Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Intercellular adhesion molecule 1

Gene

Icam1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

ReactomeiR-MMU-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
R-MMU-216083. Integrin cell surface interactions.
R-MMU-877300. Interferon gamma signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Intercellular adhesion molecule 1
Short name:
ICAM-1
Alternative name(s):
MALA-2
MyD10
CD_antigen: CD54
Gene namesi
Name:Icam1
Synonyms:Icam-1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:96392. Icam1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini28 – 485ExtracellularSequence analysisAdd BLAST458
Transmembranei486 – 509HelicalSequence analysisAdd BLAST24
Topological domaini510 – 537CytoplasmicSequence analysisAdd BLAST28

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 27By similarityAdd BLAST27
ChainiPRO_000001478528 – 537Intercellular adhesion molecule 1Add BLAST510

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi47N-linked (GlcNAc...)1 Publication1
Disulfide bondi48 ↔ 91PROSITE-ProRule annotation
Disulfide bondi52 ↔ 95PROSITE-ProRule annotation
Disulfide bondi134 ↔ 188PROSITE-ProRule annotation
Glycosylationi185N-linked (GlcNAc...)2 Publications1
Glycosylationi204N-linked (GlcNAc...)2 Publications1
Disulfide bondi239 ↔ 292PROSITE-ProRule annotation
Glycosylationi267N-linked (GlcNAc...)1 Publication1
Glycosylationi311N-linked (GlcNAc...)1 Publication1
Disulfide bondi334 ↔ 374PROSITE-ProRule annotation
Glycosylationi362N-linked (GlcNAc...)2 Publications1
Glycosylationi388N-linked (GlcNAc...)2 Publications1
Disulfide bondi406 ↔ 422By similarity
Glycosylationi409N-linked (GlcNAc...)2 Publications1
Disulfide bondi422 ↔ 461PROSITE-ProRule annotation
Disulfide bondi434 ↔ 461By similarity
Glycosylationi456N-linked (GlcNAc...)1 Publication1
Glycosylationi469N-linked (GlcNAc...)1 Publication1

Post-translational modificationi

Monoubiquitinated, which is promoted by MARCH9 and leads to endocytosis.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei469Not glycosylated1
Sitei485Not glycosylated1

Keywords - PTMi

Disulfide bond, Glycoprotein, Ubl conjugation

Proteomic databases

PaxDbiP13597.
PeptideAtlasiP13597.
PRIDEiP13597.

PTM databases

iPTMnetiP13597.
PhosphoSitePlusiP13597.

Expressioni

Tissue specificityi

Expressed at low level on a subpopulation of lymphocytes, macrophages, and endothelial cells, but is strongly induced on these cells, and on fibroblasts and epithelial cells.

Gene expression databases

BgeeiENSMUSG00000037405.
CleanExiMM_ICAM1.
ExpressionAtlasiP13597. baseline and differential.
GenevisibleiP13597. MM.

Interactioni

Subunit structurei

Homodimer. Interacts with MUC1 and promotes cell aggregation in epithelial cells. Interacts with ARHGEF26/SGEF (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

DIPiDIP-29096N.
IntActiP13597. 1 interactor.
MINTiMINT-4098375.
STRINGi10090.ENSMUSP00000083587.

Structurei

3D structure databases

ProteinModelPortaliP13597.
SMRiP13597.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini41 – 102Ig-like C2-type 1Add BLAST62
Domaini127 – 195Ig-like C2-type 2Add BLAST69
Domaini232 – 299Ig-like C2-type 3Add BLAST68
Domaini327 – 381Ig-like C2-type 4Add BLAST55
Domaini415 – 468Ig-like C2-type 5Add BLAST54

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi151 – 153Cell attachment site; atypicalSequence analysis3
Motifi179 – 181Cell attachment siteSequence analysis3

Sequence similaritiesi

Belongs to the immunoglobulin superfamily. ICAM family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IPHM. Eukaryota.
ENOG410YQ1Q. LUCA.
GeneTreeiENSGT00530000063246.
HOGENOMiHOG000059554.
HOVERGENiHBG052074.
InParanoidiP13597.
KOiK06490.
OMAiGNWTWQE.
OrthoDBiEOG091G022Y.
PhylomeDBiP13597.
TreeFamiTF333745.

Family and domain databases

Gene3Di2.60.40.10. 5 hits.
InterProiIPR003988. ICAM.
IPR013768. ICAM_N.
IPR003987. ICAM_VCAM_N.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view]
PfamiPF03921. ICAM_N. 1 hit.
PF13895. Ig_2. 1 hit.
[Graphical view]
PRINTSiPR01473. ICAM.
PR01472. ICAMVCAM1.
SMARTiSM00409. IG. 4 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P13597-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASTRAKPTL PLLLALVTVV IPGPGDAQVS IHPREAFLPQ GGSVQVNCSS
60 70 80 90 100
SCKEDLSLGL ETQWLKDELE SGPNWKLFEL SEIGEDSSPL CFENCGTVQS
110 120 130 140 150
SASATITVYS FPESVELRPL PAWQQVGKDL TLRCHVDGGA PRTQLSAVLL
160 170 180 190 200
RGEEILSRQP VGGHPKDPKE ITFTVLASRG DHGANFSCRT ELDLRPQGLA
210 220 230 240 250
LFSNVSEARS LRTFDLPATI PKLDTPDLLE VGTQQKLFCS LEGLFPASEA
260 270 280 290 300
RIYLELGGQM PTQESTNSSD SVSATALVEV TEEFDRTLPL RCVLELADQI
310 320 330 340 350
LETQRTLTVY NFSAPVLTLS QLEVSEGSQV TVKCEAHSGS KVVLLSGVEP
360 370 380 390 400
RPPTPQVQFT LNASSEDHKR SFFCSAALEV AGKFLFKNQT LELHVLYGPR
410 420 430 440 450
LDETDCLGNW TWQEGSQQTL KCQAWGNPSP KMTCRRKADG ALLPIGVVKS
460 470 480 490 500
VKQEMNGTYV CHAFSSHGNV TRNVYLTVLY HSQNNWTIII LVPVLLVIVG
510 520 530
LVMAASYVYN RQRKIRIYKL QKAQEEAIKL KGQAPPP
Length:537
Mass (Da):58,844
Last modified:January 1, 1990 - v1
Checksum:i6124167753774555
GO
Isoform 2 (identifier: P13597-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MASTRAKPTLPLLLALVTVVIPGPGDAQVSIHPR → MITHRHPVREKSINSYQFIKEKQFPAEN

Show »
Length:531
Mass (Da):58,753
Checksum:i23B6CCDA9313761F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti243G → A in AAA37876 (PubMed:2479693).Curated1
Sequence conflicti370R → A in CAA34621 (PubMed:2573511).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0025181 – 34MASTR…SIHPR → MITHRHPVREKSINSYQFIK EKQFPAEN in isoform 2. CuratedAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X16624 mRNA. Translation: CAA34621.1.
X16625 mRNA. Translation: CAA34622.1.
M31585 mRNA. Translation: AAA37876.1.
X52264 mRNA. Translation: CAA36507.1.
M90551
, M90546, M90547, M90548, M90549, M90550 Genomic DNA. Translation: AAA37875.1.
X54331 mRNA. No translation available.
CCDSiCCDS22889.1. [P13597-1]
PIRiA45815.
I49769.
S06016.
RefSeqiNP_034623.1. NM_010493.3. [P13597-1]
UniGeneiMm.435508.

Genome annotation databases

EnsembliENSMUST00000086399; ENSMUSP00000083587; ENSMUSG00000037405. [P13597-1]
GeneIDi15894.
KEGGimmu:15894.
UCSCiuc009ojx.1. mouse. [P13597-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

ICAM-1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X16624 mRNA. Translation: CAA34621.1.
X16625 mRNA. Translation: CAA34622.1.
M31585 mRNA. Translation: AAA37876.1.
X52264 mRNA. Translation: CAA36507.1.
M90551
, M90546, M90547, M90548, M90549, M90550 Genomic DNA. Translation: AAA37875.1.
X54331 mRNA. No translation available.
CCDSiCCDS22889.1. [P13597-1]
PIRiA45815.
I49769.
S06016.
RefSeqiNP_034623.1. NM_010493.3. [P13597-1]
UniGeneiMm.435508.

3D structure databases

ProteinModelPortaliP13597.
SMRiP13597.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-29096N.
IntActiP13597. 1 interactor.
MINTiMINT-4098375.
STRINGi10090.ENSMUSP00000083587.

PTM databases

iPTMnetiP13597.
PhosphoSitePlusiP13597.

Proteomic databases

PaxDbiP13597.
PeptideAtlasiP13597.
PRIDEiP13597.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000086399; ENSMUSP00000083587; ENSMUSG00000037405. [P13597-1]
GeneIDi15894.
KEGGimmu:15894.
UCSCiuc009ojx.1. mouse. [P13597-1]

Organism-specific databases

CTDi3383.
MGIiMGI:96392. Icam1.

Phylogenomic databases

eggNOGiENOG410IPHM. Eukaryota.
ENOG410YQ1Q. LUCA.
GeneTreeiENSGT00530000063246.
HOGENOMiHOG000059554.
HOVERGENiHBG052074.
InParanoidiP13597.
KOiK06490.
OMAiGNWTWQE.
OrthoDBiEOG091G022Y.
PhylomeDBiP13597.
TreeFamiTF333745.

Enzyme and pathway databases

ReactomeiR-MMU-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
R-MMU-216083. Integrin cell surface interactions.
R-MMU-877300. Interferon gamma signaling.

Miscellaneous databases

PROiP13597.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000037405.
CleanExiMM_ICAM1.
ExpressionAtlasiP13597. baseline and differential.
GenevisibleiP13597. MM.

Family and domain databases

Gene3Di2.60.40.10. 5 hits.
InterProiIPR003988. ICAM.
IPR013768. ICAM_N.
IPR003987. ICAM_VCAM_N.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view]
PfamiPF03921. ICAM_N. 1 hit.
PF13895. Ig_2. 1 hit.
[Graphical view]
PRINTSiPR01473. ICAM.
PR01472. ICAMVCAM1.
SMARTiSM00409. IG. 4 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiICAM1_MOUSE
AccessioniPrimary (citable) accession number: P13597
Secondary accession number(s): Q61828
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: January 1, 1990
Last modified: November 30, 2016
This is version 174 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.