P13607 (ATNA_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 145.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sodium/potassium-transporting ATPase subunit alpha Short name=Na(+)/K(+) ATPase alpha subunit EC=3.6.3.9 Alternative name(s): Sodium pump subunit alpha | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 1041 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients. Ref.1 Ref.2 Ref.6 |
| Catalytic activity | ATP + H2O + Na+(In) + K+(Out) = ADP + phosphate + Na+(Out) + K+(In). |
| Subunit structure | Composed of three subunits: alpha (catalytic), beta and gamma. |
| Subcellular location | |
| Tissue specificity | High levels are found in some adult tissues: Malpighian tubules, indirect flight muscles, tubular leg muscles and throughout the nervous system (brain, optic lobes, retina and ventral thoracic neuromere). Lower levels are detected at the posterior end where the reproductive organs and rectum are located. Ref.1 Ref.2 |
| Miscellaneous | Ouabain-sensitive electrogenic ion pump. |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIC subfamily. [View classification] |
| RNA editing | Edited at position 429. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] Note: Exon 6 has 4 mutually exclusive forms (6a, 6b, 6c and 6d). Additional isoforms may exist. | ||||||
| Isoform 1 (identifier: P13607-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P13607-2) Also known as: B; C; E; The sequence of this isoform differs from the canonical sequence as follows: 1-39: Missing. | ||||||
| Isoform 3 (identifier: P13607-3) Also known as: D; The sequence of this isoform differs from the canonical sequence as follows: 1-39: Missing. 836-878: PAISLAYEHA...SMAYGQIGMI → SLDLCPKPKL...CSPSQLIVKN 879-1041: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: P13607-4) The sequence of this isoform differs from the canonical sequence as follows: 1-8: MALRSDYE → MSAQ | ||||||
| Isoform 5 (identifier: P13607-5) The sequence of this isoform differs from the canonical sequence as follows: 835-865: VPAISLAYEHAEADIMKRPPRDPFNDKLVNS → IPAISLAYEGPEADIMKRRPRNPEIDNLVNE | ||||||
| Isoform 6 (identifier: P13607-6) Also known as: F; H; The sequence of this isoform differs from the canonical sequence as follows: 1-39: Missing. 844-865: HAEADIMKRPPRDPFNDKLVNS → TAESDIMKRQPRNPFQDKLVNE | ||||||
| Isoform 7 (identifier: P13607-7) Also known as: G; The sequence of this isoform differs from the canonical sequence as follows: 1-39: Missing. 835-865: VPAISLAYEHAEADIMKRPPRDPFNDKLVNS → IPAISLAYEQAESDIMKRQPRDPYRDNLVNR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1041 | 1041 | Sodium/potassium-transporting ATPase subunit alpha | PRO_0000046309 | |||||
Regions | |||||||||
| Transmembrane | 115 – 135 | 21 | Helical; Potential | ||||||
| Transmembrane | 147 – 167 | 21 | Helical; Potential | ||||||
| Transmembrane | 312 – 332 | 21 | Helical; Potential | ||||||
| Transmembrane | 338 – 358 | 21 | Helical; Potential | ||||||
| Transmembrane | 808 – 828 | 21 | Helical; Potential | ||||||
| Transmembrane | 870 – 890 | 21 | Helical; Potential | ||||||
| Transmembrane | 935 – 955 | 21 | Helical; Potential | ||||||
| Transmembrane | 970 – 990 | 21 | Helical; Potential | ||||||
Sites | |||||||||
| Active site | 394 | 1 | 4-aspartylphosphate intermediate Probable | ||||||
| Binding site | 526 | 1 | ATP By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 39 | 39 | Missing in isoform 2, isoform 3, isoform 6 and isoform 7. | VSP_000417 | |||||
| Alternative sequence | 1 – 8 | 8 | MALRSDYE → MSAQ in isoform 4. | VSP_008074 | |||||
| Alternative sequence | 835 – 865 | 31 | VPAIS…KLVNS → IPAISLAYEGPEADIMKRRP RNPEIDNLVNE in isoform 5. | VSP_008075 | |||||
| Alternative sequence | 835 – 865 | 31 | VPAIS…KLVNS → IPAISLAYEQAESDIMKRQP RDPYRDNLVNR in isoform 7. | VSP_008076 | |||||
| Alternative sequence | 836 – 878 | 43 | PAISL…QIGMI → SLDLCPKPKLHRRLKLKLLL SQYHSSKLYSYTSCSPSQLI VKN in isoform 3. | VSP_008077 | |||||
| Alternative sequence | 844 – 865 | 22 | HAEAD…KLVNS → TAESDIMKRQPRNPFQDKLV NE in isoform 6. | VSP_000418 | |||||
| Alternative sequence | 879 – 1041 | 163 | Missing in isoform 3. | VSP_008078 | |||||
| Natural variant | 429 | 1 | Y → C in RNA edited version. | ||||||
Experimental info | |||||||||
| Mutagenesis | 1020 | 1 | D → N in allele ATP-alpha-dts2; homozygous lethal and temperature dependent bang sensitive paralysis, shortened life span and neurodegeneration when heterozygous. Ref.6 | ||||||
| Mutagenesis | 1021 | 1 | E → K in allele ATP-alpha-dts1; homozygous lethal and temperature dependent bang sensitive paralysis, shortened life span and neurodegeneration when heterozygous. Ref.6 | ||||||
| Sequence conflict | 69 | 1 | L → M in CAA32638. Ref.1 | ||||||
| Sequence conflict | 85 | 1 | K → R in CAA32638. Ref.1 | ||||||
| Sequence conflict | 97 | 1 | Missing in CAA32638. Ref.1 | ||||||
| Sequence conflict | 112 – 113 | 2 | KN → ED in CAA32638. Ref.1 | ||||||
| Sequence conflict | 117 – 118 | 2 | GF → V in CAA32638. Ref.1 | ||||||
| Sequence conflict | 163 | 1 | I → V in CAA32638. Ref.1 | ||||||
| Sequence conflict | 192 | 1 | E → G in AAC05260. Ref.2 | ||||||
| Sequence conflict | 196 – 197 | 2 | LT → PS in CAA32638. Ref.1 | ||||||
| Sequence conflict | 207 – 208 | 2 | DV → VL in CAA32638. Ref.1 | ||||||
| Sequence conflict | 211 – 212 | 2 | VK → LE in CAA32638. Ref.1 | ||||||
| Sequence conflict | 216 – 221 | 6 | RIPADI → LIPLVY in CAA32638. Ref.1 | ||||||
| Sequence conflict | 228 | 1 | N → D in CAA32638. Ref.1 | ||||||
| Sequence conflict | 270 – 272 | 3 | GTA → ALP in CAA32638. Ref.1 | ||||||
| Sequence conflict | 290 | 1 | G → A in CAA32638. Ref.1 | ||||||
| Sequence conflict | 299 | 1 | Missing in CAA32638. Ref.1 | ||||||
| Sequence conflict | 402 | 1 | N → T in CAA35504. Ref.8 | ||||||
| Sequence conflict | 488 | 1 | I → N in CAA35504. Ref.8 | ||||||
| Sequence conflict | 811 | 1 | F → S in CAA32638. Ref.1 | ||||||
| Sequence conflict | 843 | 1 | E → D in CAA32638. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular characterization and expression of the (Na+ + K+)-ATPase alpha-subunit in Drosophila melanogaster." Lebovitz R.M., Takeyasu K., Fambrough D.M. EMBO J. 8:193-202(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. Strain: Canton-S and Oregon-R. Tissue: Embryo, Head and Pupae. |
| [2] | "Functional analysis and tissue-specific expression of Drosophila Na+,K+-ATPase subunits." Sun B., Wang W., Salvaterra P.M. J. Neurochem. 71:142-151(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY. Tissue: Head. |
| [3] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [4] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [5] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), RNA EDITING OF POSITION 429. Strain: Berkeley. Tissue: Head. |
| [6] | "Neural dysfunction and neurodegeneration in Drosophila Na+/K+ ATPase alpha subunit mutants." Palladino M.J., Bower J.E., Kreber R., Ganetzky B. J. Neurosci. 23:1276-1286(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-35 (ISOFORM 4), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 835-865 (ISOFORMS 1; 5; 6 AND 7), FUNCTION, MUTAGENESIS OF ASP-1020 AND GLU-1021. |
| [7] | "The Drosophila Na,K-ATPase alpha-subunit gene: gene structure, promoter function and analysis of a cold-sensitive recessive-lethal mutation." Feng Y., Huynh L., Takeyasu K., Fambrough D.M. Genes Funct. 1:99-117(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-8. |
| [8] | "Amplification of the phosphorylation site-ATP-binding site cDNA fragment of the Na+,K(+)-ATPase and the Ca2(+)-ATPase of Drosophila melanogaster by polymerase chain reaction." Varadi A., Gilmore-Heber M., Benz E.J. Jr. FEBS Lett. 258:203-207(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 400-524. |
| [9] | "RNA editing in Drosophila melanogaster: new targets and functional consequences." Stapleton M., Carlson J.W., Celniker S.E. RNA 12:1922-1932(2006) [PubMed] [Europe PMC] [Abstract] Cited for: RNA EDITING OF POSITION 429. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X14476 mRNA. Translation: CAA32638.1. AF044974 mRNA. Translation: AAC05260.1. AE014297 Genomic DNA. Translation: AAF55825.3. AE014297 Genomic DNA. Translation: AAF55826.2. AE014297 Genomic DNA. Translation: AAF55828.1. AE014297 Genomic DNA. Translation: AAS65183.1. AE014297 Genomic DNA. Translation: AAS65184.1. AE014297 Genomic DNA. Translation: AAS65185.1. AE014297 Genomic DNA. Translation: AAS65186.1. AY069184 mRNA. Translation: AAL39329.1. AY174097 Genomic DNA. Translation: AAO33930.1. AY174097 Genomic DNA. Translation: AAO33931.1. AY174097 Genomic DNA. Translation: AAO33932.1. AY174097 Genomic DNA. Translation: AAO33933.1. AY174098 Genomic DNA. Translation: AAO33929.1. U55767 Genomic DNA. Translation: AAB01189.1. X17471 mRNA. Translation: CAA35504.1. |
| PIR | S03632. |
| RefSeq | NP_001262790.1. NM_001275861.1. NP_001262791.1. NM_001275862.1. NP_732572.1. NM_169936.2. NP_732573.1. NM_169937.2. NP_732574.1. NM_169938.2. NP_732575.1. NM_169939.2. NP_996247.1. NM_206525.2. NP_996248.1. NM_206526.2. NP_996249.1. NM_206527.2. NP_996250.1. NM_206528.2. |
| UniGene | Dm.6725. |
3D structure databases | |
| ProteinModelPortal | P13607. |
| SMR | P13607. Positions 50-1041. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-19649N. |
| IntAct | P13607. 2 interactions. |
| MINT | MINT-284024. |
| STRING | 7227.FBpp0088502. |
Proteomic databases | |
| PaxDb | P13607. |
| PRIDE | P13607. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0089510; FBpp0088502; FBgn0002921. |
| GeneID | 48971. |
| KEGG | dme:Dmel_CG5670. |
Organism-specific databases | |
| CTD | 48971. |
| FlyBase | FBgn0002921. Atpalpha. |
Phylogenomic databases | |
| eggNOG | COG0474. |
| GeneTree | ENSGT00560000076887. |
| InParanoid | P13607. |
| KO | K01539. |
| OMA | FQTHPEN. |
| OrthoDB | EOG4QZ61S. |
| PhylomeDB | P13607. |
Gene expression databases | |
| Bgee | P13607. |
| GermOnline | CG5670. Drosophila melanogaster. |
Family and domain databases | |
| Gene3D | 1.20.1110.10. 2 hits. 2.70.150.10. 2 hits. 3.40.1110.10. 1 hit. |
| InterPro | IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR023299. ATPase_P-typ_cyto_domN. IPR005775. ATPase_P-typ_Na/K_IIC. IPR018303. ATPase_P-typ_P_site. IPR023298. ATPase_P-typ_TM_dom. IPR008250. ATPase_P-typ_transduc_dom_A. IPR001757. Cation_transp_P_typ_ATPase. IPR023214. HAD-like_dom. [Graphical view] |
| PANTHER | PTHR24093. PTHR24093. 1 hit. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| SUPFAM | SSF81660. ATPase_cation_domN. 1 hit. SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR01106. ATPase-IIC_X-K. 1 hit. TIGR01494. ATPase_P-type. 2 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | Atpalpha. drosophila. |
| GenomeRNAi | 48971. |
| NextBio | 839577. |
Entry information
| Entry name | ATNA_DROME | ||||||||
| Accession | Primary (citable) accession number: P13607 Secondary accession number(s): A4V366 Q9VDG8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
