SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P13607

- ATNA_DROME

UniProt

P13607 - ATNA_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Sodium/potassium-transporting ATPase subunit alpha
Gene
Atpalpha, Na-p, CG5670
Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients.3 Publications

Catalytic activityi

ATP + H2O + Na+(In) + K+(Out) = ADP + phosphate + Na+(Out) + K+(In).

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei394 – 39414-aspartylphosphate intermediate Inferred
Binding sitei526 – 5261ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. metal ion binding Source: InterPro
  3. sodium:potassium-exchanging ATPase activity Source: FlyBase

GO - Biological processi

  1. ATP biosynthetic process Source: InterPro
  2. adult locomotory behavior Source: FlyBase
  3. cation transport Source: FlyBase
  4. determination of adult lifespan Source: FlyBase
  5. embryonic development via the syncytial blastoderm Source: FlyBase
  6. jump response Source: FlyBase
  7. locomotory behavior Source: FlyBase
  8. neuromuscular process Source: FlyBase
  9. regulation of cell shape Source: FlyBase
  10. regulation of tube architecture, open tracheal system Source: FlyBase
  11. regulation of tube diameter, open tracheal system Source: FlyBase
  12. regulation of tube length, open tracheal system Source: FlyBase
  13. response to mechanical stimulus Source: FlyBase
  14. response to temperature stimulus Source: FlyBase
  15. sensory perception of sound Source: FlyBase
  16. septate junction assembly Source: FlyBase
  17. sodium ion transmembrane transport Source: GOC
  18. synaptic growth at neuromuscular junction Source: FlyBase
  19. synaptic transmission Source: FlyBase
  20. tissue homeostasis Source: FlyBase
  21. trachea morphogenesis Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Ion transport, Potassium transport, Sodium transport, Sodium/potassium transport, Transport

Keywords - Ligandi

ATP-binding, Nucleotide-binding, Potassium, Sodium

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/potassium-transporting ATPase subunit alpha (EC:3.6.3.9)
Short name:
Na(+)/K(+) ATPase alpha subunit
Alternative name(s):
Sodium pump subunit alpha
Gene namesi
Name:Atpalpha
Synonyms:Na-p
ORF Names:CG5670
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome 3R

Organism-specific databases

FlyBaseiFBgn0002921. Atpalpha.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei115 – 13521Helical; Reviewed prediction
Add
BLAST
Transmembranei147 – 16721Helical; Reviewed prediction
Add
BLAST
Transmembranei312 – 33221Helical; Reviewed prediction
Add
BLAST
Transmembranei338 – 35821Helical; Reviewed prediction
Add
BLAST
Transmembranei808 – 82821Helical; Reviewed prediction
Add
BLAST
Transmembranei870 – 89021Helical; Reviewed prediction
Add
BLAST
Transmembranei935 – 95521Helical; Reviewed prediction
Add
BLAST
Transmembranei970 – 99021Helical; Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. basolateral plasma membrane Source: FlyBase
  2. nucleus Source: FlyBase
  3. plasma membrane Source: FlyBase
  4. septate junction Source: FlyBase
  5. sodium:potassium-exchanging ATPase complex Source: FlyBase
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1020 – 10201D → N in allele ATP-alpha-dts2; homozygous lethal and temperature dependent bang sensitive paralysis, shortened life span and neurodegeneration when heterozygous. 1 Publication
Mutagenesisi1021 – 10211E → K in allele ATP-alpha-dts1; homozygous lethal and temperature dependent bang sensitive paralysis, shortened life span and neurodegeneration when heterozygous. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10411041Sodium/potassium-transporting ATPase subunit alpha
PRO_0000046309Add
BLAST

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP13607.
PRIDEiP13607.

Expressioni

Tissue specificityi

High levels are found in some adult tissues: Malpighian tubules, indirect flight muscles, tubular leg muscles and throughout the nervous system (brain, optic lobes, retina and ventral thoracic neuromere). Lower levels are detected at the posterior end where the reproductive organs and rectum are located.2 Publications

Gene expression databases

BgeeiP13607.

Interactioni

Subunit structurei

Composed of three subunits: alpha (catalytic), beta and gamma.

Protein-protein interaction databases

BioGridi71866. 51 interactions.
DIPiDIP-19649N.
IntActiP13607. 2 interactions.
STRINGi7227.FBpp0088502.

Structurei

3D structure databases

ProteinModelPortaliP13607.
SMRiP13607. Positions 49-1041.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0474.
GeneTreeiENSGT00560000076866.
InParanoidiP13607.
KOiK01539.
OMAiFQTHPEN.
OrthoDBiEOG7327N0.
PhylomeDBiP13607.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR005775. ATPase_P-typ_Na/K_IIC.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view]
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 3 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01106. ATPase-IIC_X-K. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Note: Exon 6 has 4 mutually exclusive forms (6a, 6b, 6c and 6d). Additional isoforms may exist.

Isoform 1 (identifier: P13607-1) [UniParc]FASTAAdd to Basket

Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MALRSDYEHG RADSYRVATV IATDDDNRTA DGQYKSRRKM PAKVNKKENL     50
DDLKQELDID FHKISPEELY QRFQTHPENG LSHAKAKENL ERDGPNALTP 100
PKQTPEWVKF CKNLFGGFAM LLWIGAILCF VAYSIQASTS EEPADDNLYL 150
GIVLSAVVIV TGIFSYYQES KSSKIMESFK NMVPQFATVI REGEKLTLRA 200
EDLVLGDVVE VKFGDRIPAD IRIIEARNFK VDNSSLTGES EPQSRGAEFT 250
HENPLETKNL AFFSTNAVEG TAKGVVISCG DHTVMGRIAG LASGLDTGET 300
PIAKEIHHFI HLITGVAVFL GVTFFVIAFI LGYHWLDAVI FLIGIIVANV 350
PEGLLATVTV CLTLTAKRMA SKNCLVKNLE AVETLGSTST ICSDKTGTLT 400
QNRMTVAHMW FDNQIIEADT TEDQSGVQYD RTSPGFKALS RIATLCNRAE 450
FKGGQDGVPI LKKEVSGDAS EAALLKCMEL ALGDVMNIRK RNKKIAEVPF 500
NSTNKYQVSI HETEDTNDPR YLLVMKGAPE RILERCSTIF INGKEKVLDE 550
EMKEAFNNAY MELGGLGERV LGFCDFMLPS DKYPNGFKFN TDDINFPIDN 600
LRFVGLMSMI DPPRAAVPDA VAKCRSAGIK VIMVTGDHPI TAKAIAKSVG 650
IISEGNETVE DIAQRLNIPV SEVNPREAKA AVVHGAELRD VSSDQLDEIL 700
RYHTEIVFAR TSPQQKLIIV EGCQRMGAIV AVTGDGVNDS PALKKADIGV 750
AMGIAGSDVS KQAADMILLD DNFASIVTGV EEGRLIFDNL KKSIAYTLTS 800
NIPEISPFLA FILCDIPLPL GTVTILCIDL GTDMVPAISL AYEHAEADIM 850
KRPPRDPFND KLVNSRLISM AYGQIGMIQA AAGFFVYFVI MAENGFLPKK 900
LFGIRKMWDS KAVNDLTDSY GQEWTYRDRK TLEYTCHTAF FISIVVVQWA 950
DLIICKTRRN SIFQQGMRNW ALNFGLVFET VLAAFLSYCP GMEKGLRMYP 1000
LKLVWWFPAI PFALAIFIYD ETRRFYLRRN PGGWLEQETY Y 1041
Length:1,041
Mass (Da):115,605
Last modified:June 20, 2001 - v3
Checksum:iB2DD36B2E9029F43
GO
Isoform 2 (identifier: P13607-2) [UniParc]FASTAAdd to Basket

Also known as: B, C, E

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.

Show »
Length:1,002
Mass (Da):111,133
Checksum:iCA77B36B10EB23E2
GO
Isoform 3 (identifier: P13607-3) [UniParc]FASTAAdd to Basket

Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     836-878: PAISLAYEHA...SMAYGQIGMI → SLDLCPKPKL...CSPSQLIVKN
     879-1041: Missing.

Note: No experimental confirmation available.

Show »
Length:839
Mass (Da):91,981
Checksum:iD8D38F5B5BE2CD37
GO
Isoform 4 (identifier: P13607-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-8: MALRSDYE → MSAQ

Show »
Length:1,037
Mass (Da):115,056
Checksum:i62722EDBA74BBC88
GO
Isoform 5 (identifier: P13607-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     835-865: VPAISLAYEHAEADIMKRPPRDPFNDKLVNS → IPAISLAYEGPEADIMKRRPRNPEIDNLVNE

Show »
Length:1,041
Mass (Da):115,632
Checksum:iD6084967A87F4FAD
GO
Isoform 6 (identifier: P13607-6) [UniParc]FASTAAdd to Basket

Also known as: F, H

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     844-865: HAEADIMKRPPRDPFNDKLVNS → TAESDIMKRQPRNPFQDKLVNE

Show »
Length:1,002
Mass (Da):111,199
Checksum:i4146F52C60C4114A
GO
Isoform 7 (identifier: P13607-7) [UniParc]FASTAAdd to Basket

Also known as: G

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     835-865: VPAISLAYEHAEADIMKRPPRDPFNDKLVNS → IPAISLAYEQAESDIMKRQPRDPYRDNLVNR

Show »
Length:1,002
Mass (Da):111,298
Checksum:i9762610EA4A85D45
GO

RNA editingi

Partially edited. Target of Adar.2 Publications

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti429 – 4291Y → C in RNA edited version.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3939Missing in isoform 2, isoform 3, isoform 6 and isoform 7.
VSP_000417Add
BLAST
Alternative sequencei1 – 88MALRSDYE → MSAQ in isoform 4.
VSP_008074
Alternative sequencei835 – 86531VPAIS…KLVNS → IPAISLAYEGPEADIMKRRP RNPEIDNLVNE in isoform 5.
VSP_008075Add
BLAST
Alternative sequencei835 – 86531VPAIS…KLVNS → IPAISLAYEQAESDIMKRQP RDPYRDNLVNR in isoform 7.
VSP_008076Add
BLAST
Alternative sequencei836 – 87843PAISL…QIGMI → SLDLCPKPKLHRRLKLKLLL SQYHSSKLYSYTSCSPSQLI VKN in isoform 3.
VSP_008077Add
BLAST
Alternative sequencei844 – 86522HAEAD…KLVNS → TAESDIMKRQPRNPFQDKLV NE in isoform 6.
VSP_000418Add
BLAST
Alternative sequencei879 – 1041163Missing in isoform 3.
VSP_008078Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti69 – 691L → M in CAA32638. 1 Publication
Sequence conflicti85 – 851K → R in CAA32638. 1 Publication
Sequence conflicti97 – 971Missing in CAA32638. 1 Publication
Sequence conflicti112 – 1132KN → ED in CAA32638. 1 Publication
Sequence conflicti117 – 1182GF → V in CAA32638. 1 Publication
Sequence conflicti163 – 1631I → V in CAA32638. 1 Publication
Sequence conflicti192 – 1921E → G in AAC05260. 1 Publication
Sequence conflicti196 – 1972LT → PS in CAA32638. 1 Publication
Sequence conflicti207 – 2082DV → VL in CAA32638. 1 Publication
Sequence conflicti211 – 2122VK → LE in CAA32638. 1 Publication
Sequence conflicti216 – 2216RIPADI → LIPLVY in CAA32638. 1 Publication
Sequence conflicti228 – 2281N → D in CAA32638. 1 Publication
Sequence conflicti270 – 2723GTA → ALP in CAA32638. 1 Publication
Sequence conflicti290 – 2901G → A in CAA32638. 1 Publication
Sequence conflicti299 – 2991Missing in CAA32638. 1 Publication
Sequence conflicti402 – 4021N → T in CAA35504. 1 Publication
Sequence conflicti488 – 4881I → N in CAA35504. 1 Publication
Sequence conflicti811 – 8111F → S in CAA32638. 1 Publication
Sequence conflicti843 – 8431E → D in CAA32638. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X14476 mRNA. Translation: CAA32638.1.
AF044974 mRNA. Translation: AAC05260.1.
AE014297 Genomic DNA. Translation: AAF55825.3.
AE014297 Genomic DNA. Translation: AAF55826.2.
AE014297 Genomic DNA. Translation: AAF55828.1.
AE014297 Genomic DNA. Translation: AAS65183.1.
AE014297 Genomic DNA. Translation: AAS65184.1.
AE014297 Genomic DNA. Translation: AAS65185.1.
AE014297 Genomic DNA. Translation: AAS65186.1.
AY069184 mRNA. Translation: AAL39329.1.
AY174097 Genomic DNA. Translation: AAO33930.1.
AY174097 Genomic DNA. Translation: AAO33931.1.
AY174097 Genomic DNA. Translation: AAO33932.1.
AY174097 Genomic DNA. Translation: AAO33933.1.
AY174098 Genomic DNA. Translation: AAO33929.1.
U55767 Genomic DNA. Translation: AAB01189.1.
X17471 mRNA. Translation: CAA35504.1.
PIRiS03632.
RefSeqiNP_001262790.1. NM_001275861.1. [P13607-2]
NP_001262791.1. NM_001275862.1. [P13607-2]
NP_732572.1. NM_169936.2. [P13607-1]
NP_732573.1. NM_169937.2. [P13607-2]
NP_732574.1. NM_169938.2. [P13607-2]
NP_732575.1. NM_169939.2. [P13607-3]
NP_996247.1. NM_206525.2. [P13607-6]
NP_996248.1. NM_206526.2. [P13607-7]
NP_996249.1. NM_206527.2. [P13607-6]
NP_996250.1. NM_206528.2. [P13607-2]
UniGeneiDm.6725.

Genome annotation databases

EnsemblMetazoaiFBtr0089510; FBpp0088502; FBgn0002921. [P13607-1]
GeneIDi48971.
KEGGidme:Dmel_CG5670.

Keywords - Coding sequence diversityi

Alternative splicing, RNA editing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X14476 mRNA. Translation: CAA32638.1 .
AF044974 mRNA. Translation: AAC05260.1 .
AE014297 Genomic DNA. Translation: AAF55825.3 .
AE014297 Genomic DNA. Translation: AAF55826.2 .
AE014297 Genomic DNA. Translation: AAF55828.1 .
AE014297 Genomic DNA. Translation: AAS65183.1 .
AE014297 Genomic DNA. Translation: AAS65184.1 .
AE014297 Genomic DNA. Translation: AAS65185.1 .
AE014297 Genomic DNA. Translation: AAS65186.1 .
AY069184 mRNA. Translation: AAL39329.1 .
AY174097 Genomic DNA. Translation: AAO33930.1 .
AY174097 Genomic DNA. Translation: AAO33931.1 .
AY174097 Genomic DNA. Translation: AAO33932.1 .
AY174097 Genomic DNA. Translation: AAO33933.1 .
AY174098 Genomic DNA. Translation: AAO33929.1 .
U55767 Genomic DNA. Translation: AAB01189.1 .
X17471 mRNA. Translation: CAA35504.1 .
PIRi S03632.
RefSeqi NP_001262790.1. NM_001275861.1. [P13607-2 ]
NP_001262791.1. NM_001275862.1. [P13607-2 ]
NP_732572.1. NM_169936.2. [P13607-1 ]
NP_732573.1. NM_169937.2. [P13607-2 ]
NP_732574.1. NM_169938.2. [P13607-2 ]
NP_732575.1. NM_169939.2. [P13607-3 ]
NP_996247.1. NM_206525.2. [P13607-6 ]
NP_996248.1. NM_206526.2. [P13607-7 ]
NP_996249.1. NM_206527.2. [P13607-6 ]
NP_996250.1. NM_206528.2. [P13607-2 ]
UniGenei Dm.6725.

3D structure databases

ProteinModelPortali P13607.
SMRi P13607. Positions 49-1041.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 71866. 51 interactions.
DIPi DIP-19649N.
IntActi P13607. 2 interactions.
STRINGi 7227.FBpp0088502.

Proteomic databases

PaxDbi P13607.
PRIDEi P13607.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai FBtr0089510 ; FBpp0088502 ; FBgn0002921 . [P13607-1 ]
GeneIDi 48971.
KEGGi dme:Dmel_CG5670.

Organism-specific databases

CTDi 48971.
FlyBasei FBgn0002921. Atpalpha.

Phylogenomic databases

eggNOGi COG0474.
GeneTreei ENSGT00560000076866.
InParanoidi P13607.
KOi K01539.
OMAi FQTHPEN.
OrthoDBi EOG7327N0.
PhylomeDBi P13607.

Miscellaneous databases

ChiTaRSi Atpalpha. drosophila.
GenomeRNAii 48971.
NextBioi 839577.

Gene expression databases

Bgeei P13607.

Family and domain databases

Gene3Di 1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProi IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR005775. ATPase_P-typ_Na/K_IIC.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view ]
Pfami PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view ]
PRINTSi PR00119. CATATPASE.
SMARTi SM00831. Cation_ATPase_N. 1 hit.
[Graphical view ]
SUPFAMi SSF56784. SSF56784. 3 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsi TIGR01106. ATPase-IIC_X-K. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular characterization and expression of the (Na+ + K+)-ATPase alpha-subunit in Drosophila melanogaster."
    Lebovitz R.M., Takeyasu K., Fambrough D.M.
    EMBO J. 8:193-202(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
    Strain: Canton-S and Oregon-R.
    Tissue: Embryo, Head and Pupae.
  2. "Functional analysis and tissue-specific expression of Drosophila Na+,K+-ATPase subunits."
    Sun B., Wang W., Salvaterra P.M.
    J. Neurochem. 71:142-151(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Head.
  3. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), RNA EDITING OF POSITION 429.
    Strain: Berkeley.
    Tissue: Head.
  6. "Neural dysfunction and neurodegeneration in Drosophila Na+/K+ ATPase alpha subunit mutants."
    Palladino M.J., Bower J.E., Kreber R., Ganetzky B.
    J. Neurosci. 23:1276-1286(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-35 (ISOFORM 4), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 835-865 (ISOFORMS 1; 5; 6 AND 7), FUNCTION, MUTAGENESIS OF ASP-1020 AND GLU-1021.
  7. "The Drosophila Na,K-ATPase alpha-subunit gene: gene structure, promoter function and analysis of a cold-sensitive recessive-lethal mutation."
    Feng Y., Huynh L., Takeyasu K., Fambrough D.M.
    Genes Funct. 1:99-117(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-8.
  8. "Amplification of the phosphorylation site-ATP-binding site cDNA fragment of the Na+,K(+)-ATPase and the Ca2(+)-ATPase of Drosophila melanogaster by polymerase chain reaction."
    Varadi A., Gilmore-Heber M., Benz E.J. Jr.
    FEBS Lett. 258:203-207(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 400-524.
  9. "RNA editing in Drosophila melanogaster: new targets and functional consequences."
    Stapleton M., Carlson J.W., Celniker S.E.
    RNA 12:1922-1932(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: RNA EDITING OF POSITION 429.

Entry informationi

Entry nameiATNA_DROME
AccessioniPrimary (citable) accession number: P13607
Secondary accession number(s): A4V366
, A4V367, O61494, Q0KI37, Q7KS94, Q7KS95, Q86MY6, Q86MY7, Q86MY8, Q86MY9, Q86MZ0, Q8IN40, Q8T0L8, Q9VDG6, Q9VDG7, Q9VDG8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: June 20, 2001
Last modified: July 9, 2014
This is version 157 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Miscellaneous

Ouabain-sensitive electrogenic ion pump.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi