P13597 (ICAM1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 141.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Intercellular adhesion molecule 1 Short name=ICAM-1 Alternative name(s): MALA-2 MyD10 CD_antigen=CD54 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 537 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation By similarity. |
| Subunit structure | Homodimer. Interacts with MUC1 and promotes cell aggregation in epithelial cells. Interacts with ARHGEF26/SGEF By similarity. |
| Subcellular location | |
| Tissue specificity | Expressed at low level on a subpopulation of lymphocytes, macrophages, and endothelial cells, but is strongly induced on these cells, and on fibroblasts and epithelial cells. |
| Post-translational modification | Monoubiquitinated, which is promoted by MARCH9 and leads to endocytosis By similarity. |
| Sequence similarities | Belongs to the immunoglobulin superfamily. ICAM family. Contains 5 Ig-like C2-type (immunoglobulin-like) domains. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P13597-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P13597-2) The sequence of this isoform differs from the canonical sequence as follows: 1-34: MASTRAKPTLPLLLALVTVVIPGPGDAQVSIHPR → MITHRHPVREKSINSYQFIKEKQFPAEN |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 27 | 27 | By similarity | ||||||||
| Chain | 28 – 537 | 510 | Intercellular adhesion molecule 1 | PRO_0000014785 | |||||||
Regions | |||||||||||
| Topological domain | 28 – 485 | 458 | Extracellular Potential | ||||||||
| Transmembrane | 486 – 509 | 24 | Helical; Potential | ||||||||
| Topological domain | 510 – 537 | 28 | Cytoplasmic Potential | ||||||||
| Domain | 41 – 102 | 62 | Ig-like C2-type 1 | ||||||||
| Domain | 127 – 195 | 69 | Ig-like C2-type 2 | ||||||||
| Domain | 232 – 299 | 68 | Ig-like C2-type 3 | ||||||||
| Domain | 327 – 381 | 55 | Ig-like C2-type 4 | ||||||||
| Domain | 415 – 468 | 54 | Ig-like C2-type 5 | ||||||||
| Motif | 151 – 153 | 3 | Cell attachment site; atypical Potential | ||||||||
| Motif | 179 – 181 | 3 | Cell attachment site Potential | ||||||||
Sites | |||||||||||
| Site | 469 | 1 | Not glycosylated | ||||||||
| Site | 485 | 1 | Not glycosylated | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 47 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Glycosylation | 185 | 1 | N-linked (GlcNAc...) Ref.7 Ref.8 | ||||||||
| Glycosylation | 204 | 1 | N-linked (GlcNAc...) Ref.7 Ref.8 | ||||||||
| Glycosylation | 267 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Glycosylation | 311 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Glycosylation | 362 | 1 | N-linked (GlcNAc...) Ref.7 Ref.8 | ||||||||
| Glycosylation | 388 | 1 | N-linked (GlcNAc...) Ref.7 Ref.8 | ||||||||
| Glycosylation | 409 | 1 | N-linked (GlcNAc...) Ref.7 Ref.8 | ||||||||
| Glycosylation | 456 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Glycosylation | 469 | 1 | N-linked (GlcNAc...) Ref.7 Ref.8 | ||||||||
| Disulfide bond | 48 ↔ 91 | By similarity | |||||||||
| Disulfide bond | 52 ↔ 95 | By similarity | |||||||||
| Disulfide bond | 134 ↔ 188 | By similarity | |||||||||
| Disulfide bond | 239 ↔ 292 | By similarity | |||||||||
| Disulfide bond | 334 ↔ 374 | By similarity | |||||||||
| Disulfide bond | 422 ↔ 461 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 34 | 34 | MASTR…SIHPR → MITHRHPVREKSINSYQFIK EKQFPAEN in isoform 2. | VSP_002518 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 243 | 1 | G → A in AAA37876. Ref.3 | ||||||||
| Sequence conflict | 370 | 1 | R → A in CAA34621. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of murine intercellular adhesion molecule (ICAM-1)." Horley K.J., Carpenito C., Baker B., Takei F. EMBO J. 8:2889-2896(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE. Strain: BALB/c. Tissue: Myeloma. |
| [2] | Takei F. Submitted (APR-1990) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [3] | "Isolation of the murine intercellular adhesion molecule 1 (ICAM-1) gene. ICAM-1 enhances antigen-specific T cell activation." Siu G., Hedrick S.M., Brian A.A. J. Immunol. 143:3813-3820(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [4] | "Nucleotide sequence of the cDNA for murine intercellular adhesion molecule-1 (ICAM-1)." Ballantyne C.M., O'Brien W.E., Beaudet A.L. Nucleic Acids Res. 17:5853-5853(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Strain: C57BL/6 X CBA. Tissue: Thymus. |
| [5] | "Characterization of the murine Icam-1 gene." Ballantyne C.M., Sligh J.E., Dai X.Y., Beaudet A.L. Genomics 14:1076-1080(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: NIH Swiss. |
| [6] | "Complexity of the immediate early response of myeloid cells to terminal differentiation and growth arrest includes ICAM-1, Jun-B and histone variants." Lord K.A., Hoffman-Liebermann B., Liebermann D.A. Oncogene 5:387-396(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 4-131. |
| [7] | "N-glycan structures and N-glycosylation sites of mouse soluble intercellular adhesion molecule-1 revealed by MALDI-TOF and FTICR mass spectrometry." Otto V.I., Damoc E., Cueni L.N., Schurpf T., Frei R., Ali S., Callewaert N., Moise A., Leary J.A., Folkers G., Przybylski M. Glycobiology 16:1033-1044(2006) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT ASN-47; ASN-185; ASN-204; ASN-267; ASN-311; ASN-362; ASN-388; ASN-409 AND ASN-456, ABSENCE OF GLYCOSYLATION AT ASN-469 AND ASN-485, MASS SPECTROMETRY. |
| [8] | "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins." Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D. Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-185; ASN-204; ASN-362; ASN-388; ASN-409 AND ASN-469, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X16624 mRNA. Translation: CAA34621.1. X16625 mRNA. Translation: CAA34622.1. M31585 mRNA. Translation: AAA37876.1. X52264 mRNA. Translation: CAA36507.1. M90551 M90550 Genomic DNA. Translation: AAA37875.1.X54331 mRNA. No translation available. |
| IPI | IPI00122973. IPI00230702. |
| PIR | A45815. I49769. S06016. |
| RefSeq | NP_034623.1. NM_010493.2. |
| UniGene | Mm.435508. |
3D structure databases | |
| ProteinModelPortal | P13597. |
| SMR | P13597. Positions 28-479. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-29096N. |
PTM databases | |
| PhosphoSite | P13597. |
Proteomic databases | |
| PaxDb | P13597. |
| PRIDE | P13597. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000086399; ENSMUSP00000083587; ENSMUSG00000037405. |
| GeneID | 15894. |
| KEGG | mmu:15894. |
Organism-specific databases | |
| CTD | 3383. |
| MGI | MGI:96392. Icam1. |
Phylogenomic databases | |
| eggNOG | NOG146347. |
| HOGENOM | HOG000059554. |
| HOVERGEN | HBG052074. |
| InParanoid | P13597. |
| KO | K06490. |
| OMA | RDCPGNW. |
| OrthoDB | EOG4THVT8. |
Gene expression databases | |
| ArrayExpress | P13597. |
| Bgee | P13597. |
| CleanEx | MM_ICAM1. |
| Genevestigator | P13597. |
| GermOnline | ENSMUSG00000037405. Mus musculus. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 5 hits. |
| InterPro | IPR003988. ICAM. IPR013768. ICAM_N. IPR003987. ICAM_VCAM_N. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR003599. Ig_sub. [Graphical view] |
| Pfam | PF03921. ICAM_N. 1 hit. [Graphical view] |
| PRINTS | PR01473. ICAM. PR01472. ICAMVCAM1. |
| SMART | SM00409. IG. 2 hits. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 288604. |
| SOURCE | Search... |
Entry information
| Entry name | ICAM1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P13597 Secondary accession number(s): Q61828 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
