Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P13611

- CSPG2_HUMAN

UniProt

P13611 - CSPG2_HUMAN

Protein

Versican core protein

Gene

VCAN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 177 (01 Oct 2014)
      Sequence version 3 (01 Nov 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. carbohydrate binding Source: InterPro
    3. glycosaminoglycan binding Source: ProtInc
    4. hyaluronic acid binding Source: ProtInc
    5. protein binding Source: IntAct

    GO - Biological processi

    1. carbohydrate metabolic process Source: Reactome
    2. cell adhesion Source: ProtInc
    3. cell recognition Source: ProtInc
    4. chondroitin sulfate biosynthetic process Source: Reactome
    5. chondroitin sulfate catabolic process Source: Reactome
    6. chondroitin sulfate metabolic process Source: Reactome
    7. dermatan sulfate biosynthetic process Source: Reactome
    8. extracellular matrix organization Source: Reactome
    9. glial cell migration Source: BHF-UCL
    10. glycosaminoglycan metabolic process Source: Reactome
    11. heart development Source: Ensembl
    12. multicellular organismal development Source: ProtInc
    13. osteoblast differentiation Source: UniProt
    14. small molecule metabolic process Source: Reactome

    Keywords - Ligandi

    Calcium, Hyaluronic acid, Lectin

    Enzyme and pathway databases

    ReactomeiREACT_120800. Dermatan sulfate biosynthesis.
    REACT_120888. CS/DS degradation.
    REACT_120989. Chondroitin sulfate biosynthesis.
    REACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.
    REACT_163906. ECM proteoglycans.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Versican core protein
    Alternative name(s):
    Chondroitin sulfate proteoglycan core protein 2
    Short name:
    Chondroitin sulfate proteoglycan 2
    Glial hyaluronate-binding protein
    Short name:
    GHAP
    Large fibroblast proteoglycan
    PG-M
    Gene namesi
    Name:VCAN
    Synonyms:CSPG2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:2464. VCAN.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: Reactome
    2. extracellular space Source: BHF-UCL
    3. Golgi lumen Source: Reactome
    4. intracellular membrane-bounded organelle Source: HPA
    5. lysosomal lumen Source: Reactome
    6. membrane Source: UniProt
    7. proteinaceous extracellular matrix Source: ProtInc

    Keywords - Cellular componenti

    Extracellular matrix, Secreted

    Pathology & Biotechi

    Involvement in diseasei

    Wagner vitreoretinopathy (WGVRP) [MIM:143200]: A rare vitreoretinopathy characterized by an optically empty vitreous cavity with fibrillary condensations and a preretinal avascular membrane. Other optical features include progressive chorioretinal atrophy, perivascular sheating, subcapsular cataract and myopia.2 Publications
    Note: The disease is caused by mutations affecting the gene represented in this entry. The pathological mechanism involves a quantitave imbalance of the normally occurring splice variants (PubMed:22739342).1 Publication

    Keywords - Diseasei

    Cataract

    Organism-specific databases

    MIMi143200. phenotype.
    Orphaneti898. Wagner disease.
    PharmGKBiPA162408788.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 20201 PublicationAdd
    BLAST
    Chaini21 – 33963376Versican core proteinPRO_0000017522Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi44 ↔ 130By similarity
    Glycosylationi57 – 571N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi172 ↔ 243By similarity
    Disulfide bondi196 ↔ 217By similarity
    Disulfide bondi270 ↔ 345By similarity
    Disulfide bondi294 ↔ 315By similarity
    Glycosylationi330 – 3301N-linked (GlcNAc...)
    Glycosylationi615 – 6151N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi782 – 7821N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi809 – 8091N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1332 – 13321N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1398 – 13981N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1442 – 14421N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1468 – 14681N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1663 – 16631N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1898 – 18981N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2179 – 21791N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2272 – 22721N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2280 – 22801N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2360 – 23601N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2385 – 23851N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2392 – 23921N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2496 – 24961N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2628 – 26281N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi2934 – 29341N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi3067 – 30671N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi3093 ↔ 3104By similarity
    Disulfide bondi3098 ↔ 3113By similarity
    Disulfide bondi3115 ↔ 3124By similarity
    Disulfide bondi3131 ↔ 3142By similarity
    Disulfide bondi3136 ↔ 3151By similarity
    Disulfide bondi3153 ↔ 3162By similarity
    Disulfide bondi3169 ↔ 3180By similarity
    Disulfide bondi3197 ↔ 3289By similarity
    Disulfide bondi3265 ↔ 3281By similarity
    Disulfide bondi3296 ↔ 3339By similarity
    Disulfide bondi3325 ↔ 3352By similarity
    Glycosylationi3369 – 33691N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi3379 – 33791N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    Phosphorylation sites are present in the extracellular medium.

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein, Proteoglycan

    Proteomic databases

    MaxQBiP13611.
    PaxDbiP13611.
    PRIDEiP13611.

    PTM databases

    PhosphoSiteiP13611.

    Miscellaneous databases

    PMAP-CutDBP13611.

    Expressioni

    Tissue specificityi

    Cerebral white matter and plasma. Isoform V0 and isoform V1 are expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V2 is restricted to normal brain and gliomas. Isoform V3 is found in all these tissues except medulloblastomas.

    Developmental stagei

    Disappears after the cartilage development.

    Gene expression databases

    ArrayExpressiP13611.
    BgeeiP13611.
    CleanExiHS_VCAN.
    GenevestigatoriP13611.

    Organism-specific databases

    HPAiCAB008979.
    HPA004726.

    Interactioni

    Subunit structurei

    Interacts with FBLN1.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    MMP9P147803EBI-8515977,EBI-1382326

    Protein-protein interaction databases

    BioGridi107844. 16 interactions.
    IntActiP13611. 5 interactions.
    MINTiMINT-4529155.
    STRINGi9606.ENSP00000265077.

    Structurei

    3D structure databases

    ProteinModelPortaliP13611.
    SMRiP13611. Positions 23-247, 260-348, 3047-3292.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini21 – 146126Ig-like V-typeAdd
    BLAST
    Domaini150 – 24596Link 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini251 – 34797Link 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini3089 – 312537EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini3127 – 316337EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini3176 – 3290115C-type lectinPROSITE-ProRule annotationAdd
    BLAST
    Domaini3294 – 335461SushiPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni348 – 1335988GAG-alpha (glucosaminoglycan attachment domain)Add
    BLAST
    Regioni1336 – 30891754GAG-betaAdd
    BLAST

    Sequence similaritiesi

    Contains 1 C-type lectin domain.PROSITE-ProRule annotation
    Contains 2 EGF-like domains.PROSITE-ProRule annotation
    Contains 2 Link domains.PROSITE-ProRule annotation
    Contains 1 Sushi (CCP/SCR) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Immunoglobulin domain, Repeat, Signal, Sushi

    Phylogenomic databases

    eggNOGiNOG12793.
    HOVERGENiHBG051140.
    InParanoidiP13611.
    KOiK06793.
    OMAiTQEEFPW.
    OrthoDBiEOG7J70DP.
    PhylomeDBiP13611.
    TreeFamiTF332134.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    3.10.100.10. 3 hits.
    InterProiIPR001304. C-type_lectin.
    IPR016186. C-type_lectin-like.
    IPR018378. C-type_lectin_CS.
    IPR016187. C-type_lectin_fold.
    IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    IPR000538. Link.
    IPR000436. Sushi_SCR_CCP.
    [Graphical view]
    PfamiPF00008. EGF. 2 hits.
    PF00059. Lectin_C. 1 hit.
    PF00084. Sushi. 1 hit.
    PF07686. V-set. 1 hit.
    PF00193. Xlink. 2 hits.
    [Graphical view]
    PRINTSiPR01265. LINKMODULE.
    SMARTiSM00032. CCP. 1 hit.
    SM00034. CLECT. 1 hit.
    SM00181. EGF. 1 hit.
    SM00179. EGF_CA. 1 hit.
    SM00409. IG. 1 hit.
    SM00445. LINK. 2 hits.
    [Graphical view]
    SUPFAMiSSF56436. SSF56436. 3 hits.
    SSF57535. SSF57535. 1 hit.
    PROSITEiPS00010. ASX_HYDROXYL. 1 hit.
    PS00615. C_TYPE_LECTIN_1. 1 hit.
    PS50041. C_TYPE_LECTIN_2. 1 hit.
    PS00022. EGF_1. 2 hits.
    PS01186. EGF_2. 1 hit.
    PS50026. EGF_3. 2 hits.
    PS01187. EGF_CA. 1 hit.
    PS50835. IG_LIKE. 1 hit.
    PS01241. LINK_1. 2 hits.
    PS50963. LINK_2. 2 hits.
    PS50923. SUSHI. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform V0 (identifier: P13611-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFINIKSILW MCSTLIVTHA LHKVKVGKSP PVRGSLSGKV SLPCHFSTMP     50
    TLPPSYNTSE FLRIKWSKIE VDKNGKDLKE TTVLVAQNGN IKIGQDYKGR 100
    VSVPTHPEAV GDASLTVVKL LASDAGLYRC DVMYGIEDTQ DTVSLTVDGV 150
    VFHYRAATSR YTLNFEAAQK ACLDVGAVIA TPEQLFAAYE DGFEQCDAGW 200
    LADQTVRYPI RAPRVGCYGD KMGKAGVRTY GFRSPQETYD VYCYVDHLDG 250
    DVFHLTVPSK FTFEEAAKEC ENQDARLATV GELQAAWRNG FDQCDYGWLS 300
    DASVRHPVTV ARAQCGGGLL GVRTLYRFEN QTGFPPPDSR FDAYCFKPKE 350
    ATTIDLSILA ETASPSLSKE PQMVSDRTTP IIPLVDELPV IPTEFPPVGN 400
    IVSFEQKATV QPQAITDSLA TKLPTPTGST KKPWDMDDYS PSASGPLGKL 450
    DISEIKEEVL QSTTGVSHYA TDSWDGVVED KQTQESVTQI EQIEVGPLVT 500
    SMEILKHIPS KEFPVTETPL VTARMILESK TEKKMVSTVS ELVTTGHYGF 550
    TLGEEDDEDR TLTVGSDEST LIFDQIPEVI TVSKTSEDTI HTHLEDLESV 600
    SASTTVSPLI MPDNNGSSMD DWEERQTSGR ITEEFLGKYL STTPFPSQHR 650
    TEIELFPYSG DKILVEGIST VIYPSLQTEM THRRERTETL IPEMRTDTYT 700
    DEIQEEITKS PFMGKTEEEV FSGMKLSTSL SEPIHVTESS VEMTKSFDFP 750
    TLITKLSAEP TEVRDMEEDF TATPGTTKYD ENITTVLLAH GTLSVEAATV 800
    SKWSWDEDNT TSKPLESTEP SASSKLPPAL LTTVGMNGKD KDIPSFTEDG 850
    ADEFTLIPDS TQKQLEEVTD EDIAAHGKFT IRFQPTTSTG IAEKSTLRDS 900
    TTEEKVPPIT STEGQVYATM EGSALGEVED VDLSKPVSTV PQFAHTSEVE 950
    GLAFVSYSST QEPTTYVDSS HTIPLSVIPK TDWGVLVPSV PSEDEVLGEP 1000
    SQDILVIDQT RLEATISPET MRTTKITEGT TQEEFPWKEQ TAEKPVPALS 1050
    STAWTPKEAV TPLDEQEGDG SAYTVSEDEL LTGSERVPVL ETTPVGKIDH 1100
    SVSYPPGAVT EHKVKTDEVV TLTPRIGPKV SLSPGPEQKY ETEGSSTTGF 1150
    TSSLSPFSTH ITQLMEETTT EKTSLEDIDL GSGLFEKPKA TELIEFSTIK 1200
    VTVPSDITTA FSSVDRLHTT SAFKPSSAIT KKPPLIDREP GEETTSDMVI 1250
    IGESTSHVPP TTLEDIVAKE TETDIDREYF TTSSPPATQP TRPPTVEDKE 1300
    AFGPQALSTP QPPASTKFHP DINVYIIEVR ENKTGRMSDL SVIGHPIDSE 1350
    SKEDEPCSEE TDPVHDLMAE ILPEFPDIIE IDLYHSEENE EEEEECANAT 1400
    DVTTTPSVQY INGKHLVTTV PKDPEAAEAR RGQFESVAPS QNFSDSSESD 1450
    THPFVIAKTE LSTAVQPNES TETTESLEVT WKPETYPETS EHFSGGEPDV 1500
    FPTVPFHEEF ESGTAKKGAE SVTERDTEVG HQAHEHTEPV SLFPEESSGE 1550
    IAIDQESQKI AFARATEVTF GEEVEKSTSV TYTPTIVPSS ASAYVSEEEA 1600
    VTLIGNPWPD DLLSTKESWV EATPRQVVEL SGSSSIPITE GSGEAEEDED 1650
    TMFTMVTDLS QRNTTDTLIT LDTSRIITES FFEVPATTIY PVSEQPSAKV 1700
    VPTKFVSETD TSEWISSTTV EEKKRKEEEG TTGTASTFEV YSSTQRSDQL 1750
    ILPFELESPN VATSSDSGTR KSFMSLTTPT QSEREMTDST PVFTETNTLE 1800
    NLGAQTTEHS SIHQPGVQEG LTTLPRSPAS VFMEQGSGEA AADPETTTVS 1850
    SFSLNVEYAI QAEKEVAGTL SPHVETTFST EPTGLVLSTV MDRVVAENIT 1900
    QTSREIVISE RLGEPNYGAE IRGFSTGFPL EEDFSGDFRE YSTVSHPIAK 1950
    EETVMMEGSG DAAFRDTQTS PSTVPTSVHI SHISDSEGPS STMVSTSAFP 2000
    WEEFTSSAEG SGEQLVTVSS SVVPVLPSAV QKFSGTASSI IDEGLGEVGT 2050
    VNEIDRRSTI LPTAEVEGTK APVEKEEVKV SGTVSTNFPQ TIEPAKLWSR 2100
    QEVNPVRQEI ESETTSEEQI QEEKSFESPQ NSPATEQTIF DSQTFTETEL 2150
    KTTDYSVLTT KKTYSDDKEM KEEDTSLVNM STPDPDANGL ESYTTLPEAT 2200
    EKSHFFLATA LVTESIPAEH VVTDSPIKKE ESTKHFPKGM RPTIQESDTE 2250
    LLFSGLGSGE EVLPTLPTES VNFTEVEQIN NTLYPHTSQV ESTSSDKIED 2300
    FNRMENVAKE VGPLVSQTDI FEGSGSVTST TLIEILSDTG AEGPTVAPLP 2350
    FSTDIGHPQN QTVRWAEEIQ TSRPQTITEQ DSNKNSSTAE INETTTSSTD 2400
    FLARAYGFEM AKEFVTSAPK PSDLYYEPSG EGSGEVDIVD SFHTSATTQA 2450
    TRQESSTTFV SDGSLEKHPE VPSAKAVTAD GFPTVSVMLP LHSEQNKSSP 2500
    DPTSTLSNTV SYERSTDGSF QDRFREFEDS TLKPNRKKPT ENIIIDLDKE 2550
    DKDLILTITE STILEILPEL TSDKNTIIDI DHTKPVYEDI LGMQTDIDTE 2600
    VPSEPHDSND ESNDDSTQVQ EIYEAAVNLS LTEETFEGSA DVLASYTQAT 2650
    HDESMTYEDR SQLDHMGFHF TTGIPAPSTE TELDVLLPTA TSLPIPRKSA 2700
    TVIPEIEGIK AEAKALDDMF ESSTLSDGQA IADQSEIIPT LGQFERTQEE 2750
    YEDKKHAGPS FQPEFSSGAE EALVDHTPYL SIATTHLMDQ SVTEVPDVME 2800
    GSNPPYYTDT TLAVSTFAKL SSQTPSSPLT IYSGSEASGH TEIPQPSALP 2850
    GIDVGSSVMS PQDSFKEIHV NIEATFKPSS EEYLHITEPP SLSPDTKLEP 2900
    SEDDGKPELL EEMEASPTEL IAVEGTEILQ DFQNKTDGQV SGEAIKMFPT 2950
    IKTPEAGTVI TTADEIELEG ATQWPHSTSA SATYGVEAGV VPWLSPQTSE 3000
    RPTLSSSPEI NPETQAALIR GQDSTIAASE QQVAARILDS NDQATVNPVE 3050
    FNTEVATPPF SLLETSNETD FLIGINEESV EGTAIYLPGP DRCKMNPCLN 3100
    GGTCYPTETS YVCTCVPGYS GDQCELDFDE CHSNPCRNGA TCVDGFNTFR 3150
    CLCLPSYVGA LCEQDTETCD YGWHKFQGQC YKYFAHRRTW DAAERECRLQ 3200
    GAHLTSILSH EEQMFVNRVG HDYQWIGLND KMFEHDFRWT DGSTLQYENW 3250
    RPNQPDSFFS AGEDCVVIIW HENGQWNDVP CNYHLTYTCK KGTVACGQPP 3300
    VVENAKTFGK MKPRYEINSL IRYHCKDGFI QRHLPTIRCL GNGRWAIPKI 3350
    TCMNPSAYQR TYSMKYFKNS SSAKDNSINT SKHDHRWSRR WQESRR 3396
    Length:3,396
    Mass (Da):372,820
    Last modified:November 1, 1997 - v3
    Checksum:iD174A1BBB8304FEC
    GO
    Isoform V1 (identifier: P13611-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         348-348: P → R
         349-1335: Missing.

    Show »
    Length:2,409
    Mass (Da):265,050
    Checksum:i4D290F9BF5A3F704
    GO
    Isoform V2 (identifier: P13611-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1336-3089: Missing.

    Show »
    Length:1,642
    Mass (Da):182,062
    Checksum:i25C238F0C5E94DBE
    GO
    Isoform V3 (identifier: P13611-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         348-348: P → R
         349-3089: Missing.

    Show »
    Length:655
    Mass (Da):74,293
    Checksum:i4933DFA2E0D7A0AD
    GO
    Isoform Vint (identifier: P13611-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         3355-3396: PSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR → RKWSFRKNGLPCYNNY

    Show »
    Length:3,370
    Mass (Da):369,688
    Checksum:iE76563A26BDA34C6
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti88 – 881N → D AA sequence (PubMed:2466833)Curated
    Sequence conflicti260 – 2601K → I AA sequence (PubMed:2466833)Curated
    Sequence conflicti274 – 2741D → A in BAA06801. (PubMed:7876137)Curated
    Sequence conflicti284 – 2841Q → G AA sequence (PubMed:2466833)Curated
    Sequence conflicti2709 – 27135IKAEA → EFREV in AAA36437. (PubMed:2820964)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti300 – 3001S → L.
    Corresponds to variant rs2652098 [ dbSNP | Ensembl ].
    VAR_021958
    Natural varianti428 – 4281G → D.
    Corresponds to variant rs2287926 [ dbSNP | Ensembl ].
    VAR_020214
    Natural varianti1516 – 15161K → R.
    Corresponds to variant rs309559 [ dbSNP | Ensembl ].
    VAR_021959
    Natural varianti1826 – 18261R → H.
    Corresponds to variant rs188703 [ dbSNP | Ensembl ].
    VAR_031632
    Natural varianti2301 – 23011F → Y.
    Corresponds to variant rs160278 [ dbSNP | Ensembl ].
    VAR_020215
    Natural varianti2315 – 23151V → L.
    Corresponds to variant rs3734094 [ dbSNP | Ensembl ].
    VAR_020216
    Natural varianti2937 – 29371D → Y.
    Corresponds to variant rs160277 [ dbSNP | Ensembl ].
    VAR_021960
    Natural varianti3011 – 30111N → K.
    Corresponds to variant rs16900532 [ dbSNP | Ensembl ].
    VAR_031633

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei348 – 3481P → R in isoform V1 and isoform V3. 3 PublicationsVSP_003082
    Alternative sequencei349 – 30892741Missing in isoform V3. 1 PublicationVSP_003085Add
    BLAST
    Alternative sequencei349 – 1335987Missing in isoform V1. 2 PublicationsVSP_003083Add
    BLAST
    Alternative sequencei1336 – 30891754Missing in isoform V2. 1 PublicationVSP_003084Add
    BLAST
    Alternative sequencei3355 – 339642PSAYQ…QESRR → RKWSFRKNGLPCYNNY in isoform Vint. 1 PublicationVSP_003086Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X15998 mRNA. Translation: CAA34128.1.
    U16306 mRNA. Translation: AAA65018.1.
    U26555 mRNA. Translation: AAA67565.1.
    D32039 mRNA. Translation: BAA06801.1.
    S52488 Genomic DNA. Translation: AAB24878.1.
    J02814 mRNA. Translation: AAA36437.1.
    AF084545 mRNA. Translation: AAD48545.1.
    CCDSiCCDS4060.1. [P13611-1]
    CCDS47242.1. [P13611-4]
    CCDS54875.1. [P13611-3]
    CCDS54876.1. [P13611-2]
    PIRiS06014. A60979.
    RefSeqiNP_001119808.1. NM_001126336.2. [P13611-4]
    NP_001157569.1. NM_001164097.1. [P13611-2]
    NP_001157570.1. NM_001164098.1. [P13611-3]
    NP_004376.2. NM_004385.4. [P13611-1]
    UniGeneiHs.643801.

    Genome annotation databases

    EnsembliENST00000265077; ENSP00000265077; ENSG00000038427. [P13611-1]
    ENST00000342785; ENSP00000342768; ENSG00000038427. [P13611-3]
    ENST00000343200; ENSP00000340062; ENSG00000038427. [P13611-2]
    ENST00000502527; ENSP00000421362; ENSG00000038427. [P13611-4]
    GeneIDi1462.
    KEGGihsa:1462.
    UCSCiuc003kii.3. human. [P13611-1]
    uc003kij.3. human. [P13611-2]
    uc003kik.3. human. [P13611-4]
    uc010jau.2. human. [P13611-3]

    Polymorphism databases

    DMDMi2506816.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Functional Glycomics Gateway - Glycan Binding

    Versican

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X15998 mRNA. Translation: CAA34128.1 .
    U16306 mRNA. Translation: AAA65018.1 .
    U26555 mRNA. Translation: AAA67565.1 .
    D32039 mRNA. Translation: BAA06801.1 .
    S52488 Genomic DNA. Translation: AAB24878.1 .
    J02814 mRNA. Translation: AAA36437.1 .
    AF084545 mRNA. Translation: AAD48545.1 .
    CCDSi CCDS4060.1. [P13611-1 ]
    CCDS47242.1. [P13611-4 ]
    CCDS54875.1. [P13611-3 ]
    CCDS54876.1. [P13611-2 ]
    PIRi S06014. A60979.
    RefSeqi NP_001119808.1. NM_001126336.2. [P13611-4 ]
    NP_001157569.1. NM_001164097.1. [P13611-2 ]
    NP_001157570.1. NM_001164098.1. [P13611-3 ]
    NP_004376.2. NM_004385.4. [P13611-1 ]
    UniGenei Hs.643801.

    3D structure databases

    ProteinModelPortali P13611.
    SMRi P13611. Positions 23-247, 260-348, 3047-3292.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107844. 16 interactions.
    IntActi P13611. 5 interactions.
    MINTi MINT-4529155.
    STRINGi 9606.ENSP00000265077.

    PTM databases

    PhosphoSitei P13611.

    Polymorphism databases

    DMDMi 2506816.

    Proteomic databases

    MaxQBi P13611.
    PaxDbi P13611.
    PRIDEi P13611.

    Protocols and materials databases

    DNASUi 1462.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000265077 ; ENSP00000265077 ; ENSG00000038427 . [P13611-1 ]
    ENST00000342785 ; ENSP00000342768 ; ENSG00000038427 . [P13611-3 ]
    ENST00000343200 ; ENSP00000340062 ; ENSG00000038427 . [P13611-2 ]
    ENST00000502527 ; ENSP00000421362 ; ENSG00000038427 . [P13611-4 ]
    GeneIDi 1462.
    KEGGi hsa:1462.
    UCSCi uc003kii.3. human. [P13611-1 ]
    uc003kij.3. human. [P13611-2 ]
    uc003kik.3. human. [P13611-4 ]
    uc010jau.2. human. [P13611-3 ]

    Organism-specific databases

    CTDi 1462.
    GeneCardsi GC05P082804.
    GeneReviewsi VCAN.
    HGNCi HGNC:2464. VCAN.
    HPAi CAB008979.
    HPA004726.
    MIMi 118661. gene.
    143200. phenotype.
    neXtProti NX_P13611.
    Orphaneti 898. Wagner disease.
    PharmGKBi PA162408788.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG12793.
    HOVERGENi HBG051140.
    InParanoidi P13611.
    KOi K06793.
    OMAi TQEEFPW.
    OrthoDBi EOG7J70DP.
    PhylomeDBi P13611.
    TreeFami TF332134.

    Enzyme and pathway databases

    Reactomei REACT_120800. Dermatan sulfate biosynthesis.
    REACT_120888. CS/DS degradation.
    REACT_120989. Chondroitin sulfate biosynthesis.
    REACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.
    REACT_163906. ECM proteoglycans.

    Miscellaneous databases

    ChiTaRSi VCAN. human.
    GeneWikii Versican.
    GenomeRNAii 1462.
    NextBioi 6005.
    PMAP-CutDB P13611.
    PROi P13611.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P13611.
    Bgeei P13611.
    CleanExi HS_VCAN.
    Genevestigatori P13611.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    3.10.100.10. 3 hits.
    InterProi IPR001304. C-type_lectin.
    IPR016186. C-type_lectin-like.
    IPR018378. C-type_lectin_CS.
    IPR016187. C-type_lectin_fold.
    IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    IPR000538. Link.
    IPR000436. Sushi_SCR_CCP.
    [Graphical view ]
    Pfami PF00008. EGF. 2 hits.
    PF00059. Lectin_C. 1 hit.
    PF00084. Sushi. 1 hit.
    PF07686. V-set. 1 hit.
    PF00193. Xlink. 2 hits.
    [Graphical view ]
    PRINTSi PR01265. LINKMODULE.
    SMARTi SM00032. CCP. 1 hit.
    SM00034. CLECT. 1 hit.
    SM00181. EGF. 1 hit.
    SM00179. EGF_CA. 1 hit.
    SM00409. IG. 1 hit.
    SM00445. LINK. 2 hits.
    [Graphical view ]
    SUPFAMi SSF56436. SSF56436. 3 hits.
    SSF57535. SSF57535. 1 hit.
    PROSITEi PS00010. ASX_HYDROXYL. 1 hit.
    PS00615. C_TYPE_LECTIN_1. 1 hit.
    PS50041. C_TYPE_LECTIN_2. 1 hit.
    PS00022. EGF_1. 2 hits.
    PS01186. EGF_2. 1 hit.
    PS50026. EGF_3. 2 hits.
    PS01187. EGF_CA. 1 hit.
    PS50835. IG_LIKE. 1 hit.
    PS01241. LINK_1. 2 hits.
    PS50963. LINK_2. 2 hits.
    PS50923. SUSHI. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Multiple domains of the large fibroblast proteoglycan, versican."
      Zimmermann D.R., Ruoslahti E.
      EMBO J. 8:2975-2981(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V1).
      Tissue: Placenta.
    2. "A novel glycosaminoglycan attachment domain identified in two alternative splice variants of human versican."
      Dours-Zimmermann M.T., Zimmermann D.R.
      J. Biol. Chem. 269:32992-32998(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V2).
      Tissue: Glial tumor.
    3. "Characterization of the complete genomic structure of the human versican gene and functional analysis of its promoter."
      Naso M.F., Zimmermann D.R., Iozzo R.V.
      J. Biol. Chem. 269:32999-33008(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM V0).
    4. "Expression of PG-M(V3), an alternatively spliced form of PG-M without a chondroitin sulfate attachment in region in mouse and human tissues."
      Zako M., Shinomura T., Ujita M., Ito K., Kimata K.
      J. Biol. Chem. 270:3914-3918(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM V3).
      Tissue: Brain.
    5. "Identification of the proteoglycan versican in aorta and smooth muscle cells by DNA sequence analysis, in situ hybridization and immunohistochemistry."
      Yao L.Y., Moody C., Schoenherr E., Wight T.N., Sandell L.J.
      Matrix Biol. 14:213-225(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 208-1427; 2081-2372 AND 2897-3233 (ISOFORM V1).
    6. "Mapping of the versican proteoglycan gene (CSPG2) to the long arm of human chromosome 5 (5q12-5q14)."
      Iozzo R.V., Naso M.F., Cannizzaro L.A., Wasmuth J.J., McPherson J.D.
      Genomics 14:845-851(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 251-347.
    7. "A fibroblast chondroitin sulfate proteoglycan core protein contains lectin-like and growth factor-like sequences."
      Krusius T., Gehlsen K.R., Ruoslahti E.
      J. Biol. Chem. 262:13120-13125(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2709-3396.
      Tissue: Lung fibroblast.
    8. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 3333-3396 (ISOFORM VINT).
      Tissue: Aortic smooth muscle.
    9. "Isolation of a large aggregating proteoglycan from human brain."
      Perides G., Rahemtulla F., Lane W.S., Asher R.A., Bignami A.
      J. Biol. Chem. 267:23883-23887(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 21-37.
    10. "Isolation and partial characterization of a glial hyaluronate-binding protein."
      Perides G., Lane W.S., Andrews D., Dahl D., Bignami A.
      J. Biol. Chem. 264:5981-5987(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 24-50; 80-119; 128-155; 167-218; 229-268 AND 277-290.
      Tissue: Brain.
    11. "Structural similarity of hyaluronate binding proteins in brain and cartilage."
      Bignami A., Lane W.S., Andrews D., Dahl D.
      Brain Res. Bull. 22:67-70(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 171-210 AND 289-303.
    12. "Differential expression of versican isoforms in brain tumors."
      Paulus W., Baur I., Dours-Zimmermann M.T., Zimmermann D.R.
      J. Neuropathol. Exp. Neurol. 55:528-533(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY (ISOFORMS V0; V1; V2 AND V3).
    13. "Identification of a novel splice site mutation of the CSPG2 gene in a Japanese family with Wagner syndrome."
      Miyamoto T., Inoue H., Sakamoto Y., Kudo E., Naito T., Mikawa T., Mikawa Y., Isashiki Y., Osabe D., Shinohara S., Shiota H., Itakura M.
      Invest. Ophthalmol. Vis. Sci. 46:2726-2735(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN WGVRP.
    14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    15. "Novel VCAN mutations and evidence for unbalanced alternative splicing in the pathogenesis of Wagner syndrome."
      Kloeckener-Gruissem B., Neidhardt J., Magyar I., Plauchu H., Zech J.C., Morle L., Palmer-Smith S.M., Macdonald M.J., Nas V., Fry A.E., Berger W.
      Eur. J. Hum. Genet. 21:352-356(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN WGVRP, PATHOLOGICAL MECHANISM.

    Entry informationi

    Entry nameiCSPG2_HUMAN
    AccessioniPrimary (citable) accession number: P13611
    Secondary accession number(s): P20754
    , Q13010, Q13189, Q15123, Q9UCL9, Q9UNW5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 1, 1990
    Last sequence update: November 1, 1997
    Last modified: October 1, 2014
    This is version 177 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3