293-494 (ISOFORM 5), NUCLEOTIDE SEQUENCE [MRNA] OF 293-458 (ISOFORM 9), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 293-458, GLYCOSYLATION. |
| [6] | "CD66 identifies the biliary glycoprotein (BGP) adhesion molecule: cloning, expression, and adhesion functions of the BGPc splice variant." Watt S.M., Fawcett J., Murdoch S.J., Teixeira A.M., Gschmeissner S.E., Hajibagheri N.M., Simmons D.L. Blood 84:200-210(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8), SUBCELLULAR LOCATION. Tissue: Colon adenocarcinoma. |
| [7] | "A new isoform of human biliary glycoprotein (BGP) containing a domain encoded by an Alu-like sequence." Kuroki M., Matsuo Y., Misumi Y., Oikawa S., Matsuoka Y. Submitted (JUN-1992) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). Tissue: Monocyte. |
| [8] | "Isolation of the cDNA encoding a putative carcinoembryonic antigen-related cell adhesion molecule 1 short form 3 (CEACAM1-3S)." Long S., Phillips A., Ma H., Paoni N.F., Wong-Staal F., Fan W. Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 11). |
| [9] | SeattleSNPs variation discovery resource Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-35; VAL-83; HIS-123 AND ARG-376. |
| [10] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [12] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10). Tissue: Skin. |
| [13] | "Transcriptional control of the human biliary glycoprotein gene, a CEA gene family member down-regulated in colorectal carcinomas." Hauck W., Nedellec P., Turbide C., Stanners C.P., Barnett T.R., Beauchemin N. Eur. J. Biochem. 223:529-541(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-21, DISEASE. |
| [14] | "Characterization and transcriptional activity of the mouse biliary glycoprotein 1 gene, a carcinoembryonic antigen-related gene." Nedellec P., Turbide C., Beauchemin N. Eur. J. Biochem. 231:104-114(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-21. |
| [15] | "Redefined nomenclature for members of the carcinoembryonic antigen family." Beauchemin N., Draber P., Dveksler G., Gold P., Gray-Owen S., Grunert F., Hammarstrom S., Holmes K.V., Karlsson A., Kuroki M., Lin S.H., Lucka L., Najjar S.M., Neumaier M., Obrink B., Shively J.E., Skubitz K.M., Stanners C.P. Zimmermann W.Exp. Cell Res. 252:243-249(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NOMENCLATURE OF ALTERNATIVE SPLICING ISOFORMS. |
| [16] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-104 AND ASN-111, MASS SPECTROMETRY. Tissue: Plasma. |
| [17] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-152; ASN-208; ASN-224; ASN-363; ASN-378 AND ASN-405, MASS SPECTROMETRY. Tissue: Liver. |
| [18] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [19] | "Structure of the N-terminal domain of human CEACAM1: binding target of the opacity proteins during invasion of Neisseria meningitidis and N. gonorrhoeae." Fedarovich A., Tomberg J., Nicholas R.A., Davies C. Acta Crystallogr. D 62:971-979(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 34-141. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | J03858 mRNA. Translation: AAA51826.1. X14831 mRNA. Translation: CAA32940.1. X16354 mRNA. Translation: CAA34404.1. X16356 mRNA. Translation: CAA34405.1. D90311 mRNA. Translation: BAA14341.1. D90312 mRNA. Translation: BAA14342.1. D90313 mRNA. Translation: BAA14343.1. M69176 mRNA. Translation: AAA51825.1. M72238 mRNA. Translation: AAA58393.1. M72238 mRNA. Translation: AAA58394.1. M76741 Genomic DNA. Translation: AAA57141.1. Sequence problems. M76742 mRNA. Translation: AAA57142.1. M76743 mRNA. Translation: AAA57143.1. M76744 mRNA. Translation: AAA57144.1. S71326 mRNA. Translation: AAB31183.1. D12502 mRNA. Translation: BAA02063.1. AY766113 mRNA. Translation: AAV34600.1. DQ989182 Genomic DNA. Translation: ABI75349.1. AC004785 Genomic DNA. Translation: AAC18433.1. AC004785 Genomic DNA. Translation: AAC18434.1. AC004785 Genomic DNA. Translation: AAC18435.1. AC004785 Genomic DNA. Translation: AAC18436.1. AC004785 Genomic DNA. Translation: AAC18437.1. AC004785 Genomic DNA. Translation: AAC18438.1. AC004785 Genomic DNA. Translation: AAC18439.1. CH471126 Genomic DNA. Translation: EAW57137.1. CH471126 Genomic DNA. Translation: EAW57140.1. CH471126 Genomic DNA. Translation: EAW57141.1. CH471126 Genomic DNA. Translation: EAW57143.1. BC014473 mRNA. Translation: AAH14473.1. X67277 Genomic DNA. Translation: CAA47694.1. | ||||||||||||
| IPI | IPI00009938. IPI00012676. IPI00018920. IPI00018936. IPI00216039. IPI00328130. IPI00437847. IPI00641900. IPI00644390. IPI00879975. IPI00935840. | ||||||||||||
| PIR | A32164. B48078. JH0394. JH0395. JH0396. | ||||||||||||
| RefSeq | NP_001020083.1. NM_001024912.2. NP_001171742.1. NM_001184813.1. NP_001171744.1. NM_001184815.1. NP_001171745.1. NM_001184816.1. NP_001192273.1. NM_001205344.1. NP_001703.2. NM_001712.4. | ||||||||||||
| UniGene | Hs.512682. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P13688. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P13688. 5 interactions. | ||||||||||||
| MINT | MINT-5002435. | ||||||||||||
| STRING | 9606.ENSP00000161559. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P13688. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 399116. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P13688. | ||||||||||||
| PRIDE | P13688. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 634. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000161559; ENSP00000161559; ENSG00000079385. ENST00000351134; ENSP00000325946; ENSG00000079385. ENST00000352591; ENSP00000244291; ENSG00000079385. ENST00000358394; ENSP00000351165; ENSG00000079385. ENST00000403444; ENSP00000384709; ENSG00000079385. ENST00000403461; ENSP00000384083; ENSG00000079385. ENST00000599389; ENSP00000471918; ENSG00000079385. | ||||||||||||
| GeneID | 634. | ||||||||||||
| KEGG | hsa:634. | ||||||||||||
| UCSC | uc002otv.3. human. uc002otw.3. human. uc002otx.3. human. uc002oty.3. human. uc002otz.3. human. uc002oua.3. human. uc002oub.3. human. uc002ouc.3. human. uc010eij.3. human. uc010eik.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 634. | ||||||||||||
| GeneCards | GC19M043009. | ||||||||||||
| H-InvDB | HIX0017795. | ||||||||||||
| HGNC | HGNC:1814. CEACAM1. | ||||||||||||
| HPA | CAB002146. HPA011041. | ||||||||||||
| MIM | 109770. gene. | ||||||||||||
| neXtProt | NX_P13688. | ||||||||||||
| PharmGKB | PA26358. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG149650. | ||||||||||||
| HOVERGEN | HBG007922. | ||||||||||||
| KO | K06499. | ||||||||||||
| OMA | DHSNDPP. | ||||||||||||
| OrthoDB | EOG41ZFBV. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P13688. | ||||||||||||
| Bgee | P13688. | ||||||||||||
| CleanEx | HS_CEACAM1. | ||||||||||||
| Genevestigator | P13688. | ||||||||||||
| GermOnline | ENSG00000079385. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.60.40.10. 4 hits. | ||||||||||||
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR003599. Ig_sub. IPR003598. Ig_sub2. IPR013106. Ig_V-set. IPR013151. Immunoglobulin. [Graphical view] | ||||||||||||
| Pfam | PF00047. ig. 1 hit. PF07686. V-set. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00409. IG. 2 hits. SM00408. IGc2. 2 hits. [Graphical view] | ||||||||||||
| PROSITE | PS50835. IG_LIKE. 3 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| DrugBank | DB00113. Arcitumomab. | ||||||||||||
| EvolutionaryTrace | P13688. | ||||||||||||
| GenomeRNAi | 634. | ||||||||||||
| NextBio | 2562. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | CEAM1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P13688 Secondary accession number(s): A6NE38 Q9UQV9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
