Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P13611

- CSPG2_HUMAN

UniProt

P13611 - CSPG2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Versican core protein

Gene

VCAN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. carbohydrate binding Source: UniProtKB-KW
  3. glycosaminoglycan binding Source: ProtInc
  4. hyaluronic acid binding Source: ProtInc

GO - Biological processi

  1. carbohydrate metabolic process Source: Reactome
  2. cell adhesion Source: ProtInc
  3. cell recognition Source: ProtInc
  4. chondroitin sulfate biosynthetic process Source: Reactome
  5. chondroitin sulfate catabolic process Source: Reactome
  6. chondroitin sulfate metabolic process Source: Reactome
  7. dermatan sulfate biosynthetic process Source: Reactome
  8. extracellular matrix organization Source: Reactome
  9. glial cell migration Source: BHF-UCL
  10. glycosaminoglycan metabolic process Source: Reactome
  11. heart development Source: Ensembl
  12. multicellular organismal development Source: ProtInc
  13. osteoblast differentiation Source: UniProt
  14. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Ligandi

Calcium, Hyaluronic acid, Lectin

Enzyme and pathway databases

ReactomeiREACT_120800. Dermatan sulfate biosynthesis.
REACT_120888. CS/DS degradation.
REACT_120989. Chondroitin sulfate biosynthesis.
REACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.
REACT_163906. ECM proteoglycans.

Names & Taxonomyi

Protein namesi
Recommended name:
Versican core protein
Alternative name(s):
Chondroitin sulfate proteoglycan core protein 2
Short name:
Chondroitin sulfate proteoglycan 2
Glial hyaluronate-binding protein
Short name:
GHAP
Large fibroblast proteoglycan
PG-M
Gene namesi
Name:VCAN
Synonyms:CSPG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:2464. VCAN.

Subcellular locationi

GO - Cellular componenti

  1. extracellular matrix Source: UniProtKB
  2. extracellular region Source: Reactome
  3. extracellular space Source: BHF-UCL
  4. Golgi lumen Source: Reactome
  5. intracellular membrane-bounded organelle Source: HPA
  6. lysosomal lumen Source: Reactome
  7. membrane Source: UniProt
  8. proteinaceous extracellular matrix Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Involvement in diseasei

Wagner vitreoretinopathy (WGVRP) [MIM:143200]: A rare vitreoretinopathy characterized by an optically empty vitreous cavity with fibrillary condensations and a preretinal avascular membrane. Other optical features include progressive chorioretinal atrophy, perivascular sheating, subcapsular cataract and myopia.2 Publications
Note: The disease is caused by mutations affecting the gene represented in this entry. The pathological mechanism involves a quantitave imbalance of the normally occurring splice variants (PubMed:22739342).1 Publication

Keywords - Diseasei

Cataract

Organism-specific databases

MIMi143200. phenotype.
Orphaneti898. Wagner disease.
PharmGKBiPA162408788.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 20201 PublicationAdd
BLAST
Chaini21 – 33963376Versican core proteinPRO_0000017522Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi44 ↔ 130By similarity
Glycosylationi57 – 571N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi172 ↔ 243By similarity
Disulfide bondi196 ↔ 217By similarity
Disulfide bondi270 ↔ 345By similarity
Disulfide bondi294 ↔ 315By similarity
Glycosylationi330 – 3301N-linked (GlcNAc...)
Glycosylationi615 – 6151N-linked (GlcNAc...)Sequence Analysis
Glycosylationi782 – 7821N-linked (GlcNAc...)Sequence Analysis
Glycosylationi809 – 8091N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1332 – 13321N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1398 – 13981N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1442 – 14421N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1468 – 14681N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1663 – 16631N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1898 – 18981N-linked (GlcNAc...)Sequence Analysis
Glycosylationi2179 – 21791N-linked (GlcNAc...)Sequence Analysis
Glycosylationi2272 – 22721N-linked (GlcNAc...)Sequence Analysis
Glycosylationi2280 – 22801N-linked (GlcNAc...)Sequence Analysis
Glycosylationi2360 – 23601N-linked (GlcNAc...)Sequence Analysis
Glycosylationi2385 – 23851N-linked (GlcNAc...)Sequence Analysis
Glycosylationi2392 – 23921N-linked (GlcNAc...)Sequence Analysis
Glycosylationi2496 – 24961N-linked (GlcNAc...)Sequence Analysis
Glycosylationi2628 – 26281N-linked (GlcNAc...)Sequence Analysis
Glycosylationi2934 – 29341N-linked (GlcNAc...)Sequence Analysis
Glycosylationi3067 – 30671N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi3093 ↔ 3104By similarity
Disulfide bondi3098 ↔ 3113By similarity
Disulfide bondi3115 ↔ 3124By similarity
Disulfide bondi3131 ↔ 3142By similarity
Disulfide bondi3136 ↔ 3151By similarity
Disulfide bondi3153 ↔ 3162By similarity
Disulfide bondi3169 ↔ 3180By similarity
Disulfide bondi3197 ↔ 3289By similarity
Disulfide bondi3265 ↔ 3281By similarity
Disulfide bondi3296 ↔ 3339By similarity
Disulfide bondi3325 ↔ 3352By similarity
Glycosylationi3369 – 33691N-linked (GlcNAc...)Sequence Analysis
Glycosylationi3379 – 33791N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

Phosphorylation sites are present in the extracellular medium.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein, Proteoglycan

Proteomic databases

MaxQBiP13611.
PaxDbiP13611.
PRIDEiP13611.

PTM databases

PhosphoSiteiP13611.

Miscellaneous databases

PMAP-CutDBP13611.

Expressioni

Tissue specificityi

Cerebral white matter and plasma. Isoform V0 and isoform V1 are expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V2 is restricted to normal brain and gliomas. Isoform V3 is found in all these tissues except medulloblastomas.

Developmental stagei

Disappears after the cartilage development.

Gene expression databases

BgeeiP13611.
CleanExiHS_VCAN.
ExpressionAtlasiP13611. baseline and differential.
GenevestigatoriP13611.

Organism-specific databases

HPAiCAB008979.
HPA004726.

Interactioni

Subunit structurei

Interacts with FBLN1.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
MMP9P147803EBI-8515977,EBI-1382326

Protein-protein interaction databases

BioGridi107844. 18 interactions.
IntActiP13611. 5 interactions.
MINTiMINT-4529155.
STRINGi9606.ENSP00000265077.

Structurei

3D structure databases

ProteinModelPortaliP13611.
SMRiP13611. Positions 23-136, 151-247, 260-348, 3047-3292.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini21 – 146126Ig-like V-typeAdd
BLAST
Domaini150 – 24596Link 1PROSITE-ProRule annotationAdd
BLAST
Domaini251 – 34797Link 2PROSITE-ProRule annotationAdd
BLAST
Domaini3089 – 312537EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini3127 – 316337EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini3176 – 3290115C-type lectinPROSITE-ProRule annotationAdd
BLAST
Domaini3294 – 335461SushiPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni348 – 1335988GAG-alpha (glucosaminoglycan attachment domain)Add
BLAST
Regioni1336 – 30891754GAG-betaAdd
BLAST

Sequence similaritiesi

Contains 1 C-type lectin domain.PROSITE-ProRule annotation
Contains 2 EGF-like domains.PROSITE-ProRule annotation
Contains 2 Link domains.PROSITE-ProRule annotation
Contains 1 Sushi (CCP/SCR) domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Immunoglobulin domain, Repeat, Signal, Sushi

Phylogenomic databases

eggNOGiNOG12793.
GeneTreeiENSGT00760000119025.
HOVERGENiHBG051140.
InParanoidiP13611.
KOiK06793.
OMAiTQEEFPW.
OrthoDBiEOG7J70DP.
PhylomeDBiP13611.
TreeFamiTF332134.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
3.10.100.10. 3 hits.
InterProiIPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR018378. C-type_lectin_CS.
IPR016187. C-type_lectin_fold.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR000538. Link.
IPR000436. Sushi_SCR_CCP.
[Graphical view]
PfamiPF00008. EGF. 2 hits.
PF00059. Lectin_C. 1 hit.
PF00084. Sushi. 1 hit.
PF07686. V-set. 1 hit.
PF00193. Xlink. 2 hits.
[Graphical view]
PRINTSiPR01265. LINKMODULE.
SMARTiSM00032. CCP. 1 hit.
SM00034. CLECT. 1 hit.
SM00181. EGF. 1 hit.
SM00179. EGF_CA. 1 hit.
SM00409. IG. 1 hit.
SM00445. LINK. 2 hits.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 3 hits.
SSF57535. SSF57535. 1 hit.
PROSITEiPS00010. ASX_HYDROXYL. 1 hit.
PS00615. C_TYPE_LECTIN_1. 1 hit.
PS50041. C_TYPE_LECTIN_2. 1 hit.
PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 2 hits.
PS01187. EGF_CA. 1 hit.
PS50835. IG_LIKE. 1 hit.
PS01241. LINK_1. 2 hits.
PS50963. LINK_2. 2 hits.
PS50923. SUSHI. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform V0 (identifier: P13611-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFINIKSILW MCSTLIVTHA LHKVKVGKSP PVRGSLSGKV SLPCHFSTMP
60 70 80 90 100
TLPPSYNTSE FLRIKWSKIE VDKNGKDLKE TTVLVAQNGN IKIGQDYKGR
110 120 130 140 150
VSVPTHPEAV GDASLTVVKL LASDAGLYRC DVMYGIEDTQ DTVSLTVDGV
160 170 180 190 200
VFHYRAATSR YTLNFEAAQK ACLDVGAVIA TPEQLFAAYE DGFEQCDAGW
210 220 230 240 250
LADQTVRYPI RAPRVGCYGD KMGKAGVRTY GFRSPQETYD VYCYVDHLDG
260 270 280 290 300
DVFHLTVPSK FTFEEAAKEC ENQDARLATV GELQAAWRNG FDQCDYGWLS
310 320 330 340 350
DASVRHPVTV ARAQCGGGLL GVRTLYRFEN QTGFPPPDSR FDAYCFKPKE
360 370 380 390 400
ATTIDLSILA ETASPSLSKE PQMVSDRTTP IIPLVDELPV IPTEFPPVGN
410 420 430 440 450
IVSFEQKATV QPQAITDSLA TKLPTPTGST KKPWDMDDYS PSASGPLGKL
460 470 480 490 500
DISEIKEEVL QSTTGVSHYA TDSWDGVVED KQTQESVTQI EQIEVGPLVT
510 520 530 540 550
SMEILKHIPS KEFPVTETPL VTARMILESK TEKKMVSTVS ELVTTGHYGF
560 570 580 590 600
TLGEEDDEDR TLTVGSDEST LIFDQIPEVI TVSKTSEDTI HTHLEDLESV
610 620 630 640 650
SASTTVSPLI MPDNNGSSMD DWEERQTSGR ITEEFLGKYL STTPFPSQHR
660 670 680 690 700
TEIELFPYSG DKILVEGIST VIYPSLQTEM THRRERTETL IPEMRTDTYT
710 720 730 740 750
DEIQEEITKS PFMGKTEEEV FSGMKLSTSL SEPIHVTESS VEMTKSFDFP
760 770 780 790 800
TLITKLSAEP TEVRDMEEDF TATPGTTKYD ENITTVLLAH GTLSVEAATV
810 820 830 840 850
SKWSWDEDNT TSKPLESTEP SASSKLPPAL LTTVGMNGKD KDIPSFTEDG
860 870 880 890 900
ADEFTLIPDS TQKQLEEVTD EDIAAHGKFT IRFQPTTSTG IAEKSTLRDS
910 920 930 940 950
TTEEKVPPIT STEGQVYATM EGSALGEVED VDLSKPVSTV PQFAHTSEVE
960 970 980 990 1000
GLAFVSYSST QEPTTYVDSS HTIPLSVIPK TDWGVLVPSV PSEDEVLGEP
1010 1020 1030 1040 1050
SQDILVIDQT RLEATISPET MRTTKITEGT TQEEFPWKEQ TAEKPVPALS
1060 1070 1080 1090 1100
STAWTPKEAV TPLDEQEGDG SAYTVSEDEL LTGSERVPVL ETTPVGKIDH
1110 1120 1130 1140 1150
SVSYPPGAVT EHKVKTDEVV TLTPRIGPKV SLSPGPEQKY ETEGSSTTGF
1160 1170 1180 1190 1200
TSSLSPFSTH ITQLMEETTT EKTSLEDIDL GSGLFEKPKA TELIEFSTIK
1210 1220 1230 1240 1250
VTVPSDITTA FSSVDRLHTT SAFKPSSAIT KKPPLIDREP GEETTSDMVI
1260 1270 1280 1290 1300
IGESTSHVPP TTLEDIVAKE TETDIDREYF TTSSPPATQP TRPPTVEDKE
1310 1320 1330 1340 1350
AFGPQALSTP QPPASTKFHP DINVYIIEVR ENKTGRMSDL SVIGHPIDSE
1360 1370 1380 1390 1400
SKEDEPCSEE TDPVHDLMAE ILPEFPDIIE IDLYHSEENE EEEEECANAT
1410 1420 1430 1440 1450
DVTTTPSVQY INGKHLVTTV PKDPEAAEAR RGQFESVAPS QNFSDSSESD
1460 1470 1480 1490 1500
THPFVIAKTE LSTAVQPNES TETTESLEVT WKPETYPETS EHFSGGEPDV
1510 1520 1530 1540 1550
FPTVPFHEEF ESGTAKKGAE SVTERDTEVG HQAHEHTEPV SLFPEESSGE
1560 1570 1580 1590 1600
IAIDQESQKI AFARATEVTF GEEVEKSTSV TYTPTIVPSS ASAYVSEEEA
1610 1620 1630 1640 1650
VTLIGNPWPD DLLSTKESWV EATPRQVVEL SGSSSIPITE GSGEAEEDED
1660 1670 1680 1690 1700
TMFTMVTDLS QRNTTDTLIT LDTSRIITES FFEVPATTIY PVSEQPSAKV
1710 1720 1730 1740 1750
VPTKFVSETD TSEWISSTTV EEKKRKEEEG TTGTASTFEV YSSTQRSDQL
1760 1770 1780 1790 1800
ILPFELESPN VATSSDSGTR KSFMSLTTPT QSEREMTDST PVFTETNTLE
1810 1820 1830 1840 1850
NLGAQTTEHS SIHQPGVQEG LTTLPRSPAS VFMEQGSGEA AADPETTTVS
1860 1870 1880 1890 1900
SFSLNVEYAI QAEKEVAGTL SPHVETTFST EPTGLVLSTV MDRVVAENIT
1910 1920 1930 1940 1950
QTSREIVISE RLGEPNYGAE IRGFSTGFPL EEDFSGDFRE YSTVSHPIAK
1960 1970 1980 1990 2000
EETVMMEGSG DAAFRDTQTS PSTVPTSVHI SHISDSEGPS STMVSTSAFP
2010 2020 2030 2040 2050
WEEFTSSAEG SGEQLVTVSS SVVPVLPSAV QKFSGTASSI IDEGLGEVGT
2060 2070 2080 2090 2100
VNEIDRRSTI LPTAEVEGTK APVEKEEVKV SGTVSTNFPQ TIEPAKLWSR
2110 2120 2130 2140 2150
QEVNPVRQEI ESETTSEEQI QEEKSFESPQ NSPATEQTIF DSQTFTETEL
2160 2170 2180 2190 2200
KTTDYSVLTT KKTYSDDKEM KEEDTSLVNM STPDPDANGL ESYTTLPEAT
2210 2220 2230 2240 2250
EKSHFFLATA LVTESIPAEH VVTDSPIKKE ESTKHFPKGM RPTIQESDTE
2260 2270 2280 2290 2300
LLFSGLGSGE EVLPTLPTES VNFTEVEQIN NTLYPHTSQV ESTSSDKIED
2310 2320 2330 2340 2350
FNRMENVAKE VGPLVSQTDI FEGSGSVTST TLIEILSDTG AEGPTVAPLP
2360 2370 2380 2390 2400
FSTDIGHPQN QTVRWAEEIQ TSRPQTITEQ DSNKNSSTAE INETTTSSTD
2410 2420 2430 2440 2450
FLARAYGFEM AKEFVTSAPK PSDLYYEPSG EGSGEVDIVD SFHTSATTQA
2460 2470 2480 2490 2500
TRQESSTTFV SDGSLEKHPE VPSAKAVTAD GFPTVSVMLP LHSEQNKSSP
2510 2520 2530 2540 2550
DPTSTLSNTV SYERSTDGSF QDRFREFEDS TLKPNRKKPT ENIIIDLDKE
2560 2570 2580 2590 2600
DKDLILTITE STILEILPEL TSDKNTIIDI DHTKPVYEDI LGMQTDIDTE
2610 2620 2630 2640 2650
VPSEPHDSND ESNDDSTQVQ EIYEAAVNLS LTEETFEGSA DVLASYTQAT
2660 2670 2680 2690 2700
HDESMTYEDR SQLDHMGFHF TTGIPAPSTE TELDVLLPTA TSLPIPRKSA
2710 2720 2730 2740 2750
TVIPEIEGIK AEAKALDDMF ESSTLSDGQA IADQSEIIPT LGQFERTQEE
2760 2770 2780 2790 2800
YEDKKHAGPS FQPEFSSGAE EALVDHTPYL SIATTHLMDQ SVTEVPDVME
2810 2820 2830 2840 2850
GSNPPYYTDT TLAVSTFAKL SSQTPSSPLT IYSGSEASGH TEIPQPSALP
2860 2870 2880 2890 2900
GIDVGSSVMS PQDSFKEIHV NIEATFKPSS EEYLHITEPP SLSPDTKLEP
2910 2920 2930 2940 2950
SEDDGKPELL EEMEASPTEL IAVEGTEILQ DFQNKTDGQV SGEAIKMFPT
2960 2970 2980 2990 3000
IKTPEAGTVI TTADEIELEG ATQWPHSTSA SATYGVEAGV VPWLSPQTSE
3010 3020 3030 3040 3050
RPTLSSSPEI NPETQAALIR GQDSTIAASE QQVAARILDS NDQATVNPVE
3060 3070 3080 3090 3100
FNTEVATPPF SLLETSNETD FLIGINEESV EGTAIYLPGP DRCKMNPCLN
3110 3120 3130 3140 3150
GGTCYPTETS YVCTCVPGYS GDQCELDFDE CHSNPCRNGA TCVDGFNTFR
3160 3170 3180 3190 3200
CLCLPSYVGA LCEQDTETCD YGWHKFQGQC YKYFAHRRTW DAAERECRLQ
3210 3220 3230 3240 3250
GAHLTSILSH EEQMFVNRVG HDYQWIGLND KMFEHDFRWT DGSTLQYENW
3260 3270 3280 3290 3300
RPNQPDSFFS AGEDCVVIIW HENGQWNDVP CNYHLTYTCK KGTVACGQPP
3310 3320 3330 3340 3350
VVENAKTFGK MKPRYEINSL IRYHCKDGFI QRHLPTIRCL GNGRWAIPKI
3360 3370 3380 3390
TCMNPSAYQR TYSMKYFKNS SSAKDNSINT SKHDHRWSRR WQESRR
Length:3,396
Mass (Da):372,820
Last modified:November 1, 1997 - v3
Checksum:iD174A1BBB8304FEC
GO
Isoform V1 (identifier: P13611-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     348-348: P → R
     349-1335: Missing.

Show »
Length:2,409
Mass (Da):265,050
Checksum:i4D290F9BF5A3F704
GO
Isoform V2 (identifier: P13611-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1336-3089: Missing.

Show »
Length:1,642
Mass (Da):182,062
Checksum:i25C238F0C5E94DBE
GO
Isoform V3 (identifier: P13611-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     348-348: P → R
     349-3089: Missing.

Show »
Length:655
Mass (Da):74,293
Checksum:i4933DFA2E0D7A0AD
GO
Isoform Vint (identifier: P13611-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     3355-3396: PSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR → RKWSFRKNGLPCYNNY

Show »
Length:3,370
Mass (Da):369,688
Checksum:iE76563A26BDA34C6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti88 – 881N → D AA sequence (PubMed:2466833)Curated
Sequence conflicti260 – 2601K → I AA sequence (PubMed:2466833)Curated
Sequence conflicti274 – 2741D → A in BAA06801. (PubMed:7876137)Curated
Sequence conflicti284 – 2841Q → G AA sequence (PubMed:2466833)Curated
Sequence conflicti2709 – 27135IKAEA → EFREV in AAA36437. (PubMed:2820964)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti300 – 3001S → L.
Corresponds to variant rs2652098 [ dbSNP | Ensembl ].
VAR_021958
Natural varianti428 – 4281G → D.
Corresponds to variant rs2287926 [ dbSNP | Ensembl ].
VAR_020214
Natural varianti1516 – 15161K → R.
Corresponds to variant rs309559 [ dbSNP | Ensembl ].
VAR_021959
Natural varianti1826 – 18261R → H.
Corresponds to variant rs188703 [ dbSNP | Ensembl ].
VAR_031632
Natural varianti2301 – 23011F → Y.
Corresponds to variant rs160278 [ dbSNP | Ensembl ].
VAR_020215
Natural varianti2315 – 23151V → L.
Corresponds to variant rs3734094 [ dbSNP | Ensembl ].
VAR_020216
Natural varianti2937 – 29371D → Y.
Corresponds to variant rs160277 [ dbSNP | Ensembl ].
VAR_021960
Natural varianti3011 – 30111N → K.
Corresponds to variant rs16900532 [ dbSNP | Ensembl ].
VAR_031633

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei348 – 3481P → R in isoform V1 and isoform V3. 3 PublicationsVSP_003082
Alternative sequencei349 – 30892741Missing in isoform V3. 1 PublicationVSP_003085Add
BLAST
Alternative sequencei349 – 1335987Missing in isoform V1. 2 PublicationsVSP_003083Add
BLAST
Alternative sequencei1336 – 30891754Missing in isoform V2. 1 PublicationVSP_003084Add
BLAST
Alternative sequencei3355 – 339642PSAYQ…QESRR → RKWSFRKNGLPCYNNY in isoform Vint. 1 PublicationVSP_003086Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X15998 mRNA. Translation: CAA34128.1.
U16306 mRNA. Translation: AAA65018.1.
U26555 mRNA. Translation: AAA67565.1.
D32039 mRNA. Translation: BAA06801.1.
S52488 Genomic DNA. Translation: AAB24878.1.
J02814 mRNA. Translation: AAA36437.1.
AF084545 mRNA. Translation: AAD48545.1.
CCDSiCCDS4060.1. [P13611-1]
CCDS47242.1. [P13611-4]
CCDS54875.1. [P13611-3]
CCDS54876.1. [P13611-2]
PIRiS06014. A60979.
RefSeqiNP_001119808.1. NM_001126336.2. [P13611-4]
NP_001157569.1. NM_001164097.1. [P13611-2]
NP_001157570.1. NM_001164098.1. [P13611-3]
NP_004376.2. NM_004385.4. [P13611-1]
UniGeneiHs.643801.

Genome annotation databases

EnsembliENST00000265077; ENSP00000265077; ENSG00000038427. [P13611-1]
ENST00000342785; ENSP00000342768; ENSG00000038427. [P13611-3]
ENST00000343200; ENSP00000340062; ENSG00000038427. [P13611-2]
ENST00000502527; ENSP00000421362; ENSG00000038427. [P13611-4]
GeneIDi1462.
KEGGihsa:1462.
UCSCiuc003kii.3. human. [P13611-1]
uc003kij.3. human. [P13611-2]
uc003kik.3. human. [P13611-4]
uc010jau.2. human. [P13611-3]

Polymorphism databases

DMDMi2506816.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Versican

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X15998 mRNA. Translation: CAA34128.1 .
U16306 mRNA. Translation: AAA65018.1 .
U26555 mRNA. Translation: AAA67565.1 .
D32039 mRNA. Translation: BAA06801.1 .
S52488 Genomic DNA. Translation: AAB24878.1 .
J02814 mRNA. Translation: AAA36437.1 .
AF084545 mRNA. Translation: AAD48545.1 .
CCDSi CCDS4060.1. [P13611-1 ]
CCDS47242.1. [P13611-4 ]
CCDS54875.1. [P13611-3 ]
CCDS54876.1. [P13611-2 ]
PIRi S06014. A60979.
RefSeqi NP_001119808.1. NM_001126336.2. [P13611-4 ]
NP_001157569.1. NM_001164097.1. [P13611-2 ]
NP_001157570.1. NM_001164098.1. [P13611-3 ]
NP_004376.2. NM_004385.4. [P13611-1 ]
UniGenei Hs.643801.

3D structure databases

ProteinModelPortali P13611.
SMRi P13611. Positions 23-136, 151-247, 260-348, 3047-3292.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107844. 18 interactions.
IntActi P13611. 5 interactions.
MINTi MINT-4529155.
STRINGi 9606.ENSP00000265077.

Chemistry

DrugBanki DB08818. Hyaluronan.

PTM databases

PhosphoSitei P13611.

Polymorphism databases

DMDMi 2506816.

Proteomic databases

MaxQBi P13611.
PaxDbi P13611.
PRIDEi P13611.

Protocols and materials databases

DNASUi 1462.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000265077 ; ENSP00000265077 ; ENSG00000038427 . [P13611-1 ]
ENST00000342785 ; ENSP00000342768 ; ENSG00000038427 . [P13611-3 ]
ENST00000343200 ; ENSP00000340062 ; ENSG00000038427 . [P13611-2 ]
ENST00000502527 ; ENSP00000421362 ; ENSG00000038427 . [P13611-4 ]
GeneIDi 1462.
KEGGi hsa:1462.
UCSCi uc003kii.3. human. [P13611-1 ]
uc003kij.3. human. [P13611-2 ]
uc003kik.3. human. [P13611-4 ]
uc010jau.2. human. [P13611-3 ]

Organism-specific databases

CTDi 1462.
GeneCardsi GC05P082804.
GeneReviewsi VCAN.
HGNCi HGNC:2464. VCAN.
HPAi CAB008979.
HPA004726.
MIMi 118661. gene.
143200. phenotype.
neXtProti NX_P13611.
Orphaneti 898. Wagner disease.
PharmGKBi PA162408788.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG12793.
GeneTreei ENSGT00760000119025.
HOVERGENi HBG051140.
InParanoidi P13611.
KOi K06793.
OMAi TQEEFPW.
OrthoDBi EOG7J70DP.
PhylomeDBi P13611.
TreeFami TF332134.

Enzyme and pathway databases

Reactomei REACT_120800. Dermatan sulfate biosynthesis.
REACT_120888. CS/DS degradation.
REACT_120989. Chondroitin sulfate biosynthesis.
REACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.
REACT_163906. ECM proteoglycans.

Miscellaneous databases

ChiTaRSi VCAN. human.
GeneWikii Versican.
GenomeRNAii 1462.
NextBioi 6005.
PMAP-CutDB P13611.
PROi P13611.
SOURCEi Search...

Gene expression databases

Bgeei P13611.
CleanExi HS_VCAN.
ExpressionAtlasi P13611. baseline and differential.
Genevestigatori P13611.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
3.10.100.10. 3 hits.
InterProi IPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR018378. C-type_lectin_CS.
IPR016187. C-type_lectin_fold.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR000538. Link.
IPR000436. Sushi_SCR_CCP.
[Graphical view ]
Pfami PF00008. EGF. 2 hits.
PF00059. Lectin_C. 1 hit.
PF00084. Sushi. 1 hit.
PF07686. V-set. 1 hit.
PF00193. Xlink. 2 hits.
[Graphical view ]
PRINTSi PR01265. LINKMODULE.
SMARTi SM00032. CCP. 1 hit.
SM00034. CLECT. 1 hit.
SM00181. EGF. 1 hit.
SM00179. EGF_CA. 1 hit.
SM00409. IG. 1 hit.
SM00445. LINK. 2 hits.
[Graphical view ]
SUPFAMi SSF56436. SSF56436. 3 hits.
SSF57535. SSF57535. 1 hit.
PROSITEi PS00010. ASX_HYDROXYL. 1 hit.
PS00615. C_TYPE_LECTIN_1. 1 hit.
PS50041. C_TYPE_LECTIN_2. 1 hit.
PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 2 hits.
PS01187. EGF_CA. 1 hit.
PS50835. IG_LIKE. 1 hit.
PS01241. LINK_1. 2 hits.
PS50963. LINK_2. 2 hits.
PS50923. SUSHI. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Multiple domains of the large fibroblast proteoglycan, versican."
    Zimmermann D.R., Ruoslahti E.
    EMBO J. 8:2975-2981(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V1).
    Tissue: Placenta.
  2. "A novel glycosaminoglycan attachment domain identified in two alternative splice variants of human versican."
    Dours-Zimmermann M.T., Zimmermann D.R.
    J. Biol. Chem. 269:32992-32998(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V2).
    Tissue: Glial tumor.
  3. "Characterization of the complete genomic structure of the human versican gene and functional analysis of its promoter."
    Naso M.F., Zimmermann D.R., Iozzo R.V.
    J. Biol. Chem. 269:32999-33008(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM V0).
  4. "Expression of PG-M(V3), an alternatively spliced form of PG-M without a chondroitin sulfate attachment in region in mouse and human tissues."
    Zako M., Shinomura T., Ujita M., Ito K., Kimata K.
    J. Biol. Chem. 270:3914-3918(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V3).
    Tissue: Brain.
  5. "Identification of the proteoglycan versican in aorta and smooth muscle cells by DNA sequence analysis, in situ hybridization and immunohistochemistry."
    Yao L.Y., Moody C., Schoenherr E., Wight T.N., Sandell L.J.
    Matrix Biol. 14:213-225(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 208-1427; 2081-2372 AND 2897-3233 (ISOFORM V1).
  6. "Mapping of the versican proteoglycan gene (CSPG2) to the long arm of human chromosome 5 (5q12-5q14)."
    Iozzo R.V., Naso M.F., Cannizzaro L.A., Wasmuth J.J., McPherson J.D.
    Genomics 14:845-851(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 251-347.
  7. "A fibroblast chondroitin sulfate proteoglycan core protein contains lectin-like and growth factor-like sequences."
    Krusius T., Gehlsen K.R., Ruoslahti E.
    J. Biol. Chem. 262:13120-13125(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2709-3396.
    Tissue: Lung fibroblast.
  8. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3333-3396 (ISOFORM VINT).
    Tissue: Aortic smooth muscle.
  9. "Isolation of a large aggregating proteoglycan from human brain."
    Perides G., Rahemtulla F., Lane W.S., Asher R.A., Bignami A.
    J. Biol. Chem. 267:23883-23887(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 21-37.
  10. "Isolation and partial characterization of a glial hyaluronate-binding protein."
    Perides G., Lane W.S., Andrews D., Dahl D., Bignami A.
    J. Biol. Chem. 264:5981-5987(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 24-50; 80-119; 128-155; 167-218; 229-268 AND 277-290.
    Tissue: Brain.
  11. "Structural similarity of hyaluronate binding proteins in brain and cartilage."
    Bignami A., Lane W.S., Andrews D., Dahl D.
    Brain Res. Bull. 22:67-70(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 171-210 AND 289-303.
  12. "Differential expression of versican isoforms in brain tumors."
    Paulus W., Baur I., Dours-Zimmermann M.T., Zimmermann D.R.
    J. Neuropathol. Exp. Neurol. 55:528-533(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY (ISOFORMS V0; V1; V2 AND V3).
  13. "Identification of a novel splice site mutation of the CSPG2 gene in a Japanese family with Wagner syndrome."
    Miyamoto T., Inoue H., Sakamoto Y., Kudo E., Naito T., Mikawa T., Mikawa Y., Isashiki Y., Osabe D., Shinohara S., Shiota H., Itakura M.
    Invest. Ophthalmol. Vis. Sci. 46:2726-2735(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN WGVRP.
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "Novel VCAN mutations and evidence for unbalanced alternative splicing in the pathogenesis of Wagner syndrome."
    Kloeckener-Gruissem B., Neidhardt J., Magyar I., Plauchu H., Zech J.C., Morle L., Palmer-Smith S.M., Macdonald M.J., Nas V., Fry A.E., Berger W.
    Eur. J. Hum. Genet. 21:352-356(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN WGVRP, PATHOLOGICAL MECHANISM.

Entry informationi

Entry nameiCSPG2_HUMAN
AccessioniPrimary (citable) accession number: P13611
Secondary accession number(s): P20754
, Q13010, Q13189, Q15123, Q9UCL9, Q9UNW5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: November 1, 1997
Last modified: October 29, 2014
This is version 178 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3