SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P13611

- CSPG2_HUMAN

UniProt

P13611 - CSPG2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Versican core protein

Gene
VCAN, CSPG2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. carbohydrate binding Source: InterPro
  3. glycosaminoglycan binding Source: ProtInc
  4. hyaluronic acid binding Source: ProtInc
  5. protein binding Source: IntAct

GO - Biological processi

  1. carbohydrate metabolic process Source: Reactome
  2. cell adhesion Source: ProtInc
  3. cell recognition Source: ProtInc
  4. chondroitin sulfate biosynthetic process Source: Reactome
  5. chondroitin sulfate catabolic process Source: Reactome
  6. chondroitin sulfate metabolic process Source: Reactome
  7. dermatan sulfate biosynthetic process Source: Reactome
  8. extracellular matrix organization Source: Reactome
  9. glial cell migration Source: BHF-UCL
  10. glycosaminoglycan metabolic process Source: Reactome
  11. heart development Source: Ensembl
  12. multicellular organismal development Source: ProtInc
  13. osteoblast differentiation Source: UniProt
  14. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Ligandi

Calcium, Hyaluronic acid, Lectin

Enzyme and pathway databases

ReactomeiREACT_120800. Dermatan sulfate biosynthesis.
REACT_120888. CS/DS degradation.
REACT_120989. Chondroitin sulfate biosynthesis.
REACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.
REACT_163906. ECM proteoglycans.

Names & Taxonomyi

Protein namesi
Recommended name:
Versican core protein
Alternative name(s):
Chondroitin sulfate proteoglycan core protein 2
Short name:
Chondroitin sulfate proteoglycan 2
Glial hyaluronate-binding protein
Short name:
GHAP
Large fibroblast proteoglycan
PG-M
Gene namesi
Name:VCAN
Synonyms:CSPG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:2464. VCAN.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: Reactome
  2. extracellular space Source: BHF-UCL
  3. Golgi lumen Source: Reactome
  4. intracellular membrane-bounded organelle Source: HPA
  5. lysosomal lumen Source: Reactome
  6. membrane Source: UniProt
  7. proteinaceous extracellular matrix Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Involvement in diseasei

Wagner vitreoretinopathy (WGVRP) [MIM:143200]: A rare vitreoretinopathy characterized by an optically empty vitreous cavity with fibrillary condensations and a preretinal avascular membrane. Other optical features include progressive chorioretinal atrophy, perivascular sheating, subcapsular cataract and myopia.
Note: The disease is caused by mutations affecting the gene represented in this entry. The pathological mechanism involves a quantitave imbalance of the normally occurring splice variants (1 Publication).2 Publications

Keywords - Diseasei

Cataract

Organism-specific databases

MIMi143200. phenotype.
Orphaneti898. Wagner disease.
PharmGKBiPA162408788.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 20201 PublicationAdd
BLAST
Chaini21 – 33963376Versican core proteinPRO_0000017522Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi44 ↔ 130 By similarity
Glycosylationi57 – 571N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi172 ↔ 243 By similarity
Disulfide bondi196 ↔ 217 By similarity
Disulfide bondi270 ↔ 345 By similarity
Disulfide bondi294 ↔ 315 By similarity
Glycosylationi330 – 3301N-linked (GlcNAc...)
Glycosylationi615 – 6151N-linked (GlcNAc...) Reviewed prediction
Glycosylationi782 – 7821N-linked (GlcNAc...) Reviewed prediction
Glycosylationi809 – 8091N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1332 – 13321N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1398 – 13981N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1442 – 14421N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1468 – 14681N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1663 – 16631N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1898 – 18981N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2179 – 21791N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2272 – 22721N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2280 – 22801N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2360 – 23601N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2385 – 23851N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2392 – 23921N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2496 – 24961N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2628 – 26281N-linked (GlcNAc...) Reviewed prediction
Glycosylationi2934 – 29341N-linked (GlcNAc...) Reviewed prediction
Glycosylationi3067 – 30671N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi3093 ↔ 3104 By similarity
Disulfide bondi3098 ↔ 3113 By similarity
Disulfide bondi3115 ↔ 3124 By similarity
Disulfide bondi3131 ↔ 3142 By similarity
Disulfide bondi3136 ↔ 3151 By similarity
Disulfide bondi3153 ↔ 3162 By similarity
Disulfide bondi3169 ↔ 3180 By similarity
Disulfide bondi3197 ↔ 3289 By similarity
Disulfide bondi3265 ↔ 3281 By similarity
Disulfide bondi3296 ↔ 3339 By similarity
Disulfide bondi3325 ↔ 3352 By similarity
Glycosylationi3369 – 33691N-linked (GlcNAc...) Reviewed prediction
Glycosylationi3379 – 33791N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

Phosphorylation sites are present in the extracellular medium.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein, Proteoglycan

Proteomic databases

MaxQBiP13611.
PaxDbiP13611.
PRIDEiP13611.

PTM databases

PhosphoSiteiP13611.

Miscellaneous databases

PMAP-CutDBP13611.

Expressioni

Tissue specificityi

Cerebral white matter and plasma. Isoform V0 and isoform V1 are expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V2 is restricted to normal brain and gliomas. Isoform V3 is found in all these tissues except medulloblastomas.1 Publication

Developmental stagei

Disappears after the cartilage development.

Gene expression databases

ArrayExpressiP13611.
BgeeiP13611.
CleanExiHS_VCAN.
GenevestigatoriP13611.

Organism-specific databases

HPAiCAB008979.
HPA004726.

Interactioni

Subunit structurei

Interacts with FBLN1 By similarity.

Binary interactionsi

WithEntry#Exp.IntActNotes
MMP9P147803EBI-8515977,EBI-1382326

Protein-protein interaction databases

BioGridi107844. 16 interactions.
IntActiP13611. 4 interactions.
MINTiMINT-4529155.
STRINGi9606.ENSP00000265077.

Structurei

3D structure databases

ProteinModelPortaliP13611.
SMRiP13611. Positions 23-247, 260-348, 3047-3292.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini21 – 146126Ig-like V-typeAdd
BLAST
Domaini150 – 24596Link 1Add
BLAST
Domaini251 – 34797Link 2Add
BLAST
Domaini3089 – 312537EGF-like 1Add
BLAST
Domaini3127 – 316337EGF-like 2; calcium-binding Reviewed predictionAdd
BLAST
Domaini3176 – 3290115C-type lectinAdd
BLAST
Domaini3294 – 335461SushiAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni348 – 1335988GAG-alpha (glucosaminoglycan attachment domain)Add
BLAST
Regioni1336 – 30891754GAG-betaAdd
BLAST

Sequence similaritiesi

Contains 2 EGF-like domains.
Contains 2 Link domains.

Keywords - Domaini

EGF-like domain, Immunoglobulin domain, Repeat, Signal, Sushi

Phylogenomic databases

eggNOGiNOG12793.
HOVERGENiHBG051140.
InParanoidiP13611.
KOiK06793.
OMAiTQEEFPW.
OrthoDBiEOG7J70DP.
PhylomeDBiP13611.
TreeFamiTF332134.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
3.10.100.10. 3 hits.
InterProiIPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR018378. C-type_lectin_CS.
IPR016187. C-type_lectin_fold.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR000538. Link.
IPR000436. Sushi_SCR_CCP.
[Graphical view]
PfamiPF00008. EGF. 2 hits.
PF00059. Lectin_C. 1 hit.
PF00084. Sushi. 1 hit.
PF07686. V-set. 1 hit.
PF00193. Xlink. 2 hits.
[Graphical view]
PRINTSiPR01265. LINKMODULE.
SMARTiSM00032. CCP. 1 hit.
SM00034. CLECT. 1 hit.
SM00181. EGF. 1 hit.
SM00179. EGF_CA. 1 hit.
SM00409. IG. 1 hit.
SM00445. LINK. 2 hits.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 3 hits.
SSF57535. SSF57535. 1 hit.
PROSITEiPS00010. ASX_HYDROXYL. 1 hit.
PS00615. C_TYPE_LECTIN_1. 1 hit.
PS50041. C_TYPE_LECTIN_2. 1 hit.
PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 2 hits.
PS01187. EGF_CA. 1 hit.
PS50835. IG_LIKE. 1 hit.
PS01241. LINK_1. 2 hits.
PS50963. LINK_2. 2 hits.
PS50923. SUSHI. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform V0 (identifier: P13611-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MFINIKSILW MCSTLIVTHA LHKVKVGKSP PVRGSLSGKV SLPCHFSTMP     50
TLPPSYNTSE FLRIKWSKIE VDKNGKDLKE TTVLVAQNGN IKIGQDYKGR 100
VSVPTHPEAV GDASLTVVKL LASDAGLYRC DVMYGIEDTQ DTVSLTVDGV 150
VFHYRAATSR YTLNFEAAQK ACLDVGAVIA TPEQLFAAYE DGFEQCDAGW 200
LADQTVRYPI RAPRVGCYGD KMGKAGVRTY GFRSPQETYD VYCYVDHLDG 250
DVFHLTVPSK FTFEEAAKEC ENQDARLATV GELQAAWRNG FDQCDYGWLS 300
DASVRHPVTV ARAQCGGGLL GVRTLYRFEN QTGFPPPDSR FDAYCFKPKE 350
ATTIDLSILA ETASPSLSKE PQMVSDRTTP IIPLVDELPV IPTEFPPVGN 400
IVSFEQKATV QPQAITDSLA TKLPTPTGST KKPWDMDDYS PSASGPLGKL 450
DISEIKEEVL QSTTGVSHYA TDSWDGVVED KQTQESVTQI EQIEVGPLVT 500
SMEILKHIPS KEFPVTETPL VTARMILESK TEKKMVSTVS ELVTTGHYGF 550
TLGEEDDEDR TLTVGSDEST LIFDQIPEVI TVSKTSEDTI HTHLEDLESV 600
SASTTVSPLI MPDNNGSSMD DWEERQTSGR ITEEFLGKYL STTPFPSQHR 650
TEIELFPYSG DKILVEGIST VIYPSLQTEM THRRERTETL IPEMRTDTYT 700
DEIQEEITKS PFMGKTEEEV FSGMKLSTSL SEPIHVTESS VEMTKSFDFP 750
TLITKLSAEP TEVRDMEEDF TATPGTTKYD ENITTVLLAH GTLSVEAATV 800
SKWSWDEDNT TSKPLESTEP SASSKLPPAL LTTVGMNGKD KDIPSFTEDG 850
ADEFTLIPDS TQKQLEEVTD EDIAAHGKFT IRFQPTTSTG IAEKSTLRDS 900
TTEEKVPPIT STEGQVYATM EGSALGEVED VDLSKPVSTV PQFAHTSEVE 950
GLAFVSYSST QEPTTYVDSS HTIPLSVIPK TDWGVLVPSV PSEDEVLGEP 1000
SQDILVIDQT RLEATISPET MRTTKITEGT TQEEFPWKEQ TAEKPVPALS 1050
STAWTPKEAV TPLDEQEGDG SAYTVSEDEL LTGSERVPVL ETTPVGKIDH 1100
SVSYPPGAVT EHKVKTDEVV TLTPRIGPKV SLSPGPEQKY ETEGSSTTGF 1150
TSSLSPFSTH ITQLMEETTT EKTSLEDIDL GSGLFEKPKA TELIEFSTIK 1200
VTVPSDITTA FSSVDRLHTT SAFKPSSAIT KKPPLIDREP GEETTSDMVI 1250
IGESTSHVPP TTLEDIVAKE TETDIDREYF TTSSPPATQP TRPPTVEDKE 1300
AFGPQALSTP QPPASTKFHP DINVYIIEVR ENKTGRMSDL SVIGHPIDSE 1350
SKEDEPCSEE TDPVHDLMAE ILPEFPDIIE IDLYHSEENE EEEEECANAT 1400
DVTTTPSVQY INGKHLVTTV PKDPEAAEAR RGQFESVAPS QNFSDSSESD 1450
THPFVIAKTE LSTAVQPNES TETTESLEVT WKPETYPETS EHFSGGEPDV 1500
FPTVPFHEEF ESGTAKKGAE SVTERDTEVG HQAHEHTEPV SLFPEESSGE 1550
IAIDQESQKI AFARATEVTF GEEVEKSTSV TYTPTIVPSS ASAYVSEEEA 1600
VTLIGNPWPD DLLSTKESWV EATPRQVVEL SGSSSIPITE GSGEAEEDED 1650
TMFTMVTDLS QRNTTDTLIT LDTSRIITES FFEVPATTIY PVSEQPSAKV 1700
VPTKFVSETD TSEWISSTTV EEKKRKEEEG TTGTASTFEV YSSTQRSDQL 1750
ILPFELESPN VATSSDSGTR KSFMSLTTPT QSEREMTDST PVFTETNTLE 1800
NLGAQTTEHS SIHQPGVQEG LTTLPRSPAS VFMEQGSGEA AADPETTTVS 1850
SFSLNVEYAI QAEKEVAGTL SPHVETTFST EPTGLVLSTV MDRVVAENIT 1900
QTSREIVISE RLGEPNYGAE IRGFSTGFPL EEDFSGDFRE YSTVSHPIAK 1950
EETVMMEGSG DAAFRDTQTS PSTVPTSVHI SHISDSEGPS STMVSTSAFP 2000
WEEFTSSAEG SGEQLVTVSS SVVPVLPSAV QKFSGTASSI IDEGLGEVGT 2050
VNEIDRRSTI LPTAEVEGTK APVEKEEVKV SGTVSTNFPQ TIEPAKLWSR 2100
QEVNPVRQEI ESETTSEEQI QEEKSFESPQ NSPATEQTIF DSQTFTETEL 2150
KTTDYSVLTT KKTYSDDKEM KEEDTSLVNM STPDPDANGL ESYTTLPEAT 2200
EKSHFFLATA LVTESIPAEH VVTDSPIKKE ESTKHFPKGM RPTIQESDTE 2250
LLFSGLGSGE EVLPTLPTES VNFTEVEQIN NTLYPHTSQV ESTSSDKIED 2300
FNRMENVAKE VGPLVSQTDI FEGSGSVTST TLIEILSDTG AEGPTVAPLP 2350
FSTDIGHPQN QTVRWAEEIQ TSRPQTITEQ DSNKNSSTAE INETTTSSTD 2400
FLARAYGFEM AKEFVTSAPK PSDLYYEPSG EGSGEVDIVD SFHTSATTQA 2450
TRQESSTTFV SDGSLEKHPE VPSAKAVTAD GFPTVSVMLP LHSEQNKSSP 2500
DPTSTLSNTV SYERSTDGSF QDRFREFEDS TLKPNRKKPT ENIIIDLDKE 2550
DKDLILTITE STILEILPEL TSDKNTIIDI DHTKPVYEDI LGMQTDIDTE 2600
VPSEPHDSND ESNDDSTQVQ EIYEAAVNLS LTEETFEGSA DVLASYTQAT 2650
HDESMTYEDR SQLDHMGFHF TTGIPAPSTE TELDVLLPTA TSLPIPRKSA 2700
TVIPEIEGIK AEAKALDDMF ESSTLSDGQA IADQSEIIPT LGQFERTQEE 2750
YEDKKHAGPS FQPEFSSGAE EALVDHTPYL SIATTHLMDQ SVTEVPDVME 2800
GSNPPYYTDT TLAVSTFAKL SSQTPSSPLT IYSGSEASGH TEIPQPSALP 2850
GIDVGSSVMS PQDSFKEIHV NIEATFKPSS EEYLHITEPP SLSPDTKLEP 2900
SEDDGKPELL EEMEASPTEL IAVEGTEILQ DFQNKTDGQV SGEAIKMFPT 2950
IKTPEAGTVI TTADEIELEG ATQWPHSTSA SATYGVEAGV VPWLSPQTSE 3000
RPTLSSSPEI NPETQAALIR GQDSTIAASE QQVAARILDS NDQATVNPVE 3050
FNTEVATPPF SLLETSNETD FLIGINEESV EGTAIYLPGP DRCKMNPCLN 3100
GGTCYPTETS YVCTCVPGYS GDQCELDFDE CHSNPCRNGA TCVDGFNTFR 3150
CLCLPSYVGA LCEQDTETCD YGWHKFQGQC YKYFAHRRTW DAAERECRLQ 3200
GAHLTSILSH EEQMFVNRVG HDYQWIGLND KMFEHDFRWT DGSTLQYENW 3250
RPNQPDSFFS AGEDCVVIIW HENGQWNDVP CNYHLTYTCK KGTVACGQPP 3300
VVENAKTFGK MKPRYEINSL IRYHCKDGFI QRHLPTIRCL GNGRWAIPKI 3350
TCMNPSAYQR TYSMKYFKNS SSAKDNSINT SKHDHRWSRR WQESRR 3396
Length:3,396
Mass (Da):372,820
Last modified:November 1, 1997 - v3
Checksum:iD174A1BBB8304FEC
GO
Isoform V1 (identifier: P13611-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     348-348: P → R
     349-1335: Missing.

Show »
Length:2,409
Mass (Da):265,050
Checksum:i4D290F9BF5A3F704
GO
Isoform V2 (identifier: P13611-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1336-3089: Missing.

Show »
Length:1,642
Mass (Da):182,062
Checksum:i25C238F0C5E94DBE
GO
Isoform V3 (identifier: P13611-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     348-348: P → R
     349-3089: Missing.

Show »
Length:655
Mass (Da):74,293
Checksum:i4933DFA2E0D7A0AD
GO
Isoform Vint (identifier: P13611-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     3355-3396: PSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR → RKWSFRKNGLPCYNNY

Show »
Length:3,370
Mass (Da):369,688
Checksum:iE76563A26BDA34C6
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti300 – 3001S → L.
Corresponds to variant rs2652098 [ dbSNP | Ensembl ].
VAR_021958
Natural varianti428 – 4281G → D.
Corresponds to variant rs2287926 [ dbSNP | Ensembl ].
VAR_020214
Natural varianti1516 – 15161K → R.
Corresponds to variant rs309559 [ dbSNP | Ensembl ].
VAR_021959
Natural varianti1826 – 18261R → H.
Corresponds to variant rs188703 [ dbSNP | Ensembl ].
VAR_031632
Natural varianti2301 – 23011F → Y.
Corresponds to variant rs160278 [ dbSNP | Ensembl ].
VAR_020215
Natural varianti2315 – 23151V → L.
Corresponds to variant rs3734094 [ dbSNP | Ensembl ].
VAR_020216
Natural varianti2937 – 29371D → Y.
Corresponds to variant rs160277 [ dbSNP | Ensembl ].
VAR_021960
Natural varianti3011 – 30111N → K.
Corresponds to variant rs16900532 [ dbSNP | Ensembl ].
VAR_031633

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei348 – 3481P → R in isoform V1 and isoform V3. VSP_003082
Alternative sequencei349 – 30892741Missing in isoform V3. VSP_003085Add
BLAST
Alternative sequencei349 – 1335987Missing in isoform V1. VSP_003083Add
BLAST
Alternative sequencei1336 – 30891754Missing in isoform V2. VSP_003084Add
BLAST
Alternative sequencei3355 – 339642PSAYQ…QESRR → RKWSFRKNGLPCYNNY in isoform Vint. VSP_003086Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti88 – 881N → D AA sequence 1 Publication
Sequence conflicti260 – 2601K → I AA sequence 1 Publication
Sequence conflicti274 – 2741D → A in BAA06801. 1 Publication
Sequence conflicti284 – 2841Q → G AA sequence 1 Publication
Sequence conflicti2709 – 27135IKAEA → EFREV in AAA36437. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X15998 mRNA. Translation: CAA34128.1.
U16306 mRNA. Translation: AAA65018.1.
U26555 mRNA. Translation: AAA67565.1.
D32039 mRNA. Translation: BAA06801.1.
S52488 Genomic DNA. Translation: AAB24878.1.
J02814 mRNA. Translation: AAA36437.1.
AF084545 mRNA. Translation: AAD48545.1.
CCDSiCCDS4060.1. [P13611-1]
CCDS47242.1. [P13611-4]
CCDS54875.1. [P13611-3]
CCDS54876.1. [P13611-2]
PIRiS06014. A60979.
RefSeqiNP_001119808.1. NM_001126336.2. [P13611-4]
NP_001157569.1. NM_001164097.1. [P13611-2]
NP_001157570.1. NM_001164098.1. [P13611-3]
NP_004376.2. NM_004385.4. [P13611-1]
UniGeneiHs.643801.

Genome annotation databases

EnsembliENST00000265077; ENSP00000265077; ENSG00000038427. [P13611-1]
ENST00000342785; ENSP00000342768; ENSG00000038427. [P13611-3]
ENST00000343200; ENSP00000340062; ENSG00000038427. [P13611-2]
ENST00000502527; ENSP00000421362; ENSG00000038427. [P13611-4]
GeneIDi1462.
KEGGihsa:1462.
UCSCiuc003kii.3. human. [P13611-1]
uc003kij.3. human. [P13611-2]
uc003kik.3. human. [P13611-4]
uc010jau.2. human. [P13611-3]

Polymorphism databases

DMDMi2506816.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Versican

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X15998 mRNA. Translation: CAA34128.1 .
U16306 mRNA. Translation: AAA65018.1 .
U26555 mRNA. Translation: AAA67565.1 .
D32039 mRNA. Translation: BAA06801.1 .
S52488 Genomic DNA. Translation: AAB24878.1 .
J02814 mRNA. Translation: AAA36437.1 .
AF084545 mRNA. Translation: AAD48545.1 .
CCDSi CCDS4060.1. [P13611-1 ]
CCDS47242.1. [P13611-4 ]
CCDS54875.1. [P13611-3 ]
CCDS54876.1. [P13611-2 ]
PIRi S06014. A60979.
RefSeqi NP_001119808.1. NM_001126336.2. [P13611-4 ]
NP_001157569.1. NM_001164097.1. [P13611-2 ]
NP_001157570.1. NM_001164098.1. [P13611-3 ]
NP_004376.2. NM_004385.4. [P13611-1 ]
UniGenei Hs.643801.

3D structure databases

ProteinModelPortali P13611.
SMRi P13611. Positions 23-247, 260-348, 3047-3292.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107844. 16 interactions.
IntActi P13611. 4 interactions.
MINTi MINT-4529155.
STRINGi 9606.ENSP00000265077.

PTM databases

PhosphoSitei P13611.

Polymorphism databases

DMDMi 2506816.

Proteomic databases

MaxQBi P13611.
PaxDbi P13611.
PRIDEi P13611.

Protocols and materials databases

DNASUi 1462.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000265077 ; ENSP00000265077 ; ENSG00000038427 . [P13611-1 ]
ENST00000342785 ; ENSP00000342768 ; ENSG00000038427 . [P13611-3 ]
ENST00000343200 ; ENSP00000340062 ; ENSG00000038427 . [P13611-2 ]
ENST00000502527 ; ENSP00000421362 ; ENSG00000038427 . [P13611-4 ]
GeneIDi 1462.
KEGGi hsa:1462.
UCSCi uc003kii.3. human. [P13611-1 ]
uc003kij.3. human. [P13611-2 ]
uc003kik.3. human. [P13611-4 ]
uc010jau.2. human. [P13611-3 ]

Organism-specific databases

CTDi 1462.
GeneCardsi GC05P082804.
GeneReviewsi VCAN.
HGNCi HGNC:2464. VCAN.
HPAi CAB008979.
HPA004726.
MIMi 118661. gene.
143200. phenotype.
neXtProti NX_P13611.
Orphaneti 898. Wagner disease.
PharmGKBi PA162408788.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG12793.
HOVERGENi HBG051140.
InParanoidi P13611.
KOi K06793.
OMAi TQEEFPW.
OrthoDBi EOG7J70DP.
PhylomeDBi P13611.
TreeFami TF332134.

Enzyme and pathway databases

Reactomei REACT_120800. Dermatan sulfate biosynthesis.
REACT_120888. CS/DS degradation.
REACT_120989. Chondroitin sulfate biosynthesis.
REACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.
REACT_163906. ECM proteoglycans.

Miscellaneous databases

ChiTaRSi VCAN. human.
GeneWikii Versican.
GenomeRNAii 1462.
NextBioi 6005.
PMAP-CutDB P13611.
PROi P13611.
SOURCEi Search...

Gene expression databases

ArrayExpressi P13611.
Bgeei P13611.
CleanExi HS_VCAN.
Genevestigatori P13611.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
3.10.100.10. 3 hits.
InterProi IPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR018378. C-type_lectin_CS.
IPR016187. C-type_lectin_fold.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR000538. Link.
IPR000436. Sushi_SCR_CCP.
[Graphical view ]
Pfami PF00008. EGF. 2 hits.
PF00059. Lectin_C. 1 hit.
PF00084. Sushi. 1 hit.
PF07686. V-set. 1 hit.
PF00193. Xlink. 2 hits.
[Graphical view ]
PRINTSi PR01265. LINKMODULE.
SMARTi SM00032. CCP. 1 hit.
SM00034. CLECT. 1 hit.
SM00181. EGF. 1 hit.
SM00179. EGF_CA. 1 hit.
SM00409. IG. 1 hit.
SM00445. LINK. 2 hits.
[Graphical view ]
SUPFAMi SSF56436. SSF56436. 3 hits.
SSF57535. SSF57535. 1 hit.
PROSITEi PS00010. ASX_HYDROXYL. 1 hit.
PS00615. C_TYPE_LECTIN_1. 1 hit.
PS50041. C_TYPE_LECTIN_2. 1 hit.
PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 2 hits.
PS01187. EGF_CA. 1 hit.
PS50835. IG_LIKE. 1 hit.
PS01241. LINK_1. 2 hits.
PS50963. LINK_2. 2 hits.
PS50923. SUSHI. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Multiple domains of the large fibroblast proteoglycan, versican."
    Zimmermann D.R., Ruoslahti E.
    EMBO J. 8:2975-2981(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V1).
    Tissue: Placenta.
  2. "A novel glycosaminoglycan attachment domain identified in two alternative splice variants of human versican."
    Dours-Zimmermann M.T., Zimmermann D.R.
    J. Biol. Chem. 269:32992-32998(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V2).
    Tissue: Glial tumor.
  3. "Characterization of the complete genomic structure of the human versican gene and functional analysis of its promoter."
    Naso M.F., Zimmermann D.R., Iozzo R.V.
    J. Biol. Chem. 269:32999-33008(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM V0).
  4. "Expression of PG-M(V3), an alternatively spliced form of PG-M without a chondroitin sulfate attachment in region in mouse and human tissues."
    Zako M., Shinomura T., Ujita M., Ito K., Kimata K.
    J. Biol. Chem. 270:3914-3918(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V3).
    Tissue: Brain.
  5. "Identification of the proteoglycan versican in aorta and smooth muscle cells by DNA sequence analysis, in situ hybridization and immunohistochemistry."
    Yao L.Y., Moody C., Schoenherr E., Wight T.N., Sandell L.J.
    Matrix Biol. 14:213-225(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 208-1427; 2081-2372 AND 2897-3233 (ISOFORM V1).
  6. "Mapping of the versican proteoglycan gene (CSPG2) to the long arm of human chromosome 5 (5q12-5q14)."
    Iozzo R.V., Naso M.F., Cannizzaro L.A., Wasmuth J.J., McPherson J.D.
    Genomics 14:845-851(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 251-347.
  7. "A fibroblast chondroitin sulfate proteoglycan core protein contains lectin-like and growth factor-like sequences."
    Krusius T., Gehlsen K.R., Ruoslahti E.
    J. Biol. Chem. 262:13120-13125(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2709-3396.
    Tissue: Lung fibroblast.
  8. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3333-3396 (ISOFORM VINT).
    Tissue: Aortic smooth muscle.
  9. "Isolation of a large aggregating proteoglycan from human brain."
    Perides G., Rahemtulla F., Lane W.S., Asher R.A., Bignami A.
    J. Biol. Chem. 267:23883-23887(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 21-37.
  10. "Isolation and partial characterization of a glial hyaluronate-binding protein."
    Perides G., Lane W.S., Andrews D., Dahl D., Bignami A.
    J. Biol. Chem. 264:5981-5987(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 24-50; 80-119; 128-155; 167-218; 229-268 AND 277-290.
    Tissue: Brain.
  11. "Structural similarity of hyaluronate binding proteins in brain and cartilage."
    Bignami A., Lane W.S., Andrews D., Dahl D.
    Brain Res. Bull. 22:67-70(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 171-210 AND 289-303.
  12. "Differential expression of versican isoforms in brain tumors."
    Paulus W., Baur I., Dours-Zimmermann M.T., Zimmermann D.R.
    J. Neuropathol. Exp. Neurol. 55:528-533(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY (ISOFORMS V0; V1; V2 AND V3).
  13. "Identification of a novel splice site mutation of the CSPG2 gene in a Japanese family with Wagner syndrome."
    Miyamoto T., Inoue H., Sakamoto Y., Kudo E., Naito T., Mikawa T., Mikawa Y., Isashiki Y., Osabe D., Shinohara S., Shiota H., Itakura M.
    Invest. Ophthalmol. Vis. Sci. 46:2726-2735(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN WGVRP.
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "Novel VCAN mutations and evidence for unbalanced alternative splicing in the pathogenesis of Wagner syndrome."
    Kloeckener-Gruissem B., Neidhardt J., Magyar I., Plauchu H., Zech J.C., Morle L., Palmer-Smith S.M., Macdonald M.J., Nas V., Fry A.E., Berger W.
    Eur. J. Hum. Genet. 21:352-356(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN WGVRP, PATHOLOGICAL MECHANISM.

Entry informationi

Entry nameiCSPG2_HUMAN
AccessioniPrimary (citable) accession number: P13611
Secondary accession number(s): P20754
, Q13010, Q13189, Q15123, Q9UCL9, Q9UNW5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: November 1, 1997
Last modified: September 3, 2014
This is version 176 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi