P13611 (CSPG2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 149.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Versican core protein Alternative name(s): Chondroitin sulfate proteoglycan core protein 2 Short name=Chondroitin sulfate proteoglycan 2 Glial hyaluronate-binding protein Short name=GHAP Large fibroblast proteoglycan PG-M | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 3396 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid. |
| Subunit structure | Interacts with FBLN1 By similarity. |
| Subcellular location | |
| Tissue specificity | Cerebral white matter and plasma. Isoform V0 and isoform V1 are expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V2 is restricted to normal brain and gliomas. Isoform V3 is found in all these tissues except medulloblastomas. Ref.12 Ref.14 |
| Developmental stage | Disappears after the cartilage development. |
| Post-translational modification | Phosphorylation sites are present in the extracelllular medium. |
| Involvement in disease | Defects in VCAN are the cause of Wagner syndrome type 1 (WGN1) [MIM:143200]. WGN is a dominantly inherited vitreoretinopathy characterized by an optically empty vitreous cavity with fibrillary condensations and a preretinal avascular membrane. Other optical features include progressive chorioretinal atrophy, perivascular sheating, subcapsular cataract and myopia. Systemic manifestations are absent in WGN. Ref.13 |
| Sequence similarities | Belongs to the aggrecan/versican proteoglycan family. Contains 1 C-type lectin domain. Contains 2 EGF-like domains. Contains 1 Ig-like V-type (immunoglobulin-like) domain. Contains 2 Link domains. Contains 1 Sushi (CCP/SCR) domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Extracellular matrix Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Cataract |
| Domain | EGF-like domain Immunoglobulin domain Repeat Signal Sushi |
| Ligand | Calcium Hyaluronic acid Lectin |
| PTM | Disulfide bond Glycoprotein Phosphoprotein Proteoglycan |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell adhesion Traceable author statement. Source: ProtInc cell recognitionTraceable author statement. Source: ProtInc glial cell migrationInferred from direct assay. Source: BHF-UCL |
| Cellular component | extracellular space Inferred from direct assay. Source: BHF-UCL proteinaceous extracellular matrixTraceable author statement. Source: ProtInc |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: InterPro hyaluronic acid bindingTraceable author statement. Source: ProtInc sugar bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform V0 (identifier: P13611-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform V1 (identifier: P13611-2) The sequence of this isoform differs from the canonical sequence as follows: 348-348: P → R 349-1335: Missing. | ||||||
| Isoform V2 (identifier: P13611-3) The sequence of this isoform differs from the canonical sequence as follows: 1336-3089: Missing. | ||||||
| Isoform V3 (identifier: P13611-4) The sequence of this isoform differs from the canonical sequence as follows: 348-348: P → R 349-3089: Missing. | ||||||
| Isoform Vint (identifier: P13611-5) The sequence of this isoform differs from the canonical sequence as follows: 3355-3396: PSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR → RKWSFRKNGLPCYNNY |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 20 | 20 | Ref.9 | ||||||||
| Chain | 21 – 3396 | 3376 | Versican core protein | PRO_0000017522 | |||||||
Regions | |||||||||||
| Domain | 21 – 146 | 126 | Ig-like V-type | ||||||||
| Domain | 150 – 245 | 96 | Link 1 | ||||||||
| Domain | 251 – 347 | 97 | Link 2 | ||||||||
| Domain | 3089 – 3125 | 37 | EGF-like 1 | ||||||||
| Domain | 3127 – 3163 | 37 | EGF-like 2; calcium-binding Potential | ||||||||
| Domain | 3176 – 3290 | 115 | C-type lectin | ||||||||
| Domain | 3294 – 3354 | 61 | Sushi | ||||||||
| Region | 348 – 1335 | 988 | GAG-alpha (glucosaminoglycan attachment domain) | ||||||||
| Region | 1336 – 3089 | 1754 | GAG-beta | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 2112 | 1 | Phosphoserine Ref.14 | ||||||||
| Modified residue | 2116 | 1 | Phosphoserine Ref.14 | ||||||||
| Glycosylation | 57 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 330 | 1 | N-linked (GlcNAc...) | ||||||||
| Glycosylation | 615 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 782 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 809 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1332 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1398 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1442 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1468 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1663 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1898 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2179 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2272 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2280 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2360 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2385 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2392 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2496 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2628 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 2934 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 3067 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 3369 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 3379 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 44 ↔ 130 | By similarity | |||||||||
| Disulfide bond | 172 ↔ 243 | By similarity | |||||||||
| Disulfide bond | 196 ↔ 217 | By similarity | |||||||||
| Disulfide bond | 270 ↔ 345 | By similarity | |||||||||
| Disulfide bond | 294 ↔ 315 | By similarity | |||||||||
| Disulfide bond | 3093 ↔ 3104 | By similarity | |||||||||
| Disulfide bond | 3098 ↔ 3113 | By similarity | |||||||||
| Disulfide bond | 3115 ↔ 3124 | By similarity | |||||||||
| Disulfide bond | 3131 ↔ 3142 | By similarity | |||||||||
| Disulfide bond | 3136 ↔ 3151 | By similarity | |||||||||
| Disulfide bond | 3153 ↔ 3162 | By similarity | |||||||||
| Disulfide bond | 3169 ↔ 3180 | By similarity | |||||||||
| Disulfide bond | 3197 ↔ 3289 | By similarity | |||||||||
| Disulfide bond | 3265 ↔ 3281 | By similarity | |||||||||
| Disulfide bond | 3296 ↔ 3339 | By similarity | |||||||||
| Disulfide bond | 3325 ↔ 3352 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 348 | 1 | P → R in isoform V1 and isoform V3. | VSP_003082 | |||||||
| Alternative sequence | 349 – 3089 | 2741 | Missing in isoform V3. | VSP_003085 | |||||||
| Alternative sequence | 349 – 1335 | 987 | Missing in isoform V1. | VSP_003083 | |||||||
| Alternative sequence | 1336 – 3089 | 1754 | Missing in isoform V2. | VSP_003084 | |||||||
| Alternative sequence | 3355 – 3396 | 42 | PSAYQ…QESRR → RKWSFRKNGLPCYNNY in isoform Vint. | VSP_003086 | |||||||
| Natural variant | 300 | 1 | S → L. Corresponds to variant rs2652098 [ dbSNP | Ensembl ]. | VAR_021958 | |||||||
| Natural variant | 428 | 1 | G → D. Corresponds to variant rs2287926 [ dbSNP | Ensembl ]. | VAR_020214 | |||||||
| Natural variant | 1516 | 1 | K → R. Corresponds to variant rs309559 [ dbSNP | Ensembl ]. | VAR_021959 | |||||||
| Natural variant | 1826 | 1 | R → H. Corresponds to variant rs188703 [ dbSNP | Ensembl ]. | VAR_031632 | |||||||
| Natural variant | 2301 | 1 | F → Y. Corresponds to variant rs160278 [ dbSNP | Ensembl ]. | VAR_020215 | |||||||
| Natural variant | 2315 | 1 | V → L. Corresponds to variant rs3734094 [ dbSNP | Ensembl ]. | VAR_020216 | |||||||
| Natural variant | 2937 | 1 | D → Y. Corresponds to variant rs160277 [ dbSNP | Ensembl ]. | VAR_021960 | |||||||
| Natural variant | 3011 | 1 | N → K. Corresponds to variant rs16900532 [ dbSNP | Ensembl ]. | VAR_031633 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 88 | 1 | N → D AA sequence Ref.10 | ||||||||
| Sequence conflict | 260 | 1 | K → I AA sequence Ref.10 | ||||||||
| Sequence conflict | 274 | 1 | D → A in BAA06801. Ref.4 | ||||||||
| Sequence conflict | 284 | 1 | Q → G AA sequence Ref.10 | ||||||||
| Sequence conflict | 2709 – 2713 | 5 | IKAEA → EFREV in AAA36437. Ref.7 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Multiple domains of the large fibroblast proteoglycan, versican." Zimmermann D.R., Ruoslahti E. EMBO J. 8:2975-2981(1989) [PubMed: 2583089] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V1). Tissue: Placenta. |
| [2] | "A novel glycosaminoglycan attachment domain identified in two alternative splice variants of human versican." Dours-Zimmermann M.T., Zimmermann D.R. J. Biol. Chem. 269:32992-32998(1994) [PubMed: 7806529] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V2). Tissue: Glial tumor. |
| [3] | "Characterization of the complete genomic structure of the human versican gene and functional analysis of its promoter." Naso M.F., Zimmermann D.R., Iozzo R.V. J. Biol. Chem. 269:32999-33008(1994) [PubMed: 7528742] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM V0). |
| [4] | "Expression of PG-M(V3), an alternatively spliced form of PG-M without a chondroitin sulfate attachment in region in mouse and human tissues." Zako M., Shinomura T., Ujita M., Ito K., Kimata K. J. Biol. Chem. 270:3914-3918(1995) [PubMed: 7876137] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V3). Tissue: Brain. |
| [5] | "Identification of the proteoglycan versican in aorta and smooth muscle cells by DNA sequence analysis, in situ hybridization and immunohistochemistry." Yao L.Y., Moody C., Schoenherr E., Wight T.N., Sandell L.J. Matrix Biol. 14:213-225(1994) [PubMed: 7921538] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 208-1427; 2081-2372 AND 2897-3233 (ISOFORM V1). |
| [6] | "Mapping of the versican proteoglycan gene (CSPG2) to the long arm of human chromosome 5 (5q12-5q14)." Iozzo R.V., Naso M.F., Cannizzaro L.A., Wasmuth J.J., McPherson J.D. Genomics 14:845-851(1992) [PubMed: 1478664] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 251-347. |
| [7] | "A fibroblast chondroitin sulfate proteoglycan core protein contains lectin-like and growth factor-like sequences." Krusius T., Gehlsen K.R., Ruoslahti E. J. Biol. Chem. 262:13120-13125(1987) [PubMed: 2820964] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2709-3396. Tissue: Lung fibroblast. |
| [8] | "Versican/PG-M isoforms in vascular smooth muscle cells." Lemire J.M., Braun K.R., Maurel P., Kaplan E.D., Schwartz S.M., Wight T.N. Arterioscler. Thromb. Vasc. Biol. 19:1630-1639(1999) [PubMed: 10397680] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3333-3396 (ISOFORM VINT). Tissue: Aortic smooth muscle. |
| [9] | "Isolation of a large aggregating proteoglycan from human brain." Perides G., Rahemtulla F., Lane W.S., Asher R.A., Bignami A. J. Biol. Chem. 267:23883-23887(1992) [PubMed: 1429726] [Abstract] Cited for: PROTEIN SEQUENCE OF 21-37. |
| [10] | "Isolation and partial characterization of a glial hyaluronate-binding protein." Perides G., Lane W.S., Andrews D., Dahl D., Bignami A. J. Biol. Chem. 264:5981-5987(1989) [PubMed: 2466833] [Abstract] Cited for: PROTEIN SEQUENCE OF 24-50; 80-119; 128-155; 167-218; 229-268 AND 277-290. Tissue: Brain. |
| [11] | "Structural similarity of hyaluronate binding proteins in brain and cartilage." Bignami A., Lane W.S., Andrews D., Dahl D. Brain Res. Bull. 22:67-70(1989) [PubMed: 2469524] [Abstract] Cited for: PROTEIN SEQUENCE OF 171-210 AND 289-303. |
| [12] | "Differential expression of versican isoforms in brain tumors." Paulus W., Baur I., Dours-Zimmermann M.T., Zimmermann D.R. J. Neuropathol. Exp. Neurol. 55:528-533(1996) [PubMed: 8627343] [Abstract] Cited for: TISSUE SPECIFICITY (ISOFORMS V0; V1; V2 AND V3). |
| [13] | "Identification of a novel splice site mutation of the CSPG2 gene in a Japanese family with Wagner syndrome." Miyamoto T., Inoue H., Sakamoto Y., Kudo E., Naito T., Mikawa T., Mikawa Y., Isashiki Y., Osabe D., Shinohara S., Shiota H., Itakura M. Invest. Ophthalmol. Vis. Sci. 46:2726-2735(2005) [PubMed: 16043844] [Abstract] Cited for: INVOLVEMENT IN WGN1. |
| [14] | "An initial characterization of the serum phosphoproteome." Zhou W., Ross M.M., Tessitore A., Ornstein D., Vanmeter A., Liotta L.A., Petricoin E.F. III J. Proteome Res. 8:5523-5531(2009) [PubMed: 19824718] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2112 AND SER-2116, TISSUE SPECIFICITY, MASS SPECTROMETRY. Tissue: Serum. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X15998 mRNA. Translation: CAA34128.1. U16306 mRNA. Translation: AAA65018.1. U26555 mRNA. Translation: AAA67565.1. D32039 mRNA. Translation: BAA06801.1. S52488 Genomic DNA. Translation: AAB24878.1. J02814 mRNA. Translation: AAA36437.1. AF084545 mRNA. Translation: AAD48545.1. |
| IPI | IPI00009802. IPI00215628. IPI00215629. IPI00215630. IPI00215631. |
| PIR | A60979. S06014. |
| RefSeq | NP_001119808.1. NM_001126336.2. NP_001157569.1. NM_001164097.1. NP_001157570.1. NM_001164098.1. NP_004376.2. NM_004385.4. |
| UniGene | Hs.643801. Hs.715773. |
3D structure databases | |
| ProteinModelPortal | P13611. |
| SMR | P13611. Positions 30-148, 151-248, 252-349, 3091-3356. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-4529155. |
| STRING | P13611. |
PTM databases | |
| PhosphoSite | P13611. |
Polymorphism databases | |
| DMDM | 2506816. |
Proteomic databases | |
| PRIDE | P13611. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000265077; ENSP00000265077; ENSG00000038427. |
| GeneID | 1462. |
| KEGG | hsa:1462. |
| UCSC | uc003kii.2. human. uc003kij.2. human. uc003kik.2. human. uc010jau.1. human. |
Organism-specific databases | |
| CTD | 1462. |
| GeneCards | GC05P082804. |
| H-InvDB | HIX0024794. |
| HGNC | HGNC:2464. VCAN. |
| HPA | CAB008979. HPA004726. |
| MIM | 118661. gene. 143200. phenotype. |
| neXtProt | NX_P13611. |
| Orphanet | 898. Wagner disease. |
| PharmGKB | PA162408788. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG04802. |
| HOVERGEN | HBG051140. |
| InParanoid | P13611. |
| OMA | ENKTGRM. |
| OrthoDB | EOG4G4GPG. |
| PhylomeDB | P13611. |
Gene expression databases | |
| ArrayExpress | P13611. |
| Bgee | P13611. |
| CleanEx | HS_VCAN. |
| Genevestigator | P13611. |
| GermOnline | ENSG00000038427. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001304. C-type_lectin. IPR016186. C-type_lectin-like. IPR018378. C-type_lectin_CS. IPR016187. C-type_lectin_fold. IPR016060. Complement_control_module. IPR006209. EGF. IPR006210. EGF-like. IPR001881. EGF-like_Ca-bd. IPR013032. EGF-like_reg_CS. IPR000152. EGF-type_Asp/Asn_hydroxyl_site. IPR000742. EGF_3. IPR018097. EGF_Ca-bd_CS. IPR007110. Ig-like. IPR013783. Ig-like_fold. IPR003599. Ig_sub. IPR013106. Ig_V-set. IPR000538. Link. IPR000436. Sushi_SCR_CCP. [Graphical view] |
| Gene3D | G3DSA:3.10.100.10. C-type_lectin-like. 3 hits. G3DSA:2.10.70.10. Complement_control_module. 1 hit. G3DSA:2.60.40.10. Ig-like_fold. 1 hit. |
| KO | K06793. |
| Pfam | PF00008. EGF. 2 hits. PF00059. Lectin_C. 1 hit. PF00084. Sushi. 1 hit. PF07686. V-set. 1 hit. PF00193. Xlink. 2 hits. [Graphical view] |
| PRINTS | PR01265. LINKMODULE. |
| SMART | SM00032. CCP. 1 hit. SM00034. CLECT. 1 hit. SM00181. EGF. 1 hit. SM00179. EGF_CA. 1 hit. SM00409. IG. 1 hit. SM00445. LINK. 2 hits. [Graphical view] |
| SUPFAM | SSF56436. C-type_lectin_fold. 3 hits. SSF57535. Complement_control_module. 1 hit. |
| PROSITE | PS00010. ASX_HYDROXYL. 1 hit. PS00615. C_TYPE_LECTIN_1. 1 hit. PS50041. C_TYPE_LECTIN_2. 1 hit. PS00022. EGF_1. 2 hits. PS01186. EGF_2. 1 hit. PS50026. EGF_3. 2 hits. PS01187. EGF_CA. 1 hit. PS50835. IG_LIKE. 1 hit. PS01241. LINK_1. 2 hits. PS50963. LINK_2. 2 hits. PS50923. SUSHI. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 6005. |
| PMAP-CutDB | P13611. |
| SOURCE | Search... |
Entry information
| Entry name | CSPG2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P13611 Secondary accession number(s): P20754 Q9UNW5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with