Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P13597 (ICAM1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 149. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Intercellular adhesion molecule 1

Short name=ICAM-1
Alternative name(s):
MALA-2
MyD10
CD_antigen=CD54
Gene names
Name:Icam1
Synonyms:Icam-1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length537 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation By similarity.

Subunit structure

Homodimer. Interacts with MUC1 and promotes cell aggregation in epithelial cells. Interacts with ARHGEF26/SGEF By similarity.

Subcellular location

Membrane; Single-pass type I membrane protein.

Tissue specificity

Expressed at low level on a subpopulation of lymphocytes, macrophages, and endothelial cells, but is strongly induced on these cells, and on fibroblasts and epithelial cells.

Post-translational modification

Monoubiquitinated, which is promoted by MARCH9 and leads to endocytosis By similarity.

Sequence similarities

Belongs to the immunoglobulin superfamily. ICAM family.

Contains 5 Ig-like C2-type (immunoglobulin-like) domains.

Ontologies

Keywords
   Biological processCell adhesion
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainImmunoglobulin domain
Repeat
Signal
Transmembrane
Transmembrane helix
   PTMDisulfide bond
Glycoprotein
Ubl conjugation
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell

Inferred from electronic annotation. Source: Ensembl

T cell antigen processing and presentation

Inferred from direct assay Ref.3. Source: MGI

adhesion to symbiont

Inferred from electronic annotation. Source: Ensembl

cell adhesion

Inferred from direct assay PubMed 10528208. Source: MGI

cell adhesion mediated by integrin

Inferred from direct assay PubMed 10601245. Source: MGI

cell aging

Inferred from electronic annotation. Source: Ensembl

cellular response to alkaloid

Inferred from electronic annotation. Source: Ensembl

cellular response to glucose stimulus

Inferred from direct assay PubMed 17670746. Source: MGI

cellular response to hypoxia

Inferred from electronic annotation. Source: Ensembl

cellular response to interleukin-1

Inferred from electronic annotation. Source: Ensembl

cellular response to lipopolysaccharide

Inferred from electronic annotation. Source: Ensembl

cellular response to nutrient levels

Inferred from electronic annotation. Source: Ensembl

cellular response to tumor necrosis factor

Inferred from electronic annotation. Source: Ensembl

leukocyte cell-cell adhesion

Inferred from mutant phenotype PubMed 8562500. Source: MGI

leukocyte migration

Inferred from electronic annotation. Source: Ensembl

membrane to membrane docking

Inferred from electronic annotation. Source: Ensembl

negative regulation of calcium ion transport

Inferred from electronic annotation. Source: Ensembl

ovarian follicle development

Inferred from electronic annotation. Source: Ensembl

positive regulation of NF-kappaB transcription factor activity

Inferred from electronic annotation. Source: Ensembl

positive regulation of Rho GTPase activity

Inferred from electronic annotation. Source: Ensembl

positive regulation of actin filament polymerization

Inferred from electronic annotation. Source: Ensembl

positive regulation of cellular extravasation

Inferred from electronic annotation. Source: Ensembl

positive regulation of nitric oxide biosynthetic process

Inferred from electronic annotation. Source: Ensembl

positive regulation of peptidyl-tyrosine phosphorylation

Inferred from electronic annotation. Source: Ensembl

positive regulation of vasoconstriction

Inferred from electronic annotation. Source: Ensembl

receptor-mediated virion attachment to host cell

Inferred from electronic annotation. Source: Ensembl

regulation of cell adhesion

Inferred from direct assay PubMed 15249579. Source: MGI

regulation of cell shape

Inferred from electronic annotation. Source: Ensembl

response to amino acid

Inferred from electronic annotation. Source: Ensembl

response to amphetamine

Inferred from electronic annotation. Source: Ensembl

response to copper ion

Inferred from electronic annotation. Source: Ensembl

response to drug

Inferred from electronic annotation. Source: Ensembl

response to ethanol

Inferred from electronic annotation. Source: Ensembl

response to gonadotropin

Inferred from electronic annotation. Source: Ensembl

response to ionizing radiation

Inferred from electronic annotation. Source: Ensembl

response to organic cyclic compound

Inferred from electronic annotation. Source: Ensembl

response to sulfur dioxide

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentexternal side of plasma membrane

Inferred from direct assay PubMed 16973387PubMed 18684012. Source: MGI

extracellular space

Inferred from electronic annotation. Source: Ensembl

immunological synapse

Inferred from direct assay PubMed 14973438. Source: MGI

integral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P13597-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P13597-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MASTRAKPTLPLLLALVTVVIPGPGDAQVSIHPR → MITHRHPVREKSINSYQFIKEKQFPAEN

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2727 By similarity
Chain28 – 537510Intercellular adhesion molecule 1
PRO_0000014785

Regions

Topological domain28 – 485458Extracellular Potential
Transmembrane486 – 50924Helical; Potential
Topological domain510 – 53728Cytoplasmic Potential
Domain41 – 10262Ig-like C2-type 1
Domain127 – 19569Ig-like C2-type 2
Domain232 – 29968Ig-like C2-type 3
Domain327 – 38155Ig-like C2-type 4
Domain415 – 46854Ig-like C2-type 5
Motif151 – 1533Cell attachment site; atypical Potential
Motif179 – 1813Cell attachment site Potential

Sites

Site4691Not glycosylated
Site4851Not glycosylated

Amino acid modifications

Glycosylation471N-linked (GlcNAc...) Ref.7
Glycosylation1851N-linked (GlcNAc...) Ref.7 Ref.8
Glycosylation2041N-linked (GlcNAc...) Ref.7 Ref.8
Glycosylation2671N-linked (GlcNAc...) Ref.7
Glycosylation3111N-linked (GlcNAc...) Ref.7
Glycosylation3621N-linked (GlcNAc...) Ref.7 Ref.8
Glycosylation3881N-linked (GlcNAc...) Ref.7 Ref.8
Glycosylation4091N-linked (GlcNAc...) Ref.7 Ref.8
Glycosylation4561N-linked (GlcNAc...) Ref.7
Glycosylation4691N-linked (GlcNAc...) Ref.7 Ref.8
Disulfide bond48 ↔ 91 By similarity
Disulfide bond52 ↔ 95 By similarity
Disulfide bond134 ↔ 188 By similarity
Disulfide bond239 ↔ 292 By similarity
Disulfide bond334 ↔ 374 By similarity
Disulfide bond422 ↔ 461 By similarity

Natural variations

Alternative sequence1 – 3434MASTR…SIHPR → MITHRHPVREKSINSYQFIK EKQFPAEN in isoform 2.
VSP_002518

Experimental info

Sequence conflict2431G → A in AAA37876. Ref.3
Sequence conflict3701R → A in CAA34621. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 1, 1990. Version 1.
Checksum: 6124167753774555

FASTA53758,844
        10         20         30         40         50         60 
MASTRAKPTL PLLLALVTVV IPGPGDAQVS IHPREAFLPQ GGSVQVNCSS SCKEDLSLGL 

        70         80         90        100        110        120 
ETQWLKDELE SGPNWKLFEL SEIGEDSSPL CFENCGTVQS SASATITVYS FPESVELRPL 

       130        140        150        160        170        180 
PAWQQVGKDL TLRCHVDGGA PRTQLSAVLL RGEEILSRQP VGGHPKDPKE ITFTVLASRG 

       190        200        210        220        230        240 
DHGANFSCRT ELDLRPQGLA LFSNVSEARS LRTFDLPATI PKLDTPDLLE VGTQQKLFCS 

       250        260        270        280        290        300 
LEGLFPASEA RIYLELGGQM PTQESTNSSD SVSATALVEV TEEFDRTLPL RCVLELADQI 

       310        320        330        340        350        360 
LETQRTLTVY NFSAPVLTLS QLEVSEGSQV TVKCEAHSGS KVVLLSGVEP RPPTPQVQFT 

       370        380        390        400        410        420 
LNASSEDHKR SFFCSAALEV AGKFLFKNQT LELHVLYGPR LDETDCLGNW TWQEGSQQTL 

       430        440        450        460        470        480 
KCQAWGNPSP KMTCRRKADG ALLPIGVVKS VKQEMNGTYV CHAFSSHGNV TRNVYLTVLY 

       490        500        510        520        530 
HSQNNWTIII LVPVLLVIVG LVMAASYVYN RQRKIRIYKL QKAQEEAIKL KGQAPPP 

« Hide

Isoform 2 [UniParc].

Checksum: 23B6CCDA9313761F
Show »

FASTA53158,753

References

« Hide 'large scale' references
[1]"Molecular cloning of murine intercellular adhesion molecule (ICAM-1)."
Horley K.J., Carpenito C., Baker B., Takei F.
EMBO J. 8:2889-2896(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE.
Strain: BALB/c.
Tissue: Myeloma.
[2]Takei F.
Submitted (APR-1990) to the EMBL/GenBank/DDBJ databases
Cited for: SEQUENCE REVISION.
[3]"Isolation of the murine intercellular adhesion molecule 1 (ICAM-1) gene. ICAM-1 enhances antigen-specific T cell activation."
Siu G., Hedrick S.M., Brian A.A.
J. Immunol. 143:3813-3820(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
[4]"Nucleotide sequence of the cDNA for murine intercellular adhesion molecule-1 (ICAM-1)."
Ballantyne C.M., O'Brien W.E., Beaudet A.L.
Nucleic Acids Res. 17:5853-5853(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Strain: C57BL/6 X CBA.
Tissue: Thymus.
[5]"Characterization of the murine Icam-1 gene."
Ballantyne C.M., Sligh J.E., Dai X.Y., Beaudet A.L.
Genomics 14:1076-1080(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Strain: NIH Swiss.
[6]"Complexity of the immediate early response of myeloid cells to terminal differentiation and growth arrest includes ICAM-1, Jun-B and histone variants."
Lord K.A., Hoffman-Liebermann B., Liebermann D.A.
Oncogene 5:387-396(1990) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 4-131.
[7]"N-glycan structures and N-glycosylation sites of mouse soluble intercellular adhesion molecule-1 revealed by MALDI-TOF and FTICR mass spectrometry."
Otto V.I., Damoc E., Cueni L.N., Schurpf T., Frei R., Ali S., Callewaert N., Moise A., Leary J.A., Folkers G., Przybylski M.
Glycobiology 16:1033-1044(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION AT ASN-47; ASN-185; ASN-204; ASN-267; ASN-311; ASN-362; ASN-388; ASN-409 AND ASN-456, ABSENCE OF GLYCOSYLATION AT ASN-469 AND ASN-485, IDENTIFICATION BY MASS SPECTROMETRY.
[8]"Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-185; ASN-204; ASN-362; ASN-388; ASN-409 AND ASN-469.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X16624 mRNA. Translation: CAA34621.1.
X16625 mRNA. Translation: CAA34622.1.
M31585 mRNA. Translation: AAA37876.1.
X52264 mRNA. Translation: CAA36507.1.
M90551 expand/collapse EMBL AC list , M90546, M90547, M90548, M90549, M90550 Genomic DNA. Translation: AAA37875.1.
X54331 mRNA. No translation available.
PIRA45815.
I49769.
S06016.
RefSeqNP_034623.1. NM_010493.2.
UniGeneMm.435508.

3D structure databases

ProteinModelPortalP13597.
SMRP13597. Positions 28-479.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

DIPDIP-29096N.
IntActP13597. 1 interaction.
MINTMINT-4098375.

PTM databases

PhosphoSiteP13597.

Proteomic databases

PaxDbP13597.
PRIDEP13597.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000086399; ENSMUSP00000083587; ENSMUSG00000037405. [P13597-1]
GeneID15894.
KEGGmmu:15894.
UCSCuc009ojx.1. mouse. [P13597-1]

Organism-specific databases

CTD3383.
MGIMGI:96392. Icam1.

Phylogenomic databases

eggNOGNOG146347.
HOGENOMHOG000059554.
HOVERGENHBG052074.
InParanoidP13597.
KOK06490.
OMARDCPGNW.
OrthoDBEOG7QG43X.
PhylomeDBP13597.
TreeFamTF333745.

Gene expression databases

ArrayExpressP13597.
BgeeP13597.
CleanExMM_ICAM1.
GenevestigatorP13597.

Family and domain databases

Gene3D2.60.40.10. 5 hits.
InterProIPR003988. ICAM.
IPR013768. ICAM_N.
IPR003987. ICAM_VCAM_N.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view]
PfamPF03921. ICAM_N. 1 hit.
[Graphical view]
PRINTSPR01473. ICAM.
PR01472. ICAMVCAM1.
SMARTSM00409. IG. 2 hits.
[Graphical view]
PROSITEPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio288604.
PROP13597.
SOURCESearch...

Entry information

Entry nameICAM1_MOUSE
AccessionPrimary (citable) accession number: P13597
Secondary accession number(s): Q61828
Entry history
Integrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: January 1, 1990
Last modified: April 16, 2014
This is version 149 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot