P13497 (BMP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 140.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bone morphogenetic protein 1 Short name=BMP-1 EC=3.4.24.19 Alternative name(s): Mammalian tolloid protein Short name=mTld Procollagen C-proteinase Short name=PCP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 986 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Cleaves the C-terminal propeptides of procollagen I, II and III. Induces cartilage and bone formation. May participate in dorsoventral patterning during early development by cleaving chordin (CHRD). |
| Catalytic activity | Cleavage of the C-terminal propeptide at Ala-|-Asp in type I and II procollagens and at Arg-|-Asp in type III. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Enzyme regulation | Activity is increased by the procollagen C-endopeptidase enhancer protein. |
| Tissue specificity | Ubiquitous. |
| Sequence similarities | Belongs to the peptidase M12A family. Contains 5 CUB domains. Contains 2 EGF-like domains. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform BMP1-3 (identifier: P13497-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform BMP1-1 (identifier: P13497-2) The sequence of this isoform differs from the canonical sequence as follows: 703-730: DKDECSKDNGGCQQDCVNTFGSYECQCR → EKRPALQPPRGRPHQLKFRVQKRNRTPQ 731-986: Missing. | ||||||
| Isoform BMP1-2 (identifier: P13497-7) The sequence of this isoform is not available. | ||||||
| Isoform BMP1-4 (identifier: P13497-3) The sequence of this isoform differs from the canonical sequence as follows: 245-302: QEYNFLKMEP...NGVKPPIGQR → VLHSSLLLLS...AAPRTLRAGV 303-986: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform BMP1-5 (identifier: P13497-4) The sequence of this isoform differs from the canonical sequence as follows: 589-622: AACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLV → GCYDLQVGKPLLWDRHCFRLSTHGPEMLGTALRG 623-986: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform BMP1-6 (identifier: P13497-5) The sequence of this isoform differs from the canonical sequence as follows: 703-717: DKDECSKDNGGCQQD → GGELFGLLGHPPRRP 718-986: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform BMP1-7 (identifier: P13497-6) The sequence of this isoform differs from the canonical sequence as follows: 703-823: DKDECSKDNG...KAPVLGRFCG → VLEGAGDRHS...PATFRGIWAL 824-986: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Potential | ||||||||||||||||||||||||||||||||||||||
| Propeptide | 23 – 120 | 98 | Potential | PRO_0000028889 | |||||||||||||||||||||||||||||||||||||
| Chain | 121 – 986 | 866 | Bone morphogenetic protein 1 | PRO_0000028890 | |||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||
| Domain | 322 – 434 | 113 | CUB 1 | ||||||||||||||||||||||||||||||||||||||
| Domain | 435 – 546 | 112 | CUB 2 | ||||||||||||||||||||||||||||||||||||||
| Domain | 547 – 588 | 42 | EGF-like 1; calcium-binding Potential | ||||||||||||||||||||||||||||||||||||||
| Domain | 591 – 703 | 113 | CUB 3 | ||||||||||||||||||||||||||||||||||||||
| Domain | 704 – 743 | 40 | EGF-like 2; calcium-binding Potential | ||||||||||||||||||||||||||||||||||||||
| Domain | 747 – 859 | 113 | CUB 4 | ||||||||||||||||||||||||||||||||||||||
| Domain | 860 – 976 | 117 | CUB 5 | ||||||||||||||||||||||||||||||||||||||
| Region | 121 – 321 | 201 | Metalloprotease | ||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||
| Active site | 214 | 1 | By similarity | ||||||||||||||||||||||||||||||||||||||
| Metal binding | 213 | 1 | Zinc; catalytic By similarity | ||||||||||||||||||||||||||||||||||||||
| Metal binding | 217 | 1 | Zinc; catalytic By similarity | ||||||||||||||||||||||||||||||||||||||
| Metal binding | 223 | 1 | Zinc; catalytic By similarity | ||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 91 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||
| Glycosylation | 142 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||
| Glycosylation | 332 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||
| Glycosylation | 363 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||
| Glycosylation | 599 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 183 ↔ 186 | ||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 322 ↔ 348 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 375 ↔ 397 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 435 ↔ 461 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 488 ↔ 510 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 551 ↔ 563 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 559 ↔ 572 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 574 ↔ 587 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 591 ↔ 617 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 644 ↔ 666 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 707 ↔ 718 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 714 ↔ 727 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 729 ↔ 742 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 747 ↔ 773 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 800 ↔ 822 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 860 ↔ 890 | By similarity | |||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 917 ↔ 939 | By similarity | |||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 245 – 302 | 58 | QEYNF…PIGQR → VLHSSLLLLSCGSRNGASFP CSLESSTHQALCWTGLFLRP SPFPRLPLAAPRTLRAGV in isoform BMP1-4. | VSP_005463 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 303 – 986 | 684 | Missing in isoform BMP1-4. | VSP_005464 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 589 – 622 | 34 | AACGG…IWQLV → GCYDLQVGKPLLWDRHCFRL STHGPEMLGTALRG in isoform BMP1-5. | VSP_005465 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 623 – 986 | 364 | Missing in isoform BMP1-5. | VSP_005466 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 703 – 823 | 121 | DKDEC…GRFCG → VLEGAGDRHSHLSGLELLLC PHALVDTVPAPPSALHGDTH AHTHTHVHTHCPIAQETCRG PPLGASRLSPQGPGHLTLAP QEGSYLDFWDTHRGDPKPRR RRKSLKTFSLTPATFRGIWA L in isoform BMP1-7. | VSP_005469 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 703 – 730 | 28 | DKDEC…ECQCR → EKRPALQPPRGRPHQLKFRV QKRNRTPQ in isoform BMP1-1. | VSP_005461 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 703 – 717 | 15 | DKDEC…GCQQD → GGELFGLLGHPPRRP in isoform BMP1-6. | VSP_005467 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 718 – 986 | 269 | Missing in isoform BMP1-6. | VSP_005468 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 731 – 986 | 256 | Missing in isoform BMP1-1. | VSP_005462 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 824 – 986 | 163 | Missing in isoform BMP1-7. | VSP_005470 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 45 | 1 | D → H in a breast cancer sample; somatic mutation. Ref.10 | VAR_036141 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 719 | 1 | V → I. [dbSNP:rs11996036] | VAR_051584 | |||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 748 | 1 | D → N Ref.4 | ||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 934 | 1 | R → S Ref.4 | ||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||
| Helix | 126 – 128 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 135 – 138 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 147 – 161 | 15 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 166 – 168 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 176 – 180 | 5 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 197 – 201 | 5 | |||||||||||||||||||||||||||||||||||||||
| Helix | 211 – 214 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 224 – 226 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 230 – 232 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 234 – 236 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 238 – 240 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 246 – 249 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 254 – 256 | 3 | |||||||||||||||||||||||||||||||||||||||
| Turn | 274 – 277 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 285 – 290 | 6 | |||||||||||||||||||||||||||||||||||||||
| Helix | 310 – 316 | 7 | |||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The C-proteinase that processes procollagens to fibrillar collagens is identical to the protein previously identified as bone morphogenic protein-1." Li S.W., Sieron A.L., Fertala A., Hojima Y., Arnold W.V., Prockop D.J. Proc. Natl. Acad. Sci. U.S.A. 93:5127-5130(1996) [PubMed: 8643539] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BMP1-3). Tissue: Skin. |
| [2] | "Novel regulators of bone formation: molecular clones and activities." Wozney J.M., Rosen V., Celeste A.J., Mitsock L.M., Whitters M.J., Kriz R.W., Hewick R.M., Wang E.A. Science 242:1528-1534(1988) [PubMed: 3201241] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BMP1-1). |
| [3] | "Three alternatively spliced variants of the gene coding for the human bone morphogenetic protein-1." Janitz M., Heiser V., Boettcher U., Landt O., Lauster R. J. Mol. Med. 76:141-146(1998) [PubMed: 9500680] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BMP1-4; BMP1-5 AND BMP1-6). Tissue: Placenta. |
| [4] | "Bone morphogenetic protein-1 and a mammalian tolloid homologue (mTld) are encoded by alternatively spliced transcripts which are differentially expressed in some tissues." Takahara K., Lyons G.E., Greenspan D.S. J. Biol. Chem. 269:32572-32578(1994) [PubMed: 7798260] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE (ISOFORMS BMP1-3 AND BMP1-7). Tissue: Placenta. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BMP1-5). Tissue: Placenta. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BMP1-3). Tissue: Brain. |
| [8] | "Identification of amino acid residues in bone morphogenetic protein-1 important for procollagen C-proteinase activity." Garrigue-Antar L., Barker C., Kadler K.E. J. Biol. Chem. 276:26237-26242(2001) [PubMed: 11283002] [Abstract] Cited for: DISULFIDE BOND AT 183-CYS--CYS-186. |
| [9] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [10] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-45. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U50330 mRNA. Translation: AAA93462.1. M22488 mRNA. Translation: AAA51833.1. Y08723 mRNA. Translation: CAA69973.1. Y08724 mRNA. Translation: CAA69974.1. Y08725 mRNA. Translation: CAA69975.1. L35278 mRNA. Translation: AAC41703.1. L35279 mRNA. Translation: AAC41710.1. AK291620 mRNA. Translation: BAF84309.1. CH471080 Genomic DNA. Translation: EAW63698.1. CH471080 Genomic DNA. Translation: EAW63703.1. CH471080 Genomic DNA. Translation: EAW63704.1. BC136679 mRNA. Translation: AAI36680.1. | ||||||||||||||||||
| IPI | IPI00009054. IPI00014021. IPI00218040. IPI00218042. IPI00218044. IPI00218045. | ||||||||||||||||||
| PIR | BMHU1. A37278. A58788. B58788. | ||||||||||||||||||
| RefSeq | NP_001190.1. NM_001199.3. NP_006120.1. NM_006129.4. | ||||||||||||||||||
| UniGene | Hs.1274. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P13497. | ||||||||||||||||||
| SMR | P13497. Positions 44-978. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-33403N. | ||||||||||||||||||
| IntAct | P13497. 4 interactions. | ||||||||||||||||||
| MINT | MINT-1394084. | ||||||||||||||||||
| STRING | P13497. | ||||||||||||||||||
Protein family/group databases | |||||||||||||||||||
| MEROPS | M12.005. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P13497. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 13124688. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PeptideAtlas | P13497. | ||||||||||||||||||
| PRIDE | P13497. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000306385; ENSP00000305714; ENSG00000168487. | ||||||||||||||||||
| GeneID | 649. | ||||||||||||||||||
| KEGG | hsa:649. | ||||||||||||||||||
| UCSC | uc003xba.1. human. uc003xbb.1. human. uc003xbg.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 649. | ||||||||||||||||||
| GeneCards | GC08P022022. | ||||||||||||||||||
| H-InvDB | HIX0007366. | ||||||||||||||||||
| HGNC | HGNC:1067. BMP1. | ||||||||||||||||||
| HPA | HPA014572. | ||||||||||||||||||
| MIM | 112264. gene. | ||||||||||||||||||
| neXtProt | NX_P13497. | ||||||||||||||||||
| PharmGKB | PA25377. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG14114. | ||||||||||||||||||
| GeneTree | ENSGT00600000084035. | ||||||||||||||||||
| HOVERGEN | HBG004859. | ||||||||||||||||||
| InParanoid | P13497. | ||||||||||||||||||
| OMA | RWRGRPR. | ||||||||||||||||||
| OrthoDB | EOG4FTVZV. | ||||||||||||||||||
| PhylomeDB | P13497. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BRENDA | 3.4.24.19. 2681. | ||||||||||||||||||
| Reactome | REACT_22258. Metabolism of lipids and lipoproteins. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P13497. | ||||||||||||||||||
| Bgee | P13497. | ||||||||||||||||||
| CleanEx | HS_BMP1. | ||||||||||||||||||
| Genevestigator | P13497. | ||||||||||||||||||
| GermOnline | ENSG00000168487. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR015446. BMP_1/tolloid-like. IPR000859. CUB. IPR001881. EGF-like_Ca-bd. IPR013032. EGF-like_reg_CS. IPR000152. EGF-type_Asp/Asn_hydroxyl_site. IPR000742. EGF_3. IPR018097. EGF_Ca-bd_CS. IPR024079. MetalloPept_cat_dom. IPR001506. Peptidase_M12A. IPR006026. Peptidase_Metallo. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:2.60.120.290. CUB. 5 hits. G3DSA:3.40.390.10. G3DSA:3.40.390.10. 1 hit. | ||||||||||||||||||
| KO | K05502. | ||||||||||||||||||
| Pfam | PF01400. Astacin. 1 hit. PF00431. CUB. 5 hits. PF07645. EGF_CA. 2 hits. [Graphical view] | ||||||||||||||||||
| PIRSF | PIRSF001199. BMP_1/tolloid-like. 1 hit. | ||||||||||||||||||
| PRINTS | PR00480. ASTACIN. | ||||||||||||||||||
| SMART | SM00042. CUB. 5 hits. SM00179. EGF_CA. 2 hits. SM00235. ZnMc. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF49854. CUB. 5 hits. | ||||||||||||||||||
| PROSITE | PS00010. ASX_HYDROXYL. 2 hits. PS01180. CUB. 5 hits. PS00022. EGF_1. False negative. PS01186. EGF_2. 2 hits. PS50026. EGF_3. 2 hits. PS01187. EGF_CA. 2 hits. PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 2632. | ||||||||||||||||||
| PMAP-CutDB | P13497. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | BMP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P13497 Secondary accession number(s): A8K6F5 Q9UL38 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with