SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P13597

- ICAM1_MOUSE

UniProt

P13597 - ICAM1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Intercellular adhesion molecule 1

Gene
Icam1, Icam-1
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei469 – 4691Not glycosylated
Sitei485 – 4851Not glycosylated

GO - Molecular functioni

  1. integrin binding Source: MGI

GO - Biological processi

  1. cell adhesion Source: MGI
  2. cell adhesion mediated by integrin Source: MGI
  3. cell aging Source: Ensembl
  4. cellular response to alkaloid Source: Ensembl
  5. cellular response to glucose stimulus Source: MGI
  6. cellular response to hypoxia Source: Ensembl
  7. cellular response to interleukin-1 Source: Ensembl
  8. cellular response to lipopolysaccharide Source: Ensembl
  9. cellular response to nutrient levels Source: Ensembl
  10. cellular response to tumor necrosis factor Source: Ensembl
  11. leukocyte cell-cell adhesion Source: MGI
  12. leukocyte migration Source: Ensembl
  13. membrane to membrane docking Source: Ensembl
  14. negative regulation of calcium ion transport Source: Ensembl
  15. ovarian follicle development Source: Ensembl
  16. positive regulation of actin filament polymerization Source: Ensembl
  17. positive regulation of cellular extravasation Source: Ensembl
  18. positive regulation of NF-kappaB transcription factor activity Source: Ensembl
  19. positive regulation of nitric oxide biosynthetic process Source: Ensembl
  20. positive regulation of peptidyl-tyrosine phosphorylation Source: Ensembl
  21. positive regulation of Rho GTPase activity Source: Ensembl
  22. positive regulation of vasoconstriction Source: Ensembl
  23. receptor-mediated virion attachment to host cell Source: Ensembl
  24. regulation of cell adhesion Source: MGI
  25. regulation of cell shape Source: Ensembl
  26. regulation of ruffle assembly Source: MGI
  27. response to amino acid Source: Ensembl
  28. response to amphetamine Source: Ensembl
  29. response to copper ion Source: Ensembl
  30. response to drug Source: Ensembl
  31. response to ethanol Source: Ensembl
  32. response to gonadotropin Source: Ensembl
  33. response to ionizing radiation Source: Ensembl
  34. response to organic cyclic compound Source: Ensembl
  35. response to sulfur dioxide Source: Ensembl
  36. T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell Source: Ensembl
  37. T cell antigen processing and presentation Source: MGI
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

ReactomeiREACT_198660. Interferon gamma signaling.
REACT_202937. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
REACT_216309. Integrin cell surface interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Intercellular adhesion molecule 1
Short name:
ICAM-1
Alternative name(s):
MALA-2
MyD10
CD_antigen: CD54
Gene namesi
Name:Icam1
Synonyms:Icam-1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 9

Organism-specific databases

MGIiMGI:96392. Icam1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini28 – 485458Extracellular Reviewed predictionAdd
BLAST
Transmembranei486 – 50924Helical; Reviewed predictionAdd
BLAST
Topological domaini510 – 53728Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. external side of plasma membrane Source: MGI
  2. extracellular space Source: Ensembl
  3. immunological synapse Source: MGI
  4. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2727 By similarityAdd
BLAST
Chaini28 – 537510Intercellular adhesion molecule 1PRO_0000014785Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi47 – 471N-linked (GlcNAc...)1 Publication
Disulfide bondi48 ↔ 91 By similarity
Disulfide bondi52 ↔ 95 By similarity
Disulfide bondi134 ↔ 188 By similarity
Glycosylationi185 – 1851N-linked (GlcNAc...)2 Publications
Glycosylationi204 – 2041N-linked (GlcNAc...)2 Publications
Disulfide bondi239 ↔ 292 By similarity
Glycosylationi267 – 2671N-linked (GlcNAc...)1 Publication
Glycosylationi311 – 3111N-linked (GlcNAc...)1 Publication
Disulfide bondi334 ↔ 374 By similarity
Glycosylationi362 – 3621N-linked (GlcNAc...)2 Publications
Glycosylationi388 – 3881N-linked (GlcNAc...)2 Publications
Glycosylationi409 – 4091N-linked (GlcNAc...)2 Publications
Disulfide bondi422 ↔ 461 By similarity
Glycosylationi456 – 4561N-linked (GlcNAc...)1 Publication
Glycosylationi469 – 4691N-linked (GlcNAc...)2 Publications

Post-translational modificationi

Monoubiquitinated, which is promoted by MARCH9 and leads to endocytosis By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein, Ubl conjugation

Proteomic databases

MaxQBiP13597.
PaxDbiP13597.
PRIDEiP13597.

PTM databases

PhosphoSiteiP13597.

Expressioni

Tissue specificityi

Expressed at low level on a subpopulation of lymphocytes, macrophages, and endothelial cells, but is strongly induced on these cells, and on fibroblasts and epithelial cells.

Gene expression databases

ArrayExpressiP13597.
BgeeiP13597.
CleanExiMM_ICAM1.
GenevestigatoriP13597.

Interactioni

Subunit structurei

Homodimer. Interacts with MUC1 and promotes cell aggregation in epithelial cells. Interacts with ARHGEF26/SGEF By similarity.

Protein-protein interaction databases

DIPiDIP-29096N.
IntActiP13597. 1 interaction.
MINTiMINT-4098375.

Structurei

3D structure databases

ProteinModelPortaliP13597.
SMRiP13597. Positions 28-479.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini41 – 10262Ig-like C2-type 1Add
BLAST
Domaini127 – 19569Ig-like C2-type 2Add
BLAST
Domaini232 – 29968Ig-like C2-type 3Add
BLAST
Domaini327 – 38155Ig-like C2-type 4Add
BLAST
Domaini415 – 46854Ig-like C2-type 5Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi151 – 1533Cell attachment site; atypical Reviewed prediction
Motifi179 – 1813Cell attachment site Reviewed prediction

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG146347.
HOGENOMiHOG000059554.
HOVERGENiHBG052074.
InParanoidiP13597.
KOiK06490.
OMAiRDCPGNW.
OrthoDBiEOG7QG43X.
PhylomeDBiP13597.
TreeFamiTF333745.

Family and domain databases

Gene3Di2.60.40.10. 5 hits.
InterProiIPR003988. ICAM.
IPR013768. ICAM_N.
IPR003987. ICAM_VCAM_N.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view]
PfamiPF03921. ICAM_N. 1 hit.
[Graphical view]
PRINTSiPR01473. ICAM.
PR01472. ICAMVCAM1.
SMARTiSM00409. IG. 2 hits.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P13597-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MASTRAKPTL PLLLALVTVV IPGPGDAQVS IHPREAFLPQ GGSVQVNCSS    50
SCKEDLSLGL ETQWLKDELE SGPNWKLFEL SEIGEDSSPL CFENCGTVQS 100
SASATITVYS FPESVELRPL PAWQQVGKDL TLRCHVDGGA PRTQLSAVLL 150
RGEEILSRQP VGGHPKDPKE ITFTVLASRG DHGANFSCRT ELDLRPQGLA 200
LFSNVSEARS LRTFDLPATI PKLDTPDLLE VGTQQKLFCS LEGLFPASEA 250
RIYLELGGQM PTQESTNSSD SVSATALVEV TEEFDRTLPL RCVLELADQI 300
LETQRTLTVY NFSAPVLTLS QLEVSEGSQV TVKCEAHSGS KVVLLSGVEP 350
RPPTPQVQFT LNASSEDHKR SFFCSAALEV AGKFLFKNQT LELHVLYGPR 400
LDETDCLGNW TWQEGSQQTL KCQAWGNPSP KMTCRRKADG ALLPIGVVKS 450
VKQEMNGTYV CHAFSSHGNV TRNVYLTVLY HSQNNWTIII LVPVLLVIVG 500
LVMAASYVYN RQRKIRIYKL QKAQEEAIKL KGQAPPP 537
Length:537
Mass (Da):58,844
Last modified:January 1, 1990 - v1
Checksum:i6124167753774555
GO
Isoform 2 (identifier: P13597-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MASTRAKPTLPLLLALVTVVIPGPGDAQVSIHPR → MITHRHPVREKSINSYQFIKEKQFPAEN

Show »
Length:531
Mass (Da):58,753
Checksum:i23B6CCDA9313761F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3434MASTR…SIHPR → MITHRHPVREKSINSYQFIK EKQFPAEN in isoform 2. VSP_002518Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti243 – 2431G → A in AAA37876. 1 Publication
Sequence conflicti370 – 3701R → A in CAA34621. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X16624 mRNA. Translation: CAA34621.1.
X16625 mRNA. Translation: CAA34622.1.
M31585 mRNA. Translation: AAA37876.1.
X52264 mRNA. Translation: CAA36507.1.
M90551
, M90546, M90547, M90548, M90549, M90550 Genomic DNA. Translation: AAA37875.1.
X54331 mRNA. No translation available.
CCDSiCCDS22889.1. [P13597-1]
PIRiA45815.
I49769.
S06016.
RefSeqiNP_034623.1. NM_010493.2. [P13597-1]
UniGeneiMm.435508.

Genome annotation databases

EnsembliENSMUST00000086399; ENSMUSP00000083587; ENSMUSG00000037405. [P13597-1]
GeneIDi15894.
KEGGimmu:15894.
UCSCiuc009ojx.1. mouse. [P13597-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

ICAM-1

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X16624 mRNA. Translation: CAA34621.1 .
X16625 mRNA. Translation: CAA34622.1 .
M31585 mRNA. Translation: AAA37876.1 .
X52264 mRNA. Translation: CAA36507.1 .
M90551
, M90546 , M90547 , M90548 , M90549 , M90550 Genomic DNA. Translation: AAA37875.1 .
X54331 mRNA. No translation available.
CCDSi CCDS22889.1. [P13597-1 ]
PIRi A45815.
I49769.
S06016.
RefSeqi NP_034623.1. NM_010493.2. [P13597-1 ]
UniGenei Mm.435508.

3D structure databases

ProteinModelPortali P13597.
SMRi P13597. Positions 28-479.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

DIPi DIP-29096N.
IntActi P13597. 1 interaction.
MINTi MINT-4098375.

PTM databases

PhosphoSitei P13597.

Proteomic databases

MaxQBi P13597.
PaxDbi P13597.
PRIDEi P13597.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000086399 ; ENSMUSP00000083587 ; ENSMUSG00000037405 . [P13597-1 ]
GeneIDi 15894.
KEGGi mmu:15894.
UCSCi uc009ojx.1. mouse. [P13597-1 ]

Organism-specific databases

CTDi 3383.
MGIi MGI:96392. Icam1.

Phylogenomic databases

eggNOGi NOG146347.
HOGENOMi HOG000059554.
HOVERGENi HBG052074.
InParanoidi P13597.
KOi K06490.
OMAi RDCPGNW.
OrthoDBi EOG7QG43X.
PhylomeDBi P13597.
TreeFami TF333745.

Enzyme and pathway databases

Reactomei REACT_198660. Interferon gamma signaling.
REACT_202937. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
REACT_216309. Integrin cell surface interactions.

Miscellaneous databases

NextBioi 288604.
PROi P13597.
SOURCEi Search...

Gene expression databases

ArrayExpressi P13597.
Bgeei P13597.
CleanExi MM_ICAM1.
Genevestigatori P13597.

Family and domain databases

Gene3Di 2.60.40.10. 5 hits.
InterProi IPR003988. ICAM.
IPR013768. ICAM_N.
IPR003987. ICAM_VCAM_N.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view ]
Pfami PF03921. ICAM_N. 1 hit.
[Graphical view ]
PRINTSi PR01473. ICAM.
PR01472. ICAMVCAM1.
SMARTi SM00409. IG. 2 hits.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of murine intercellular adhesion molecule (ICAM-1)."
    Horley K.J., Carpenito C., Baker B., Takei F.
    EMBO J. 8:2889-2896(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE.
    Strain: BALB/c.
    Tissue: Myeloma.
  2. Takei F.
    Submitted (APR-1990) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  3. "Isolation of the murine intercellular adhesion molecule 1 (ICAM-1) gene. ICAM-1 enhances antigen-specific T cell activation."
    Siu G., Hedrick S.M., Brian A.A.
    J. Immunol. 143:3813-3820(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
  4. "Nucleotide sequence of the cDNA for murine intercellular adhesion molecule-1 (ICAM-1)."
    Ballantyne C.M., O'Brien W.E., Beaudet A.L.
    Nucleic Acids Res. 17:5853-5853(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Strain: C57BL/6 X CBA.
    Tissue: Thymus.
  5. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Strain: NIH Swiss.
  6. "Complexity of the immediate early response of myeloid cells to terminal differentiation and growth arrest includes ICAM-1, Jun-B and histone variants."
    Lord K.A., Hoffman-Liebermann B., Liebermann D.A.
    Oncogene 5:387-396(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 4-131.
  7. "N-glycan structures and N-glycosylation sites of mouse soluble intercellular adhesion molecule-1 revealed by MALDI-TOF and FTICR mass spectrometry."
    Otto V.I., Damoc E., Cueni L.N., Schurpf T., Frei R., Ali S., Callewaert N., Moise A., Leary J.A., Folkers G., Przybylski M.
    Glycobiology 16:1033-1044(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION AT ASN-47; ASN-185; ASN-204; ASN-267; ASN-311; ASN-362; ASN-388; ASN-409 AND ASN-456, ABSENCE OF GLYCOSYLATION AT ASN-469 AND ASN-485, IDENTIFICATION BY MASS SPECTROMETRY.
  8. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-185; ASN-204; ASN-362; ASN-388; ASN-409 AND ASN-469.

Entry informationi

Entry nameiICAM1_MOUSE
AccessioniPrimary (citable) accession number: P13597
Secondary accession number(s): Q61828
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: January 1, 1990
Last modified: September 3, 2014
This is version 153 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi