P13084 (NPM_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nucleophosmin Short name=NPM Alternative name(s): Nucleolar phosphoprotein B23 Nucleolar protein NO38 Numatrin | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 292 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in diverse cellular processes such as ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, cell proliferation, and regulation of tumor suppressors p53/TP53 and ARF. Binds ribosome presumably to drive ribosome nuclear export. Acts as a chaperonin for the core histones H3, H2B and H4. Stimulates APEX1 endonuclease activity on apurinic/apyrimidinic (AP) double-stranded DNA but inhibits APEX1 endonuclease activity on AP single-stranded RNA. May exert a control of APEX1 endonuclease activity within nucleoli devoted to repair AP on rDNA and the removal of oxidized rRNA molecules By similarity. Associated with nucleolar ribonucleoprotein structures and bind single-stranded nucleic acids. In concert with BRCA2, regulates centrosome duplication. Regulates centriole duplication: phosphorylation by PLK2 is able to trigger centriole replication By similarity. |
| Subunit structure | Decamer formed by two pentameric rings associated in a head-to-head fashion. Disulfide-linked dimers under certain conditions. The SWAP complex consists of NPM1, NCL, PARP1 and SWAP70. Interacts with NSUN2 and SENP3. Interacts with the methylated form of RPS10. Interacts (via N-terminal domain) with APEX1; the interaction is RNA-dependent and decreases in hydrogen peroxide-damaged cells. Interacts with NEK2. Interacts with ROCK2 and BRCA2 By similarity. Interacts with RPGR. Interacts with CENPW By similarity. |
| Subcellular location | Nucleus › nucleolus. Nucleus › nucleoplasm By similarity. Cytoplasm › cytoskeleton › centrosome By similarity. Note: Generally nucleolar, but is translocated to the nucleoplasm in case of serum starvation or treatment with anticancer drugs. Co-localizes with the methylated form of RPS10 in the granular component (GC) region of the nucleolus. Colocalized with nucleolin and APEX1 in nucleoli. NEK2 is required for its localization to the centrosome during mitosis By similarity. |
| Post-translational modification | Acetylated at C-terminal lysine residues, thereby increasing affinity to histones By similarity. ADP-ribosylated By similarity. Phosphorylated at Ser-4 by PLK1 and PLK2. Phosphorylation at Ser-4 by PLK2 in S phase is required for centriole duplication and is sufficient to trigger centriole replication. Phosphorylation at Ser-4 by PLK1 takes place during mitosis. Phosphorylated by CDK2 at Ser-125 and Thr-198. Phosphorylation at Thr-198 may trigger initiation of centrosome duplication. Phosphorylated by CDK1 at Thr-198, Thr-217, Thr-232 and Thr-235 during cell mitosis. When these four sites are phosphorated, RNA-binding activity seem to be abolished. May be phosphorylated at Ser-70 by NEK2. The Thr-198 phosphorylated form has higher affinity for ROCK2 By similarity. Sumoylated by ARF By similarity. The N-terminus is blocked. |
| Sequence similarities | Belongs to the nucleoplasmin family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform B23.1 (identifier: P13084-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B23.2 (identifier: P13084-2) The sequence of this isoform differs from the canonical sequence as follows: 256-292: GGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL → AH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 292 | 292 | Nucleophosmin | PRO_0000219483 | |||||
Regions | |||||||||
| Region | 1 – 185 | 185 | Required for interaction with SENP3 By similarity | ||||||
| Region | 1 – 117 | 117 | Necessary for interaction with APEX1 By similarity | ||||||
| Region | 241 – 292 | 52 | Required for nucleolar localization By similarity | ||||||
| Motif | 152 – 157 | 6 | Nuclear localization signal Potential | ||||||
| Motif | 190 – 196 | 7 | Nuclear localization signal Potential | ||||||
| Compositional bias | 1 – 9 | 9 | Met-rich | ||||||
| Compositional bias | 120 – 132 | 13 | Asp/Glu-rich (acidic) | ||||||
| Compositional bias | 158 – 187 | 30 | Asp/Glu-rich (highly acidic) | ||||||
Sites | |||||||||
| Site | 55 | 1 | Interaction between pentamers By similarity | ||||||
| Site | 80 | 1 | Interaction between pentamers By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine By similarity | ||||||
| Modified residue | 4 | 1 | Phosphoserine; by PLK1 and PLK2 By similarity | ||||||
| Modified residue | 10 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 32 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 70 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 75 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 95 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 106 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 125 | 1 | Phosphoserine; by CDK2 Ref.6 | ||||||
| Modified residue | 139 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 150 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 154 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 198 | 1 | Phosphothreonine; by CDK1 and CDK2 By similarity | ||||||
| Modified residue | 211 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 217 | 1 | Phosphothreonine; by CDK1 By similarity | ||||||
| Modified residue | 225 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 227 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 228 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 232 | 1 | Phosphothreonine; by CDK1 By similarity | ||||||
| Modified residue | 235 | 1 | Phosphothreonine; by CDK1 By similarity | ||||||
| Modified residue | 240 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 241 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 248 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 252 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 255 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 258 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 265 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 271 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 277 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 290 | 1 | N6-acetyllysine By similarity | ||||||
| Cross-link | 228 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | |||||||
| Cross-link | 261 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 256 – 292 | 37 | GGSLP…WRKSL → AH in isoform B23.2. | VSP_003617 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA and deduced primary structure of rat protein B23, a nucleolar protein containing highly conserved sequences." Chang J.-H., Dumbar T.S., Olson M.O.J. J. Biol. Chem. 263:12824-12827(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B23.1 AND B23.2), PARTIAL PROTEIN SEQUENCE. |
| [2] | "A single gene codes for two forms of rat nucleolar protein B23 mRNA." Chang J.-H., Olson M.O.J. J. Biol. Chem. 264:11732-11737(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM B23.2). |
| [3] | "Structure of the gene for rat nucleolar protein B23." Chang J.-H., Olson M.O.J. J. Biol. Chem. 265:18227-18233(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS B23.1 AND B23.2). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B23.1). Tissue: Pituitary and Thymus. |
| [5] | Lubec G., Chen W.-Q. Submitted (APR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 55-101; 238-246 AND 266-271, MASS SPECTROMETRY. Strain: Sprague-Dawley. Tissue: Hippocampus. |
| [6] | "Quantitative phosphoproteomics of vasopressin-sensitive renal cells: regulation of aquaporin-2 phosphorylation at two sites." Hoffert J.D., Pisitkun T., Wang G., Shen R.-F., Knepper M.A. Proc. Natl. Acad. Sci. U.S.A. 103:7159-7164(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-106 AND SER-125, MASS SPECTROMETRY. Tissue: Renal collecting duct. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | J03969 mRNA. Translation: AAA40796.1. M37039 M37038 Genomic DNA. Translation: AAA41730.1.M37041 M37040 Genomic DNA. Translation: AAA41731.1.M25062 Genomic DNA. Translation: AAA40795.1. J04943 mRNA. Translation: AAA40794.1. J04944 Genomic DNA. Translation: AAA40793.1. BC060579 mRNA. Translation: AAH60579.1. BC088088 mRNA. Translation: AAH88088.1. |
| IPI | IPI00197553. IPI00230893. |
| PIR | A28939. A36089. A34168. B36089. |
| RefSeq | NP_037124.1. NM_012992.4. |
| UniGene | Rn.54537. |
3D structure databases | |
| ProteinModelPortal | P13084. |
| SMR | P13084. Positions 15-118, 241-292. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P13084. |
2D gel databases | |
| World-2DPAGE | 0004:P13084. |
Proteomic databases | |
| PaxDb | P13084. |
| PRIDE | P13084. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000006591; ENSRNOP00000006591; ENSRNOG00000004616. ENSRNOT00000064744; ENSRNOP00000062356; ENSRNOG00000004616. |
| GeneID | 25498. |
| KEGG | rno:25498. |
| UCSC | RGD:3192. rat. |
Organism-specific databases | |
| CTD | 4869. |
| RGD | 3192. Npm1. |
Phylogenomic databases | |
| eggNOG | NOG79897. |
| GeneTree | ENSGT00440000034554. |
| HOGENOM | HOG000013061. |
| HOVERGEN | HBG001860. |
| InParanoid | P13084. |
| KO | K11276. |
| OMA | NCFRTED. |
| OrthoDB | EOG4W3SNZ. |
Gene expression databases | |
| ArrayExpress | P13084. |
| Genevestigator | P13084. |
| GermOnline | ENSRNOG00000004616. Rattus norvegicus. |
Family and domain databases | |
| Gene3D | 2.60.120.340. 1 hit. |
| InterPro | IPR004301. Nucleoplasmin. IPR024057. Nucleoplasmin_core_dom. [Graphical view] |
| PANTHER | PTHR22747. PTHR22747. 1 hit. |
| SUPFAM | SSF69203. Nucleoplasmin. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 606897. |
Entry information
| Entry name | NPM_RAT | ||||||||
| Accession | Primary (citable) accession number: P13084 Secondary accession number(s): Q63698, Q64269 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
