Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P13597

- ICAM1_MOUSE

UniProt

P13597 - ICAM1_MOUSE

Protein

Intercellular adhesion molecule 1

Gene

Icam1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 154 (01 Oct 2014)
      Sequence version 1 (01 Jan 1990)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei469 – 4691Not glycosylated
    Sitei485 – 4851Not glycosylated

    GO - Molecular functioni

    1. integrin binding Source: MGI

    GO - Biological processi

    1. cell adhesion Source: MGI
    2. cell adhesion mediated by integrin Source: MGI
    3. cell aging Source: Ensembl
    4. cellular response to alkaloid Source: Ensembl
    5. cellular response to glucose stimulus Source: MGI
    6. cellular response to hypoxia Source: Ensembl
    7. cellular response to interleukin-1 Source: Ensembl
    8. cellular response to lipopolysaccharide Source: Ensembl
    9. cellular response to nutrient levels Source: Ensembl
    10. cellular response to tumor necrosis factor Source: Ensembl
    11. leukocyte cell-cell adhesion Source: MGI
    12. leukocyte migration Source: Ensembl
    13. membrane to membrane docking Source: Ensembl
    14. negative regulation of calcium ion transport Source: Ensembl
    15. ovarian follicle development Source: Ensembl
    16. positive regulation of actin filament polymerization Source: Ensembl
    17. positive regulation of cellular extravasation Source: Ensembl
    18. positive regulation of NF-kappaB transcription factor activity Source: Ensembl
    19. positive regulation of nitric oxide biosynthetic process Source: Ensembl
    20. positive regulation of peptidyl-tyrosine phosphorylation Source: Ensembl
    21. positive regulation of Rho GTPase activity Source: Ensembl
    22. positive regulation of vasoconstriction Source: Ensembl
    23. receptor-mediated virion attachment to host cell Source: Ensembl
    24. regulation of cell adhesion Source: MGI
    25. regulation of cell shape Source: Ensembl
    26. regulation of ruffle assembly Source: MGI
    27. response to amino acid Source: Ensembl
    28. response to amphetamine Source: Ensembl
    29. response to copper ion Source: Ensembl
    30. response to drug Source: Ensembl
    31. response to ethanol Source: Ensembl
    32. response to gonadotropin Source: Ensembl
    33. response to ionizing radiation Source: Ensembl
    34. response to organic cyclic compound Source: Ensembl
    35. response to sulfur dioxide Source: Ensembl
    36. T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell Source: Ensembl
    37. T cell antigen processing and presentation Source: MGI

    Keywords - Biological processi

    Cell adhesion

    Enzyme and pathway databases

    ReactomeiREACT_198660. Interferon gamma signaling.
    REACT_202937. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
    REACT_216309. Integrin cell surface interactions.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Intercellular adhesion molecule 1
    Short name:
    ICAM-1
    Alternative name(s):
    MALA-2
    MyD10
    CD_antigen: CD54
    Gene namesi
    Name:Icam1
    Synonyms:Icam-1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 9

    Organism-specific databases

    MGIiMGI:96392. Icam1.

    Subcellular locationi

    GO - Cellular componenti

    1. external side of plasma membrane Source: MGI
    2. extracellular space Source: Ensembl
    3. immunological synapse Source: MGI
    4. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2727By similarityAdd
    BLAST
    Chaini28 – 537510Intercellular adhesion molecule 1PRO_0000014785Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi47 – 471N-linked (GlcNAc...)1 Publication
    Disulfide bondi48 ↔ 91PROSITE-ProRule annotation
    Disulfide bondi52 ↔ 95PROSITE-ProRule annotation
    Disulfide bondi134 ↔ 188PROSITE-ProRule annotation
    Glycosylationi185 – 1851N-linked (GlcNAc...)2 Publications
    Glycosylationi204 – 2041N-linked (GlcNAc...)2 Publications
    Disulfide bondi239 ↔ 292PROSITE-ProRule annotation
    Glycosylationi267 – 2671N-linked (GlcNAc...)1 Publication
    Glycosylationi311 – 3111N-linked (GlcNAc...)1 Publication
    Disulfide bondi334 ↔ 374PROSITE-ProRule annotation
    Glycosylationi362 – 3621N-linked (GlcNAc...)2 Publications
    Glycosylationi388 – 3881N-linked (GlcNAc...)2 Publications
    Glycosylationi409 – 4091N-linked (GlcNAc...)2 Publications
    Disulfide bondi422 ↔ 461PROSITE-ProRule annotation
    Glycosylationi456 – 4561N-linked (GlcNAc...)1 Publication
    Glycosylationi469 – 4691N-linked (GlcNAc...)1 Publication

    Post-translational modificationi

    Monoubiquitinated, which is promoted by MARCH9 and leads to endocytosis.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiP13597.
    PaxDbiP13597.
    PRIDEiP13597.

    PTM databases

    PhosphoSiteiP13597.

    Expressioni

    Tissue specificityi

    Expressed at low level on a subpopulation of lymphocytes, macrophages, and endothelial cells, but is strongly induced on these cells, and on fibroblasts and epithelial cells.

    Gene expression databases

    ArrayExpressiP13597.
    BgeeiP13597.
    CleanExiMM_ICAM1.
    GenevestigatoriP13597.

    Interactioni

    Subunit structurei

    Homodimer. Interacts with MUC1 and promotes cell aggregation in epithelial cells. Interacts with ARHGEF26/SGEF By similarity.By similarity

    Protein-protein interaction databases

    DIPiDIP-29096N.
    IntActiP13597. 1 interaction.
    MINTiMINT-4098375.

    Structurei

    3D structure databases

    ProteinModelPortaliP13597.
    SMRiP13597. Positions 28-479.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini28 – 485458ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini510 – 53728CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei486 – 50924HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini41 – 10262Ig-like C2-type 1Add
    BLAST
    Domaini127 – 19569Ig-like C2-type 2Add
    BLAST
    Domaini232 – 29968Ig-like C2-type 3Add
    BLAST
    Domaini327 – 38155Ig-like C2-type 4Add
    BLAST
    Domaini415 – 46854Ig-like C2-type 5Add
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi151 – 1533Cell attachment site; atypicalSequence Analysis
    Motifi179 – 1813Cell attachment siteSequence Analysis

    Sequence similaritiesi

    Belongs to the immunoglobulin superfamily. ICAM family.Curated

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG146347.
    HOGENOMiHOG000059554.
    HOVERGENiHBG052074.
    InParanoidiP13597.
    KOiK06490.
    OMAiRDCPGNW.
    OrthoDBiEOG7QG43X.
    PhylomeDBiP13597.
    TreeFamiTF333745.

    Family and domain databases

    Gene3Di2.60.40.10. 5 hits.
    InterProiIPR003988. ICAM.
    IPR013768. ICAM_N.
    IPR003987. ICAM_VCAM_N.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    [Graphical view]
    PfamiPF03921. ICAM_N. 1 hit.
    [Graphical view]
    PRINTSiPR01473. ICAM.
    PR01472. ICAMVCAM1.
    SMARTiSM00409. IG. 2 hits.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P13597-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASTRAKPTL PLLLALVTVV IPGPGDAQVS IHPREAFLPQ GGSVQVNCSS    50
    SCKEDLSLGL ETQWLKDELE SGPNWKLFEL SEIGEDSSPL CFENCGTVQS 100
    SASATITVYS FPESVELRPL PAWQQVGKDL TLRCHVDGGA PRTQLSAVLL 150
    RGEEILSRQP VGGHPKDPKE ITFTVLASRG DHGANFSCRT ELDLRPQGLA 200
    LFSNVSEARS LRTFDLPATI PKLDTPDLLE VGTQQKLFCS LEGLFPASEA 250
    RIYLELGGQM PTQESTNSSD SVSATALVEV TEEFDRTLPL RCVLELADQI 300
    LETQRTLTVY NFSAPVLTLS QLEVSEGSQV TVKCEAHSGS KVVLLSGVEP 350
    RPPTPQVQFT LNASSEDHKR SFFCSAALEV AGKFLFKNQT LELHVLYGPR 400
    LDETDCLGNW TWQEGSQQTL KCQAWGNPSP KMTCRRKADG ALLPIGVVKS 450
    VKQEMNGTYV CHAFSSHGNV TRNVYLTVLY HSQNNWTIII LVPVLLVIVG 500
    LVMAASYVYN RQRKIRIYKL QKAQEEAIKL KGQAPPP 537
    Length:537
    Mass (Da):58,844
    Last modified:January 1, 1990 - v1
    Checksum:i6124167753774555
    GO
    Isoform 2 (identifier: P13597-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-34: MASTRAKPTLPLLLALVTVVIPGPGDAQVSIHPR → MITHRHPVREKSINSYQFIKEKQFPAEN

    Show »
    Length:531
    Mass (Da):58,753
    Checksum:i23B6CCDA9313761F
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti243 – 2431G → A in AAA37876. (PubMed:2479693)Curated
    Sequence conflicti370 – 3701R → A in CAA34621. (PubMed:2573511)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3434MASTR…SIHPR → MITHRHPVREKSINSYQFIK EKQFPAEN in isoform 2. CuratedVSP_002518Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X16624 mRNA. Translation: CAA34621.1.
    X16625 mRNA. Translation: CAA34622.1.
    M31585 mRNA. Translation: AAA37876.1.
    X52264 mRNA. Translation: CAA36507.1.
    M90551
    , M90546, M90547, M90548, M90549, M90550 Genomic DNA. Translation: AAA37875.1.
    X54331 mRNA. No translation available.
    CCDSiCCDS22889.1. [P13597-1]
    PIRiA45815.
    I49769.
    S06016.
    RefSeqiNP_034623.1. NM_010493.2. [P13597-1]
    UniGeneiMm.435508.

    Genome annotation databases

    EnsembliENSMUST00000086399; ENSMUSP00000083587; ENSMUSG00000037405. [P13597-1]
    GeneIDi15894.
    KEGGimmu:15894.
    UCSCiuc009ojx.1. mouse. [P13597-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Functional Glycomics Gateway - Glycan Binding

    ICAM-1

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X16624 mRNA. Translation: CAA34621.1 .
    X16625 mRNA. Translation: CAA34622.1 .
    M31585 mRNA. Translation: AAA37876.1 .
    X52264 mRNA. Translation: CAA36507.1 .
    M90551
    , M90546 , M90547 , M90548 , M90549 , M90550 Genomic DNA. Translation: AAA37875.1 .
    X54331 mRNA. No translation available.
    CCDSi CCDS22889.1. [P13597-1 ]
    PIRi A45815.
    I49769.
    S06016.
    RefSeqi NP_034623.1. NM_010493.2. [P13597-1 ]
    UniGenei Mm.435508.

    3D structure databases

    ProteinModelPortali P13597.
    SMRi P13597. Positions 28-479.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    DIPi DIP-29096N.
    IntActi P13597. 1 interaction.
    MINTi MINT-4098375.

    PTM databases

    PhosphoSitei P13597.

    Proteomic databases

    MaxQBi P13597.
    PaxDbi P13597.
    PRIDEi P13597.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000086399 ; ENSMUSP00000083587 ; ENSMUSG00000037405 . [P13597-1 ]
    GeneIDi 15894.
    KEGGi mmu:15894.
    UCSCi uc009ojx.1. mouse. [P13597-1 ]

    Organism-specific databases

    CTDi 3383.
    MGIi MGI:96392. Icam1.

    Phylogenomic databases

    eggNOGi NOG146347.
    HOGENOMi HOG000059554.
    HOVERGENi HBG052074.
    InParanoidi P13597.
    KOi K06490.
    OMAi RDCPGNW.
    OrthoDBi EOG7QG43X.
    PhylomeDBi P13597.
    TreeFami TF333745.

    Enzyme and pathway databases

    Reactomei REACT_198660. Interferon gamma signaling.
    REACT_202937. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
    REACT_216309. Integrin cell surface interactions.

    Miscellaneous databases

    NextBioi 288604.
    PROi P13597.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P13597.
    Bgeei P13597.
    CleanExi MM_ICAM1.
    Genevestigatori P13597.

    Family and domain databases

    Gene3Di 2.60.40.10. 5 hits.
    InterProi IPR003988. ICAM.
    IPR013768. ICAM_N.
    IPR003987. ICAM_VCAM_N.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    [Graphical view ]
    Pfami PF03921. ICAM_N. 1 hit.
    [Graphical view ]
    PRINTSi PR01473. ICAM.
    PR01472. ICAMVCAM1.
    SMARTi SM00409. IG. 2 hits.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of murine intercellular adhesion molecule (ICAM-1)."
      Horley K.J., Carpenito C., Baker B., Takei F.
      EMBO J. 8:2889-2896(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE.
      Strain: BALB/c.
      Tissue: Myeloma.
    2. Takei F.
      Submitted (APR-1990) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION.
    3. "Isolation of the murine intercellular adhesion molecule 1 (ICAM-1) gene. ICAM-1 enhances antigen-specific T cell activation."
      Siu G., Hedrick S.M., Brian A.A.
      J. Immunol. 143:3813-3820(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    4. "Nucleotide sequence of the cDNA for murine intercellular adhesion molecule-1 (ICAM-1)."
      Ballantyne C.M., O'Brien W.E., Beaudet A.L.
      Nucleic Acids Res. 17:5853-5853(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
      Strain: C57BL/6 X CBA.
      Tissue: Thymus.
    5. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
      Strain: NIH Swiss.
    6. "Complexity of the immediate early response of myeloid cells to terminal differentiation and growth arrest includes ICAM-1, Jun-B and histone variants."
      Lord K.A., Hoffman-Liebermann B., Liebermann D.A.
      Oncogene 5:387-396(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 4-131.
    7. "N-glycan structures and N-glycosylation sites of mouse soluble intercellular adhesion molecule-1 revealed by MALDI-TOF and FTICR mass spectrometry."
      Otto V.I., Damoc E., Cueni L.N., Schurpf T., Frei R., Ali S., Callewaert N., Moise A., Leary J.A., Folkers G., Przybylski M.
      Glycobiology 16:1033-1044(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION AT ASN-47; ASN-185; ASN-204; ASN-267; ASN-311; ASN-362; ASN-388; ASN-409 AND ASN-456, ABSENCE OF GLYCOSYLATION AT ASN-469 AND ASN-485, IDENTIFICATION BY MASS SPECTROMETRY.
    8. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
      Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
      Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-185; ASN-204; ASN-362; ASN-388; ASN-409 AND ASN-469.

    Entry informationi

    Entry nameiICAM1_MOUSE
    AccessioniPrimary (citable) accession number: P13597
    Secondary accession number(s): Q61828
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 1, 1990
    Last sequence update: January 1, 1990
    Last modified: October 1, 2014
    This is version 154 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3