Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P13611 (CSPG2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 175. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Versican core protein
Alternative name(s):
Chondroitin sulfate proteoglycan core protein 2
Short name=Chondroitin sulfate proteoglycan 2
Glial hyaluronate-binding protein
Short name=GHAP
Large fibroblast proteoglycan
PG-M
Gene names
Name:VCAN
Synonyms:CSPG2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length3396 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Subunit structure

Interacts with FBLN1 By similarity.

Subcellular location

Secretedextracellular spaceextracellular matrix.

Tissue specificity

Cerebral white matter and plasma. Isoform V0 and isoform V1 are expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V2 is restricted to normal brain and gliomas. Isoform V3 is found in all these tissues except medulloblastomas. Ref.12

Developmental stage

Disappears after the cartilage development.

Post-translational modification

Phosphorylation sites are present in the extracellular medium.

Involvement in disease

Wagner vitreoretinopathy (WGVRP) [MIM:143200]: A rare vitreoretinopathy characterized by an optically empty vitreous cavity with fibrillary condensations and a preretinal avascular membrane. Other optical features include progressive chorioretinal atrophy, perivascular sheating, subcapsular cataract and myopia.
Note: The disease is caused by mutations affecting the gene represented in this entry. The pathological mechanism involves a quantitave imbalance of the normally occurring splice variants (Ref.15). Ref.13 Ref.15

Sequence similarities

Belongs to the aggrecan/versican proteoglycan family.

Contains 1 C-type lectin domain.

Contains 2 EGF-like domains.

Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Contains 2 Link domains.

Contains 1 Sushi (CCP/SCR) domain.

Ontologies

Keywords
   Cellular componentExtracellular matrix
Secreted
   Coding sequence diversityAlternative splicing
Polymorphism
   DiseaseCataract
   DomainEGF-like domain
Immunoglobulin domain
Repeat
Signal
Sushi
   LigandCalcium
Hyaluronic acid
Lectin
   PTMDisulfide bond
Glycoprotein
Phosphoprotein
Proteoglycan
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processcarbohydrate metabolic process

Traceable author statement. Source: Reactome

cell adhesion

Traceable author statement Ref.1. Source: ProtInc

cell recognition

Traceable author statement Ref.1. Source: ProtInc

chondroitin sulfate biosynthetic process

Traceable author statement. Source: Reactome

chondroitin sulfate catabolic process

Traceable author statement. Source: Reactome

chondroitin sulfate metabolic process

Traceable author statement. Source: Reactome

dermatan sulfate biosynthetic process

Traceable author statement. Source: Reactome

extracellular matrix organization

Traceable author statement. Source: Reactome

glial cell migration

Inferred from direct assay PubMed 18431253PubMed 18431253. Source: BHF-UCL

glycosaminoglycan metabolic process

Traceable author statement. Source: Reactome

heart development

Inferred from electronic annotation. Source: Ensembl

multicellular organismal development

Traceable author statement Ref.1. Source: ProtInc

osteoblast differentiation

Inferred from direct assay PubMed 16210410. Source: UniProt

small molecule metabolic process

Traceable author statement. Source: Reactome

   Cellular_componentGolgi lumen

Traceable author statement. Source: Reactome

extracellular region

Traceable author statement. Source: Reactome

extracellular space

Inferred from direct assay PubMed 20551380. Source: BHF-UCL

intracellular membrane-bounded organelle

Inferred from direct assay. Source: HPA

lysosomal lumen

Traceable author statement. Source: Reactome

membrane

Inferred from direct assay PubMed 16210410. Source: UniProt

proteinaceous extracellular matrix

Traceable author statement Ref.1. Source: ProtInc

   Molecular_functioncalcium ion binding

Inferred from electronic annotation. Source: InterPro

carbohydrate binding

Inferred from electronic annotation. Source: InterPro

glycosaminoglycan binding

Traceable author statement Ref.3. Source: ProtInc

hyaluronic acid binding

Traceable author statement Ref.1. Source: ProtInc

protein binding

Inferred from physical interaction PubMed 23601700. Source: IntAct

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

MMP9P147803EBI-8515977,EBI-1382326

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform V0 (identifier: P13611-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform V1 (identifier: P13611-2)

The sequence of this isoform differs from the canonical sequence as follows:
     348-348: P → R
     349-1335: Missing.
Isoform V2 (identifier: P13611-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1336-3089: Missing.
Isoform V3 (identifier: P13611-4)

The sequence of this isoform differs from the canonical sequence as follows:
     348-348: P → R
     349-3089: Missing.
Isoform Vint (identifier: P13611-5)

The sequence of this isoform differs from the canonical sequence as follows:
     3355-3396: PSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR → RKWSFRKNGLPCYNNY

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2020 Ref.9
Chain21 – 33963376Versican core protein
PRO_0000017522

Regions

Domain21 – 146126Ig-like V-type
Domain150 – 24596Link 1
Domain251 – 34797Link 2
Domain3089 – 312537EGF-like 1
Domain3127 – 316337EGF-like 2; calcium-binding Potential
Domain3176 – 3290115C-type lectin
Domain3294 – 335461Sushi
Region348 – 1335988GAG-alpha (glucosaminoglycan attachment domain)
Region1336 – 30891754GAG-beta

Amino acid modifications

Glycosylation571N-linked (GlcNAc...) Potential
Glycosylation3301N-linked (GlcNAc...)
Glycosylation6151N-linked (GlcNAc...) Potential
Glycosylation7821N-linked (GlcNAc...) Potential
Glycosylation8091N-linked (GlcNAc...) Potential
Glycosylation13321N-linked (GlcNAc...) Potential
Glycosylation13981N-linked (GlcNAc...) Potential
Glycosylation14421N-linked (GlcNAc...) Potential
Glycosylation14681N-linked (GlcNAc...) Potential
Glycosylation16631N-linked (GlcNAc...) Potential
Glycosylation18981N-linked (GlcNAc...) Potential
Glycosylation21791N-linked (GlcNAc...) Potential
Glycosylation22721N-linked (GlcNAc...) Potential
Glycosylation22801N-linked (GlcNAc...) Potential
Glycosylation23601N-linked (GlcNAc...) Potential
Glycosylation23851N-linked (GlcNAc...) Potential
Glycosylation23921N-linked (GlcNAc...) Potential
Glycosylation24961N-linked (GlcNAc...) Potential
Glycosylation26281N-linked (GlcNAc...) Potential
Glycosylation29341N-linked (GlcNAc...) Potential
Glycosylation30671N-linked (GlcNAc...) Potential
Glycosylation33691N-linked (GlcNAc...) Potential
Glycosylation33791N-linked (GlcNAc...) Potential
Disulfide bond44 ↔ 130 By similarity
Disulfide bond172 ↔ 243 By similarity
Disulfide bond196 ↔ 217 By similarity
Disulfide bond270 ↔ 345 By similarity
Disulfide bond294 ↔ 315 By similarity
Disulfide bond3093 ↔ 3104 By similarity
Disulfide bond3098 ↔ 3113 By similarity
Disulfide bond3115 ↔ 3124 By similarity
Disulfide bond3131 ↔ 3142 By similarity
Disulfide bond3136 ↔ 3151 By similarity
Disulfide bond3153 ↔ 3162 By similarity
Disulfide bond3169 ↔ 3180 By similarity
Disulfide bond3197 ↔ 3289 By similarity
Disulfide bond3265 ↔ 3281 By similarity
Disulfide bond3296 ↔ 3339 By similarity
Disulfide bond3325 ↔ 3352 By similarity

Natural variations

Alternative sequence3481P → R in isoform V1 and isoform V3.
VSP_003082
Alternative sequence349 – 30892741Missing in isoform V3.
VSP_003085
Alternative sequence349 – 1335987Missing in isoform V1.
VSP_003083
Alternative sequence1336 – 30891754Missing in isoform V2.
VSP_003084
Alternative sequence3355 – 339642PSAYQ…QESRR → RKWSFRKNGLPCYNNY in isoform Vint.
VSP_003086
Natural variant3001S → L.
Corresponds to variant rs2652098 [ dbSNP | Ensembl ].
VAR_021958
Natural variant4281G → D.
Corresponds to variant rs2287926 [ dbSNP | Ensembl ].
VAR_020214
Natural variant15161K → R.
Corresponds to variant rs309559 [ dbSNP | Ensembl ].
VAR_021959
Natural variant18261R → H.
Corresponds to variant rs188703 [ dbSNP | Ensembl ].
VAR_031632
Natural variant23011F → Y.
Corresponds to variant rs160278 [ dbSNP | Ensembl ].
VAR_020215
Natural variant23151V → L.
Corresponds to variant rs3734094 [ dbSNP | Ensembl ].
VAR_020216
Natural variant29371D → Y.
Corresponds to variant rs160277 [ dbSNP | Ensembl ].
VAR_021960
Natural variant30111N → K.
Corresponds to variant rs16900532 [ dbSNP | Ensembl ].
VAR_031633

Experimental info

Sequence conflict881N → D AA sequence Ref.10
Sequence conflict2601K → I AA sequence Ref.10
Sequence conflict2741D → A in BAA06801. Ref.4
Sequence conflict2841Q → G AA sequence Ref.10
Sequence conflict2709 – 27135IKAEA → EFREV in AAA36437. Ref.7

Sequences

Sequence LengthMass (Da)Tools
Isoform V0 [UniParc].

Last modified November 1, 1997. Version 3.
Checksum: D174A1BBB8304FEC

FASTA3,396372,820
        10         20         30         40         50         60 
MFINIKSILW MCSTLIVTHA LHKVKVGKSP PVRGSLSGKV SLPCHFSTMP TLPPSYNTSE 

        70         80         90        100        110        120 
FLRIKWSKIE VDKNGKDLKE TTVLVAQNGN IKIGQDYKGR VSVPTHPEAV GDASLTVVKL 

       130        140        150        160        170        180 
LASDAGLYRC DVMYGIEDTQ DTVSLTVDGV VFHYRAATSR YTLNFEAAQK ACLDVGAVIA 

       190        200        210        220        230        240 
TPEQLFAAYE DGFEQCDAGW LADQTVRYPI RAPRVGCYGD KMGKAGVRTY GFRSPQETYD 

       250        260        270        280        290        300 
VYCYVDHLDG DVFHLTVPSK FTFEEAAKEC ENQDARLATV GELQAAWRNG FDQCDYGWLS 

       310        320        330        340        350        360 
DASVRHPVTV ARAQCGGGLL GVRTLYRFEN QTGFPPPDSR FDAYCFKPKE ATTIDLSILA 

       370        380        390        400        410        420 
ETASPSLSKE PQMVSDRTTP IIPLVDELPV IPTEFPPVGN IVSFEQKATV QPQAITDSLA 

       430        440        450        460        470        480 
TKLPTPTGST KKPWDMDDYS PSASGPLGKL DISEIKEEVL QSTTGVSHYA TDSWDGVVED 

       490        500        510        520        530        540 
KQTQESVTQI EQIEVGPLVT SMEILKHIPS KEFPVTETPL VTARMILESK TEKKMVSTVS 

       550        560        570        580        590        600 
ELVTTGHYGF TLGEEDDEDR TLTVGSDEST LIFDQIPEVI TVSKTSEDTI HTHLEDLESV 

       610        620        630        640        650        660 
SASTTVSPLI MPDNNGSSMD DWEERQTSGR ITEEFLGKYL STTPFPSQHR TEIELFPYSG 

       670        680        690        700        710        720 
DKILVEGIST VIYPSLQTEM THRRERTETL IPEMRTDTYT DEIQEEITKS PFMGKTEEEV 

       730        740        750        760        770        780 
FSGMKLSTSL SEPIHVTESS VEMTKSFDFP TLITKLSAEP TEVRDMEEDF TATPGTTKYD 

       790        800        810        820        830        840 
ENITTVLLAH GTLSVEAATV SKWSWDEDNT TSKPLESTEP SASSKLPPAL LTTVGMNGKD 

       850        860        870        880        890        900 
KDIPSFTEDG ADEFTLIPDS TQKQLEEVTD EDIAAHGKFT IRFQPTTSTG IAEKSTLRDS 

       910        920        930        940        950        960 
TTEEKVPPIT STEGQVYATM EGSALGEVED VDLSKPVSTV PQFAHTSEVE GLAFVSYSST 

       970        980        990       1000       1010       1020 
QEPTTYVDSS HTIPLSVIPK TDWGVLVPSV PSEDEVLGEP SQDILVIDQT RLEATISPET 

      1030       1040       1050       1060       1070       1080 
MRTTKITEGT TQEEFPWKEQ TAEKPVPALS STAWTPKEAV TPLDEQEGDG SAYTVSEDEL 

      1090       1100       1110       1120       1130       1140 
LTGSERVPVL ETTPVGKIDH SVSYPPGAVT EHKVKTDEVV TLTPRIGPKV SLSPGPEQKY 

      1150       1160       1170       1180       1190       1200 
ETEGSSTTGF TSSLSPFSTH ITQLMEETTT EKTSLEDIDL GSGLFEKPKA TELIEFSTIK 

      1210       1220       1230       1240       1250       1260 
VTVPSDITTA FSSVDRLHTT SAFKPSSAIT KKPPLIDREP GEETTSDMVI IGESTSHVPP 

      1270       1280       1290       1300       1310       1320 
TTLEDIVAKE TETDIDREYF TTSSPPATQP TRPPTVEDKE AFGPQALSTP QPPASTKFHP 

      1330       1340       1350       1360       1370       1380 
DINVYIIEVR ENKTGRMSDL SVIGHPIDSE SKEDEPCSEE TDPVHDLMAE ILPEFPDIIE 

      1390       1400       1410       1420       1430       1440 
IDLYHSEENE EEEEECANAT DVTTTPSVQY INGKHLVTTV PKDPEAAEAR RGQFESVAPS 

      1450       1460       1470       1480       1490       1500 
QNFSDSSESD THPFVIAKTE LSTAVQPNES TETTESLEVT WKPETYPETS EHFSGGEPDV 

      1510       1520       1530       1540       1550       1560 
FPTVPFHEEF ESGTAKKGAE SVTERDTEVG HQAHEHTEPV SLFPEESSGE IAIDQESQKI 

      1570       1580       1590       1600       1610       1620 
AFARATEVTF GEEVEKSTSV TYTPTIVPSS ASAYVSEEEA VTLIGNPWPD DLLSTKESWV 

      1630       1640       1650       1660       1670       1680 
EATPRQVVEL SGSSSIPITE GSGEAEEDED TMFTMVTDLS QRNTTDTLIT LDTSRIITES 

      1690       1700       1710       1720       1730       1740 
FFEVPATTIY PVSEQPSAKV VPTKFVSETD TSEWISSTTV EEKKRKEEEG TTGTASTFEV 

      1750       1760       1770       1780       1790       1800 
YSSTQRSDQL ILPFELESPN VATSSDSGTR KSFMSLTTPT QSEREMTDST PVFTETNTLE 

      1810       1820       1830       1840       1850       1860 
NLGAQTTEHS SIHQPGVQEG LTTLPRSPAS VFMEQGSGEA AADPETTTVS SFSLNVEYAI 

      1870       1880       1890       1900       1910       1920 
QAEKEVAGTL SPHVETTFST EPTGLVLSTV MDRVVAENIT QTSREIVISE RLGEPNYGAE 

      1930       1940       1950       1960       1970       1980 
IRGFSTGFPL EEDFSGDFRE YSTVSHPIAK EETVMMEGSG DAAFRDTQTS PSTVPTSVHI 

      1990       2000       2010       2020       2030       2040 
SHISDSEGPS STMVSTSAFP WEEFTSSAEG SGEQLVTVSS SVVPVLPSAV QKFSGTASSI 

      2050       2060       2070       2080       2090       2100 
IDEGLGEVGT VNEIDRRSTI LPTAEVEGTK APVEKEEVKV SGTVSTNFPQ TIEPAKLWSR 

      2110       2120       2130       2140       2150       2160 
QEVNPVRQEI ESETTSEEQI QEEKSFESPQ NSPATEQTIF DSQTFTETEL KTTDYSVLTT 

      2170       2180       2190       2200       2210       2220 
KKTYSDDKEM KEEDTSLVNM STPDPDANGL ESYTTLPEAT EKSHFFLATA LVTESIPAEH 

      2230       2240       2250       2260       2270       2280 
VVTDSPIKKE ESTKHFPKGM RPTIQESDTE LLFSGLGSGE EVLPTLPTES VNFTEVEQIN 

      2290       2300       2310       2320       2330       2340 
NTLYPHTSQV ESTSSDKIED FNRMENVAKE VGPLVSQTDI FEGSGSVTST TLIEILSDTG 

      2350       2360       2370       2380       2390       2400 
AEGPTVAPLP FSTDIGHPQN QTVRWAEEIQ TSRPQTITEQ DSNKNSSTAE INETTTSSTD 

      2410       2420       2430       2440       2450       2460 
FLARAYGFEM AKEFVTSAPK PSDLYYEPSG EGSGEVDIVD SFHTSATTQA TRQESSTTFV 

      2470       2480       2490       2500       2510       2520 
SDGSLEKHPE VPSAKAVTAD GFPTVSVMLP LHSEQNKSSP DPTSTLSNTV SYERSTDGSF 

      2530       2540       2550       2560       2570       2580 
QDRFREFEDS TLKPNRKKPT ENIIIDLDKE DKDLILTITE STILEILPEL TSDKNTIIDI 

      2590       2600       2610       2620       2630       2640 
DHTKPVYEDI LGMQTDIDTE VPSEPHDSND ESNDDSTQVQ EIYEAAVNLS LTEETFEGSA 

      2650       2660       2670       2680       2690       2700 
DVLASYTQAT HDESMTYEDR SQLDHMGFHF TTGIPAPSTE TELDVLLPTA TSLPIPRKSA 

      2710       2720       2730       2740       2750       2760 
TVIPEIEGIK AEAKALDDMF ESSTLSDGQA IADQSEIIPT LGQFERTQEE YEDKKHAGPS 

      2770       2780       2790       2800       2810       2820 
FQPEFSSGAE EALVDHTPYL SIATTHLMDQ SVTEVPDVME GSNPPYYTDT TLAVSTFAKL 

      2830       2840       2850       2860       2870       2880 
SSQTPSSPLT IYSGSEASGH TEIPQPSALP GIDVGSSVMS PQDSFKEIHV NIEATFKPSS 

      2890       2900       2910       2920       2930       2940 
EEYLHITEPP SLSPDTKLEP SEDDGKPELL EEMEASPTEL IAVEGTEILQ DFQNKTDGQV 

      2950       2960       2970       2980       2990       3000 
SGEAIKMFPT IKTPEAGTVI TTADEIELEG ATQWPHSTSA SATYGVEAGV VPWLSPQTSE 

      3010       3020       3030       3040       3050       3060 
RPTLSSSPEI NPETQAALIR GQDSTIAASE QQVAARILDS NDQATVNPVE FNTEVATPPF 

      3070       3080       3090       3100       3110       3120 
SLLETSNETD FLIGINEESV EGTAIYLPGP DRCKMNPCLN GGTCYPTETS YVCTCVPGYS 

      3130       3140       3150       3160       3170       3180 
GDQCELDFDE CHSNPCRNGA TCVDGFNTFR CLCLPSYVGA LCEQDTETCD YGWHKFQGQC 

      3190       3200       3210       3220       3230       3240 
YKYFAHRRTW DAAERECRLQ GAHLTSILSH EEQMFVNRVG HDYQWIGLND KMFEHDFRWT 

      3250       3260       3270       3280       3290       3300 
DGSTLQYENW RPNQPDSFFS AGEDCVVIIW HENGQWNDVP CNYHLTYTCK KGTVACGQPP 

      3310       3320       3330       3340       3350       3360 
VVENAKTFGK MKPRYEINSL IRYHCKDGFI QRHLPTIRCL GNGRWAIPKI TCMNPSAYQR 

      3370       3380       3390 
TYSMKYFKNS SSAKDNSINT SKHDHRWSRR WQESRR 

« Hide

Isoform V1 [UniParc].

Checksum: 4D290F9BF5A3F704
Show »

FASTA2,409265,050
Isoform V2 [UniParc].

Checksum: 25C238F0C5E94DBE
Show »

FASTA1,642182,062
Isoform V3 [UniParc].

Checksum: 4933DFA2E0D7A0AD
Show »

FASTA65574,293
Isoform Vint [UniParc].

Checksum: E76563A26BDA34C6
Show »

FASTA3,370369,688

References

« Hide 'large scale' references
[1]"Multiple domains of the large fibroblast proteoglycan, versican."
Zimmermann D.R., Ruoslahti E.
EMBO J. 8:2975-2981(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V1).
Tissue: Placenta.
[2]"A novel glycosaminoglycan attachment domain identified in two alternative splice variants of human versican."
Dours-Zimmermann M.T., Zimmermann D.R.
J. Biol. Chem. 269:32992-32998(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V2).
Tissue: Glial tumor.
[3]"Characterization of the complete genomic structure of the human versican gene and functional analysis of its promoter."
Naso M.F., Zimmermann D.R., Iozzo R.V.
J. Biol. Chem. 269:32999-33008(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM V0).
[4]"Expression of PG-M(V3), an alternatively spliced form of PG-M without a chondroitin sulfate attachment in region in mouse and human tissues."
Zako M., Shinomura T., Ujita M., Ito K., Kimata K.
J. Biol. Chem. 270:3914-3918(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V3).
Tissue: Brain.
[5]"Identification of the proteoglycan versican in aorta and smooth muscle cells by DNA sequence analysis, in situ hybridization and immunohistochemistry."
Yao L.Y., Moody C., Schoenherr E., Wight T.N., Sandell L.J.
Matrix Biol. 14:213-225(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 208-1427; 2081-2372 AND 2897-3233 (ISOFORM V1).
[6]"Mapping of the versican proteoglycan gene (CSPG2) to the long arm of human chromosome 5 (5q12-5q14)."
Iozzo R.V., Naso M.F., Cannizzaro L.A., Wasmuth J.J., McPherson J.D.
Genomics 14:845-851(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 251-347.
[7]"A fibroblast chondroitin sulfate proteoglycan core protein contains lectin-like and growth factor-like sequences."
Krusius T., Gehlsen K.R., Ruoslahti E.
J. Biol. Chem. 262:13120-13125(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2709-3396.
Tissue: Lung fibroblast.
[8]"Versican/PG-M isoforms in vascular smooth muscle cells."
Lemire J.M., Braun K.R., Maurel P., Kaplan E.D., Schwartz S.M., Wight T.N.
Arterioscler. Thromb. Vasc. Biol. 19:1630-1639(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3333-3396 (ISOFORM VINT).
Tissue: Aortic smooth muscle.
[9]"Isolation of a large aggregating proteoglycan from human brain."
Perides G., Rahemtulla F., Lane W.S., Asher R.A., Bignami A.
J. Biol. Chem. 267:23883-23887(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 21-37.
[10]"Isolation and partial characterization of a glial hyaluronate-binding protein."
Perides G., Lane W.S., Andrews D., Dahl D., Bignami A.
J. Biol. Chem. 264:5981-5987(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 24-50; 80-119; 128-155; 167-218; 229-268 AND 277-290.
Tissue: Brain.
[11]"Structural similarity of hyaluronate binding proteins in brain and cartilage."
Bignami A., Lane W.S., Andrews D., Dahl D.
Brain Res. Bull. 22:67-70(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 171-210 AND 289-303.
[12]"Differential expression of versican isoforms in brain tumors."
Paulus W., Baur I., Dours-Zimmermann M.T., Zimmermann D.R.
J. Neuropathol. Exp. Neurol. 55:528-533(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY (ISOFORMS V0; V1; V2 AND V3).
[13]"Identification of a novel splice site mutation of the CSPG2 gene in a Japanese family with Wagner syndrome."
Miyamoto T., Inoue H., Sakamoto Y., Kudo E., Naito T., Mikawa T., Mikawa Y., Isashiki Y., Osabe D., Shinohara S., Shiota H., Itakura M.
Invest. Ophthalmol. Vis. Sci. 46:2726-2735(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INVOLVEMENT IN WGVRP.
[14]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[15]"Novel VCAN mutations and evidence for unbalanced alternative splicing in the pathogenesis of Wagner syndrome."
Kloeckener-Gruissem B., Neidhardt J., Magyar I., Plauchu H., Zech J.C., Morle L., Palmer-Smith S.M., Macdonald M.J., Nas V., Fry A.E., Berger W.
Eur. J. Hum. Genet. 21:352-356(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: INVOLVEMENT IN WGVRP, PATHOLOGICAL MECHANISM.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X15998 mRNA. Translation: CAA34128.1.
U16306 mRNA. Translation: AAA65018.1.
U26555 mRNA. Translation: AAA67565.1.
D32039 mRNA. Translation: BAA06801.1.
S52488 Genomic DNA. Translation: AAB24878.1.
J02814 mRNA. Translation: AAA36437.1.
AF084545 mRNA. Translation: AAD48545.1.
CCDSCCDS4060.1. [P13611-1]
CCDS47242.1. [P13611-4]
CCDS54875.1. [P13611-3]
CCDS54876.1. [P13611-2]
PIRA60979. S06014.
RefSeqNP_001119808.1. NM_001126336.2. [P13611-4]
NP_001157569.1. NM_001164097.1. [P13611-2]
NP_001157570.1. NM_001164098.1. [P13611-3]
NP_004376.2. NM_004385.4. [P13611-1]
UniGeneHs.643801.

3D structure databases

ProteinModelPortalP13611.
SMRP13611. Positions 23-247, 260-348, 3047-3292.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107844. 16 interactions.
IntActP13611. 4 interactions.
MINTMINT-4529155.
STRING9606.ENSP00000265077.

PTM databases

PhosphoSiteP13611.

Polymorphism databases

DMDM2506816.

Proteomic databases

MaxQBP13611.
PaxDbP13611.
PRIDEP13611.

Protocols and materials databases

DNASU1462.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000265077; ENSP00000265077; ENSG00000038427. [P13611-1]
ENST00000342785; ENSP00000342768; ENSG00000038427. [P13611-3]
ENST00000343200; ENSP00000340062; ENSG00000038427. [P13611-2]
ENST00000502527; ENSP00000421362; ENSG00000038427. [P13611-4]
GeneID1462.
KEGGhsa:1462.
UCSCuc003kii.3. human. [P13611-1]
uc003kij.3. human. [P13611-2]
uc003kik.3. human. [P13611-4]
uc010jau.2. human. [P13611-3]

Organism-specific databases

CTD1462.
GeneCardsGC05P082804.
GeneReviewsVCAN.
HGNCHGNC:2464. VCAN.
HPACAB008979.
HPA004726.
MIM118661. gene.
143200. phenotype.
neXtProtNX_P13611.
Orphanet898. Wagner disease.
PharmGKBPA162408788.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG12793.
HOVERGENHBG051140.
InParanoidP13611.
KOK06793.
OMATQEEFPW.
OrthoDBEOG7J70DP.
PhylomeDBP13611.
TreeFamTF332134.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.
REACT_116125. Disease.
REACT_118779. Extracellular matrix organization.

Gene expression databases

ArrayExpressP13611.
BgeeP13611.
CleanExHS_VCAN.
GenevestigatorP13611.

Family and domain databases

Gene3D2.60.40.10. 1 hit.
3.10.100.10. 3 hits.
InterProIPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR018378. C-type_lectin_CS.
IPR016187. C-type_lectin_fold.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR000538. Link.
IPR000436. Sushi_SCR_CCP.
[Graphical view]
PfamPF00008. EGF. 2 hits.
PF00059. Lectin_C. 1 hit.
PF00084. Sushi. 1 hit.
PF07686. V-set. 1 hit.
PF00193. Xlink. 2 hits.
[Graphical view]
PRINTSPR01265. LINKMODULE.
SMARTSM00032. CCP. 1 hit.
SM00034. CLECT. 1 hit.
SM00181. EGF. 1 hit.
SM00179. EGF_CA. 1 hit.
SM00409. IG. 1 hit.
SM00445. LINK. 2 hits.
[Graphical view]
SUPFAMSSF56436. SSF56436. 3 hits.
SSF57535. SSF57535. 1 hit.
PROSITEPS00010. ASX_HYDROXYL. 1 hit.
PS00615. C_TYPE_LECTIN_1. 1 hit.
PS50041. C_TYPE_LECTIN_2. 1 hit.
PS00022. EGF_1. 2 hits.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 2 hits.
PS01187. EGF_CA. 1 hit.
PS50835. IG_LIKE. 1 hit.
PS01241. LINK_1. 2 hits.
PS50963. LINK_2. 2 hits.
PS50923. SUSHI. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSVCAN. human.
GeneWikiVersican.
GenomeRNAi1462.
NextBio6005.
PMAP-CutDBP13611.
PROP13611.
SOURCESearch...

Entry information

Entry nameCSPG2_HUMAN
AccessionPrimary (citable) accession number: P13611
Secondary accession number(s): P20754 expand/collapse secondary AC list , Q13010, Q13189, Q15123, Q9UCL9, Q9UNW5
Entry history
Integrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: November 1, 1997
Last modified: July 9, 2014
This is version 175 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM