Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P13688

- CEAM1_HUMAN

UniProt

P13688 - CEAM1_HUMAN

Protein

Carcinoembryonic antigen-related cell adhesion molecule 1

Gene

CEACAM1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 161 (01 Oct 2014)
      Sequence version 2 (01 Jul 1993)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. protein homodimerization activity Source: UniProtKB

    GO - Biological processi

    1. angiogenesis Source: UniProtKB
    2. cell migration Source: UniProtKB
    3. homophilic cell adhesion Source: UniProtKB
    4. integrin-mediated signaling pathway Source: UniProtKB

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Carcinoembryonic antigen-related cell adhesion molecule 1
    Alternative name(s):
    Biliary glycoprotein 1
    Short name:
    BGP-1
    CD_antigen: CD66a
    Gene namesi
    Name:CEACAM1
    Synonyms:BGP, BGP1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:1814. CEACAM1.

    Subcellular locationi

    Isoform 8 : Cell membrane; Single-pass type I membrane protein
    Note: Localizes to sites of cell-cell contact.

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. integral component of membrane Source: MGI
    3. integral component of plasma membrane Source: UniProtKB
    4. membrane Source: ProtInc
    5. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26358.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3434Add
    BLAST
    Chaini35 – 526492Carcinoembryonic antigen-related cell adhesion molecule 1PRO_0000014562Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei35 – 351Pyrrolidone carboxylic acid1 Publication
    Glycosylationi104 – 1041N-linked (GlcNAc...)1 Publication
    Glycosylationi111 – 1111N-linked (GlcNAc...)1 Publication
    Glycosylationi115 – 1151N-linked (GlcNAc...)
    Glycosylationi152 – 1521N-linked (GlcNAc...)1 Publication
    Disulfide bondi167 ↔ 215Curated
    Glycosylationi182 – 1821N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi197 – 1971N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi208 – 2081N-linked (GlcNAc...)1 Publication
    Glycosylationi224 – 2241N-linked (GlcNAc...)1 Publication
    Glycosylationi232 – 2321N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi254 – 2541N-linked (GlcNAc...)
    Disulfide bondi259 ↔ 299Curated
    Glycosylationi274 – 2741N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi288 – 2881N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi292 – 2921N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi302 – 3021N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi309 – 3091N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi345 – 3451N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi348 ↔ 396Curated
    Glycosylationi351 – 3511N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi363 – 3631N-linked (GlcNAc...)1 Publication
    Glycosylationi378 – 3781N-linked (GlcNAc...)1 Publication
    Glycosylationi405 – 4051N-linked (GlcNAc...)1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Pyrrolidone carboxylic acid

    Proteomic databases

    MaxQBiP13688.
    PaxDbiP13688.
    PRIDEiP13688.

    PTM databases

    PhosphoSiteiP13688.

    Expressioni

    Gene expression databases

    ArrayExpressiP13688.
    BgeeiP13688.
    CleanExiHS_CEACAM1.
    GenevestigatoriP13688.

    Organism-specific databases

    HPAiCAB002146.
    HPA011041.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CARTPTQ165683EBI-4314481,EBI-4314526
    CEACAM6P401992EBI-4314481,EBI-4314501
    uspa1Q8GH8712EBI-4314481,EBI-7936357From a different organism.

    Protein-protein interaction databases

    BioGridi107103. 11 interactions.
    IntActiP13688. 6 interactions.
    MINTiMINT-5002435.
    STRINGi9606.ENSP00000161559.

    Structurei

    Secondary structure

    1
    526
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi37 – 459
    Beta strandi51 – 566
    Beta strandi60 – 7213
    Helixi75 – 773
    Beta strandi78 – 836
    Turni84 – 874
    Beta strandi88 – 914
    Beta strandi99 – 1013
    Beta strandi107 – 1093
    Helixi114 – 1163
    Beta strandi118 – 1269
    Beta strandi132 – 1409

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2GK2X-ray2.20A/B34-141[»]
    ProteinModelPortaliP13688.
    SMRiP13688. Positions 34-414.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP13688.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini35 – 428394ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini453 – 52674CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei429 – 45224HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini35 – 142108Ig-like V-typeAdd
    BLAST
    Domaini145 – 23288Ig-like C2-type 1Add
    BLAST
    Domaini237 – 31781Ig-like C2-type 2Add
    BLAST
    Domaini323 – 41391Ig-like C2-type 3Add
    BLAST

    Sequence similaritiesi

    Belongs to the immunoglobulin superfamily. CEA family.Curated

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG149650.
    HOVERGENiHBG007922.
    KOiK06499.
    OMAiNTSYLWS.
    OrthoDBiEOG74BJS7.
    PhylomeDBiP13688.
    TreeFamiTF336859.

    Family and domain databases

    Gene3Di2.60.40.10. 4 hits.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR013106. Ig_V-set.
    IPR013151. Immunoglobulin.
    [Graphical view]
    PfamiPF00047. ig. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view]
    SMARTiSM00409. IG. 2 hits.
    SM00408. IGc2. 2 hits.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 3 hits.
    [Graphical view]

    Sequences (11)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 11 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P13688-1) [UniParc]FASTAAdd to Basket

    Also known as: BGPa, CEACAM1-4L, TM1-CEA

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGHLSAPLHR VRVPWQGLLL TASLLTFWNP PTTAQLTTES MPFNVAEGKE    50
    VLLLVHNLPQ QLFGYSWYKG ERVDGNRQIV GYAIGTQQAT PGPANSGRET 100
    IYPNASLLIQ NVTQNDTGFY TLQVIKSDLV NEEATGQFHV YPELPKPSIS 150
    SNNSNPVEDK DAVAFTCEPE TQDTTYLWWI NNQSLPVSPR LQLSNGNRTL 200
    TLLSVTRNDT GPYECEIQNP VSANRSDPVT LNVTYGPDTP TISPSDTYYR 250
    PGANLSLSCY AASNPPAQYS WLINGTFQQS TQELFIPNIT VNNSGSYTCH 300
    ANNSVTGCNR TTVKTIIVTE LSPVVAKPQI KASKTTVTGD KDSVNLTCST 350
    NDTGISIRWF FKNQSLPSSE RMKLSQGNTT LSINPVKRED AGTYWCEVFN 400
    PISKNQSDPI MLNVNYNALP QENGLSPGAI AGIVIGVVAL VALIAVALAC 450
    FLHFGKTGRA SDQRDLTEHK PSVSNHTQDH SNDPPNKMNE VTYSTLNFEA 500
    QQPTQPTSAS PSLTATEIIY SEVKKQ 526
    Length:526
    Mass (Da):57,560
    Last modified:July 1, 1993 - v2
    Checksum:iCAD1B2328D069AF8
    GO
    Isoform 2 (identifier: P13688-2) [UniParc]FASTAAdd to Basket

    Also known as: BGPg, CEACAM1-4C1

    The sequence of this isoform differs from the canonical sequence as follows:
         416-417: YN → CK
         418-526: Missing.

    Show »
    Length:417
    Mass (Da):45,950
    Checksum:i5D4B9F86184AA4B4
    GO
    Isoform 3 (identifier: P13688-3) [UniParc]FASTAAdd to Basket

    Also known as: BGPh, CEACAM1-3

    The sequence of this isoform differs from the canonical sequence as follows:
         320-321: EL → GK
         322-526: Missing.

    Show »
    Length:321
    Mass (Da):35,302
    Checksum:i81DE2F4E62AD42A7
    GO
    Isoform 4 (identifier: P13688-4) [UniParc]FASTAAdd to Basket

    Also known as: BGPi, CEACAM1-3C2

    The sequence of this isoform differs from the canonical sequence as follows:
         321-351: LSPVVAKPQIKASKTTVTGDKDSVNLTCSTN → SPVLGEDEAVPGQHHPQHKPCQEGGCWDVLV
         352-526: Missing.

    Show »
    Length:351
    Mass (Da):38,578
    Checksum:i33CEF445429E8DD4
    GO
    Isoform 5 (identifier: P13688-5) [UniParc]FASTAAdd to Basket

    Also known as: BGPy, CEACAM1-3AL

    The sequence of this isoform differs from the canonical sequence as follows:
         321-416: LSPVVAKPQI...SDPIMLNVNY → RQNLTMLPRLDSNSWAQAILPSVSQSAEITD

    Show »
    Length:461
    Mass (Da):50,349
    Checksum:iE7810D2559DF7A8F
    GO
    Isoform 6 (identifier: P13688-6) [UniParc]FASTAAdd to Basket

    Also known as: BGPb, CEACAM1-3L, TM2-CEA

    The sequence of this isoform differs from the canonical sequence as follows:
         320-416: ELSPVVAKPQ...SDPIMLNVNY → D

    Show »
    Length:430
    Mass (Da):46,910
    Checksum:i195DE9F171D1414F
    GO
    Isoform 7 (identifier: P13688-7) [UniParc]FASTAAdd to Basket

    Also known as: BGPx, CEACAM1-1L

    The sequence of this isoform differs from the canonical sequence as follows:
         143-416: Missing.

    Show »
    Length:252
    Mass (Da):27,431
    Checksum:i6C85A702292B6367
    GO
    Isoform 8 (identifier: P13688-8) [UniParc]FASTAAdd to Basket

    Also known as: BGPc, CEACAM1-4S, TM3-CEA

    The sequence of this isoform differs from the canonical sequence as follows:
         459-464: RASDQR → SSGPLQ
         465-526: Missing.

    Show »
    Length:464
    Mass (Da):50,521
    Checksum:i598E4D71BF05EDA9
    GO
    Isoform 9 (identifier: P13688-9) [UniParc]FASTAAdd to Basket

    Also known as: BGPz, CEACAM1-3AS

    The sequence of this isoform differs from the canonical sequence as follows:
         321-416: LSPVVAKPQI...SDPIMLNVNY → MAFHHVAKAGLKLLSSSNPPASTSQSAKITD
         459-464: RASDQR → SSGPLQ
         465-526: Missing.

    Show »
    Length:399
    Mass (Da):43,062
    Checksum:i0BC49C50F3525841
    GO
    Isoform 10 (identifier: P13688-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         460-468: ASDQRDLTE → TTPMTHLTR
         469-526: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:468
    Mass (Da):51,147
    Checksum:i215C1A33EEFFFD68
    GO
    Isoform 11 (identifier: P13688-11) [UniParc]FASTAAdd to Basket

    Also known as: BGPd, CEACAM1-3S

    The sequence of this isoform differs from the canonical sequence as follows:
         320-416: ELSPVVAKPQ...SDPIMLNVNY → D
         459-464: RASDQR → SSGPLQ
         465-526: Missing.

    Show »
    Length:368
    Mass (Da):39,871
    Checksum:i23D7E54B4DC54318
    GO

    Sequence cautioni

    The sequence AAA57141.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti142 – 1421P → H in AAA57142. (PubMed:8423792)Curated
    Sequence conflicti246 – 2461D → Y in BAA02063. 1 PublicationCurated
    Isoform 5 (identifier: P13688-5)
    Sequence conflicti323 – 3231N → L in AAA57143. (PubMed:8423792)Curated
    Sequence conflicti329 – 3291R → G in BAA02063. 1 PublicationCurated
    Sequence conflicti337 – 3371Q → E in AAA57143. (PubMed:8423792)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti35 – 351Q → K.1 Publication
    Corresponds to variant rs8111171 [ dbSNP | Ensembl ].
    VAR_049844
    Natural varianti83 – 831A → V.1 Publication
    Corresponds to variant rs8110904 [ dbSNP | Ensembl ].
    VAR_049845
    Natural varianti123 – 1231Q → H.1 Publication
    Corresponds to variant rs8111468 [ dbSNP | Ensembl ].
    VAR_049846
    Natural varianti376 – 3761Q → R.1 Publication
    Corresponds to variant rs41355544 [ dbSNP | Ensembl ].
    VAR_049847

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei143 – 416274Missing in isoform 7. 1 PublicationVSP_012222Add
    BLAST
    Alternative sequencei320 – 41697ELSPV…LNVNY → D in isoform 6 and isoform 11. 2 PublicationsVSP_010938Add
    BLAST
    Alternative sequencei320 – 3212EL → GK in isoform 3. 1 PublicationVSP_002478
    Alternative sequencei321 – 41696LSPVV…LNVNY → RQNLTMLPRLDSNSWAQAIL PSVSQSAEITD in isoform 5. 2 PublicationsVSP_009227Add
    BLAST
    Alternative sequencei321 – 41696LSPVV…LNVNY → MAFHHVAKAGLKLLSSSNPP ASTSQSAKITD in isoform 9. 1 PublicationVSP_040571Add
    BLAST
    Alternative sequencei321 – 35131LSPVV…TCSTN → SPVLGEDEAVPGQHHPQHKP CQEGGCWDVLV in isoform 4. 1 PublicationVSP_002480Add
    BLAST
    Alternative sequencei322 – 526205Missing in isoform 3. 1 PublicationVSP_002479Add
    BLAST
    Alternative sequencei352 – 526175Missing in isoform 4. 1 PublicationVSP_002481Add
    BLAST
    Alternative sequencei416 – 4172YN → CK in isoform 2. 1 PublicationVSP_002482
    Alternative sequencei418 – 526109Missing in isoform 2. 1 PublicationVSP_002483Add
    BLAST
    Alternative sequencei459 – 4646RASDQR → SSGPLQ in isoform 8, isoform 9 and isoform 11. 4 PublicationsVSP_040572
    Alternative sequencei460 – 4689ASDQRDLTE → TTPMTHLTR in isoform 10. 1 PublicationVSP_040573
    Alternative sequencei465 – 52662Missing in isoform 8, isoform 9 and isoform 11. 4 PublicationsVSP_040574Add
    BLAST
    Alternative sequencei469 – 52658Missing in isoform 10. 1 PublicationVSP_040575Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    J03858 mRNA. Translation: AAA51826.1.
    X14831 mRNA. Translation: CAA32940.1.
    X16354 mRNA. Translation: CAA34404.1.
    X16356 mRNA. Translation: CAA34405.1.
    D90311 mRNA. Translation: BAA14341.1.
    D90312 mRNA. Translation: BAA14342.1.
    D90313 mRNA. Translation: BAA14343.1.
    M69176 mRNA. Translation: AAA51825.1.
    M72238 mRNA. Translation: AAA58393.1.
    M72238 mRNA. Translation: AAA58394.1.
    M76741 Genomic DNA. Translation: AAA57141.1. Sequence problems.
    M76742 mRNA. Translation: AAA57142.1.
    M76743 mRNA. Translation: AAA57143.1.
    M76744 mRNA. Translation: AAA57144.1.
    S71326 mRNA. Translation: AAB31183.1.
    D12502 mRNA. Translation: BAA02063.1.
    AY766113 mRNA. Translation: AAV34600.1.
    DQ989182 Genomic DNA. Translation: ABI75349.1.
    AC004785 Genomic DNA. Translation: AAC18433.1.
    AC004785 Genomic DNA. Translation: AAC18434.1.
    AC004785 Genomic DNA. Translation: AAC18435.1.
    AC004785 Genomic DNA. Translation: AAC18436.1.
    AC004785 Genomic DNA. Translation: AAC18437.1.
    AC004785 Genomic DNA. Translation: AAC18438.1.
    AC004785 Genomic DNA. Translation: AAC18439.1.
    CH471126 Genomic DNA. Translation: EAW57137.1.
    CH471126 Genomic DNA. Translation: EAW57140.1.
    CH471126 Genomic DNA. Translation: EAW57141.1.
    CH471126 Genomic DNA. Translation: EAW57143.1.
    BC014473 mRNA. Translation: AAH14473.1.
    X67277 Genomic DNA. Translation: CAA47694.1.
    CCDSiCCDS12609.1. [P13688-1]
    CCDS46089.1. [P13688-8]
    CCDS54272.1. [P13688-11]
    CCDS54273.1. [P13688-6]
    CCDS54274.1. [P13688-5]
    PIRiA32164.
    B48078.
    JH0394.
    JH0395.
    JH0396.
    RefSeqiNP_001020083.1. NM_001024912.2. [P13688-8]
    NP_001171742.1. NM_001184813.1. [P13688-6]
    NP_001171744.1. NM_001184815.1. [P13688-5]
    NP_001171745.1. NM_001184816.1. [P13688-11]
    NP_001192273.1. NM_001205344.1. [P13688-10]
    NP_001703.2. NM_001712.4. [P13688-1]
    UniGeneiHs.512682.

    Genome annotation databases

    EnsembliENST00000161559; ENSP00000161559; ENSG00000079385. [P13688-1]
    ENST00000352591; ENSP00000244291; ENSG00000079385. [P13688-6]
    ENST00000358394; ENSP00000351165; ENSG00000079385. [P13688-5]
    ENST00000403444; ENSP00000384709; ENSG00000079385. [P13688-8]
    ENST00000403461; ENSP00000384083; ENSG00000079385. [P13688-11]
    ENST00000599389; ENSP00000471918; ENSG00000079385. [P13688-9]
    GeneIDi634.
    KEGGihsa:634.
    UCSCiuc002otv.3. human. [P13688-1]
    uc002otw.3. human. [P13688-8]
    uc002otx.3. human. [P13688-5]
    uc002oty.3. human. [P13688-6]
    uc002otz.3. human. [P13688-11]
    uc002oua.3. human. [P13688-2]
    uc002oub.3. human. [P13688-4]
    uc002ouc.3. human. [P13688-3]
    uc010eij.3. human. [P13688-10]
    uc010eik.3. human. [P13688-7]

    Polymorphism databases

    DMDMi399116.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    SeattleSNPs
    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    J03858 mRNA. Translation: AAA51826.1 .
    X14831 mRNA. Translation: CAA32940.1 .
    X16354 mRNA. Translation: CAA34404.1 .
    X16356 mRNA. Translation: CAA34405.1 .
    D90311 mRNA. Translation: BAA14341.1 .
    D90312 mRNA. Translation: BAA14342.1 .
    D90313 mRNA. Translation: BAA14343.1 .
    M69176 mRNA. Translation: AAA51825.1 .
    M72238 mRNA. Translation: AAA58393.1 .
    M72238 mRNA. Translation: AAA58394.1 .
    M76741 Genomic DNA. Translation: AAA57141.1 . Sequence problems.
    M76742 mRNA. Translation: AAA57142.1 .
    M76743 mRNA. Translation: AAA57143.1 .
    M76744 mRNA. Translation: AAA57144.1 .
    S71326 mRNA. Translation: AAB31183.1 .
    D12502 mRNA. Translation: BAA02063.1 .
    AY766113 mRNA. Translation: AAV34600.1 .
    DQ989182 Genomic DNA. Translation: ABI75349.1 .
    AC004785 Genomic DNA. Translation: AAC18433.1 .
    AC004785 Genomic DNA. Translation: AAC18434.1 .
    AC004785 Genomic DNA. Translation: AAC18435.1 .
    AC004785 Genomic DNA. Translation: AAC18436.1 .
    AC004785 Genomic DNA. Translation: AAC18437.1 .
    AC004785 Genomic DNA. Translation: AAC18438.1 .
    AC004785 Genomic DNA. Translation: AAC18439.1 .
    CH471126 Genomic DNA. Translation: EAW57137.1 .
    CH471126 Genomic DNA. Translation: EAW57140.1 .
    CH471126 Genomic DNA. Translation: EAW57141.1 .
    CH471126 Genomic DNA. Translation: EAW57143.1 .
    BC014473 mRNA. Translation: AAH14473.1 .
    X67277 Genomic DNA. Translation: CAA47694.1 .
    CCDSi CCDS12609.1. [P13688-1 ]
    CCDS46089.1. [P13688-8 ]
    CCDS54272.1. [P13688-11 ]
    CCDS54273.1. [P13688-6 ]
    CCDS54274.1. [P13688-5 ]
    PIRi A32164.
    B48078.
    JH0394.
    JH0395.
    JH0396.
    RefSeqi NP_001020083.1. NM_001024912.2. [P13688-8 ]
    NP_001171742.1. NM_001184813.1. [P13688-6 ]
    NP_001171744.1. NM_001184815.1. [P13688-5 ]
    NP_001171745.1. NM_001184816.1. [P13688-11 ]
    NP_001192273.1. NM_001205344.1. [P13688-10 ]
    NP_001703.2. NM_001712.4. [P13688-1 ]
    UniGenei Hs.512682.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2GK2 X-ray 2.20 A/B 34-141 [» ]
    ProteinModelPortali P13688.
    SMRi P13688. Positions 34-414.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107103. 11 interactions.
    IntActi P13688. 6 interactions.
    MINTi MINT-5002435.
    STRINGi 9606.ENSP00000161559.

    Chemistry

    DrugBanki DB00113. Arcitumomab.

    PTM databases

    PhosphoSitei P13688.

    Polymorphism databases

    DMDMi 399116.

    Proteomic databases

    MaxQBi P13688.
    PaxDbi P13688.
    PRIDEi P13688.

    Protocols and materials databases

    DNASUi 634.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000161559 ; ENSP00000161559 ; ENSG00000079385 . [P13688-1 ]
    ENST00000352591 ; ENSP00000244291 ; ENSG00000079385 . [P13688-6 ]
    ENST00000358394 ; ENSP00000351165 ; ENSG00000079385 . [P13688-5 ]
    ENST00000403444 ; ENSP00000384709 ; ENSG00000079385 . [P13688-8 ]
    ENST00000403461 ; ENSP00000384083 ; ENSG00000079385 . [P13688-11 ]
    ENST00000599389 ; ENSP00000471918 ; ENSG00000079385 . [P13688-9 ]
    GeneIDi 634.
    KEGGi hsa:634.
    UCSCi uc002otv.3. human. [P13688-1 ]
    uc002otw.3. human. [P13688-8 ]
    uc002otx.3. human. [P13688-5 ]
    uc002oty.3. human. [P13688-6 ]
    uc002otz.3. human. [P13688-11 ]
    uc002oua.3. human. [P13688-2 ]
    uc002oub.3. human. [P13688-4 ]
    uc002ouc.3. human. [P13688-3 ]
    uc010eij.3. human. [P13688-10 ]
    uc010eik.3. human. [P13688-7 ]

    Organism-specific databases

    CTDi 634.
    GeneCardsi GC19M043009.
    H-InvDB HIX0017795.
    HGNCi HGNC:1814. CEACAM1.
    HPAi CAB002146.
    HPA011041.
    MIMi 109770. gene.
    neXtProti NX_P13688.
    PharmGKBi PA26358.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG149650.
    HOVERGENi HBG007922.
    KOi K06499.
    OMAi NTSYLWS.
    OrthoDBi EOG74BJS7.
    PhylomeDBi P13688.
    TreeFami TF336859.

    Miscellaneous databases

    EvolutionaryTracei P13688.
    GeneWikii CEACAM1.
    GenomeRNAii 634.
    NextBioi 2562.
    PROi P13688.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P13688.
    Bgeei P13688.
    CleanExi HS_CEACAM1.
    Genevestigatori P13688.

    Family and domain databases

    Gene3Di 2.60.40.10. 4 hits.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR013106. Ig_V-set.
    IPR013151. Immunoglobulin.
    [Graphical view ]
    Pfami PF00047. ig. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view ]
    SMARTi SM00409. IG. 2 hits.
    SM00408. IGc2. 2 hits.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of a cDNA coding biliary glycoprotein I: primary structure of a glycoprotein immunologically crossreactive with carcinoembryonic antigen."
      Hinoda Y., Neumaier M., Hefta S.A., Drzeniek Z., Wagener C., Shively L., Hefta L.J.F., Shively J.E., Paxton R.J.
      Proc. Natl. Acad. Sci. U.S.A. 85:6959-6963(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, PYROGLUTAMATE FORMATION AT GLN-35.
    2. Erratum
      Hinoda Y., Neumaier M., Hefta S.A., Drzeniek Z., Wagener C., Shively L., Hefta L.J.F., Shively J.E., Paxton R.J.
      Proc. Natl. Acad. Sci. U.S.A. 86:1668-1668(1989)
      Cited for: SEQUENCE REVISION.
    3. "Carcinoembryonic antigens: alternative splicing accounts for the multiple mRNAs that code for novel members of the carcinoembryonic antigen family."
      Barnett T.R., Kretschmer A., Austen D.A., Goebel S.J., Hart J.T., Elting J.J., Kamarck M.E.
      J. Cell Biol. 108:267-276(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 6 AND 8).
    4. "Three novel molecular forms of biliary glycoprotein deduced from cDNA clones from a human leukocyte library."
      Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Nakazato H., Matsuoka Y.
      Biochem. Biophys. Res. Commun. 176:578-585(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), SUBCELLULAR LOCATION, GLYCOSYLATION.
      Tissue: Leukocyte.
    5. "Human biliary glycoprotein gene: characterization of a family of novel alternatively spliced RNAs and their expressed proteins."
      Barnett T.R., Drake L., Pickle W. II
      Mol. Cell. Biol. 13:1273-1282(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7), NUCLEOTIDE SEQUENCE [MRNA] OF 293-494 (ISOFORM 5), NUCLEOTIDE SEQUENCE [MRNA] OF 293-458 (ISOFORM 9), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 293-458, GLYCOSYLATION.
    6. "CD66 identifies the biliary glycoprotein (BGP) adhesion molecule: cloning, expression, and adhesion functions of the BGPc splice variant."
      Watt S.M., Fawcett J., Murdoch S.J., Teixeira A.M., Gschmeissner S.E., Hajibagheri N.M., Simmons D.L.
      Blood 84:200-210(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8), SUBCELLULAR LOCATION.
      Tissue: Colon adenocarcinoma.
    7. "A new isoform of human biliary glycoprotein (BGP) containing a domain encoded by an Alu-like sequence."
      Kuroki M., Matsuo Y., Misumi Y., Oikawa S., Matsuoka Y.
      Submitted (JUN-1992) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
      Tissue: Monocyte.
    8. "Isolation of the cDNA encoding a putative carcinoembryonic antigen-related cell adhesion molecule 1 short form 3 (CEACAM1-3S)."
      Long S., Phillips A., Ma H., Paoni N.F., Wong-Staal F., Fan W.
      Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 11).
    9. SeattleSNPs variation discovery resource
      Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-35; VAL-83; HIS-123 AND ARG-376.
    10. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    12. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10).
      Tissue: Skin.
    13. "Transcriptional control of the human biliary glycoprotein gene, a CEA gene family member down-regulated in colorectal carcinomas."
      Hauck W., Nedellec P., Turbide C., Stanners C.P., Barnett T.R., Beauchemin N.
      Eur. J. Biochem. 223:529-541(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-21, DISEASE.
    14. "Characterization and transcriptional activity of the mouse biliary glycoprotein 1 gene, a carcinoembryonic antigen-related gene."
      Nedellec P., Turbide C., Beauchemin N.
      Eur. J. Biochem. 231:104-114(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-21.
    15. Cited for: NOMENCLATURE OF ALTERNATIVE SPLICING ISOFORMS.
    16. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
      Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
      J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-104 AND ASN-111.
      Tissue: Plasma.
    17. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-152; ASN-208; ASN-224; ASN-363; ASN-378 AND ASN-405.
      Tissue: Liver.
    18. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    19. "Structure of the N-terminal domain of human CEACAM1: binding target of the opacity proteins during invasion of Neisseria meningitidis and N. gonorrhoeae."
      Fedarovich A., Tomberg J., Nicholas R.A., Davies C.
      Acta Crystallogr. D 62:971-979(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 34-141.

    Entry informationi

    Entry nameiCEAM1_HUMAN
    AccessioniPrimary (citable) accession number: P13688
    Secondary accession number(s): A6NE38
    , A8MY49, O60430, Q069I7, Q13854, Q13857, Q13858, Q13859, Q13860, Q15600, Q15601, Q16170, Q5UB49, Q7KYP5, Q96CA7, Q9UQV9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 1, 1990
    Last sequence update: July 1, 1993
    Last modified: October 1, 2014
    This is version 161 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3