Reviewed,
UniProtKB/Swiss-Prot P12928 (KPYR_RAT)
Last modified
February 9, 2010.
Version 101.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Pyruvate kinase isozymes R/L EC=2.7.1.40 Alternative name(s): L-PK | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 574 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Plays a key role in glycolysis By similarity. |
| Catalytic activity | ATP + pyruvate = ADP + phosphoenolpyruvate. |
| Cofactor | Magnesium. Potassium. |
| Enzyme regulation | Allosterically activated by fructose 1,6-bisphosphate By similarity. |
| Pathway | Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 5/5. |
| Subunit structure | Homotetramer. |
| Miscellaneous | There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues. |
| Sequence similarities | Belongs to the pyruvate kinase family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform R-type (identifier: P12928-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform L-type (identifier: P12928-2) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MSVQENTLPQQLWPWIFRSQKDLAKSALSGAPG → ME |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 574 | 574 | Pyruvate kinase isozymes R/L | PRO_0000112096 | |||||
Regions | |||||||||
| Region | 475 – 480 | 6 | Allosteric activator binding By similarity | ||||||
| Region | 559 – 564 | 6 | Allosteric activator binding By similarity | ||||||
Sites | |||||||||
| Metal binding | 118 | 1 | Potassium By similarity | ||||||
| Metal binding | 120 | 1 | Potassium By similarity | ||||||
| Metal binding | 156 | 1 | Potassium By similarity | ||||||
| Metal binding | 157 | 1 | Potassium By similarity | ||||||
| Metal binding | 315 | 1 | Magnesium By similarity | ||||||
| Metal binding | 339 | 1 | Magnesium By similarity | ||||||
| Binding site | 116 | 1 | Substrate By similarity | ||||||
| Binding site | 338 | 1 | Substrate; via amide nitrogen By similarity | ||||||
| Binding site | 339 | 1 | Substrate; via amide nitrogen By similarity | ||||||
| Binding site | 371 | 1 | Substrate By similarity | ||||||
| Binding site | 525 | 1 | Allosteric activator By similarity | ||||||
| Binding site | 532 | 1 | Allosteric activator By similarity | ||||||
| Site | 313 | 1 | Transition state stabilizer By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 43 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 348 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 556 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 33 | 33 | MSVQE…SGAPG → ME in isoform L-type. | VSP_002884 | |||||
Experimental info | |||||||||
| Sequence conflict | 130 | 1 | S → Y in AAA41882. Ref.1 | ||||||
| Sequence conflict | 130 | 1 | S → Y in AAA41883. Ref.1 | ||||||
| Sequence conflict | 322 | 1 | K → R in AAA41882. Ref.1 | ||||||
| Sequence conflict | 322 | 1 | K → R in AAA41883. Ref.1 | ||||||
| Sequence conflict | 498 | 1 | R → G in AAA41880. Ref.3 | ||||||
| Sequence conflict | 501 | 1 | Q → K in AAA41880. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The L- and R-type isozymes of rat pyruvate kinase are produced from a single gene by use of different promoters." Noguchi T., Yamada K., Inoue H., Matsuda T., Tanaka T. J. Biol. Chem. 262:14366-14371(1987) [PubMed: 3654663] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [2] | "Complete amino acid sequence of rat L-type pyruvate kinase deduced from the cDNA sequence." Inoue H., Noguchi T., Tanaka T. Eur. J. Biochem. 154:465-469(1986) [PubMed: 3002799] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [3] | "Complete nucleotide and deduced amino acid sequences of rat L-type pyruvate kinase." Lone Y.-C., Simon M.-P., Kahn A., Marie J. FEBS Lett. 195:97-100(1986) [PubMed: 3080337] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [4] | "Structure of the rat L-type pyruvate kinase gene." Cognet M., Lone Y.C., Vaulont S., Kahn A., Marie J. J. Mol. Biol. 196:11-25(1987) [PubMed: 3309348] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M17091 M17090 Genomic DNA. Translation: AAA41882.1. M17091 M17090 Genomic DNA. Translation: AAA41883.1. M17685 mRNA. Translation: AAA41881.1. X05684 Genomic DNA. Translation: CAA29169.1. M11709 mRNA. Translation: AAA41880.1. |
| IPI | IPI00202549. IPI00231683. |
| PIR | KIRTPR. A27427. KIRTPL. A92940. |
| RefSeq | NP_036756.3. |
| UniGene | Rn.48821 |
3D structure databases | |
| SMR | P12928. Positions 57-573. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P12928. |
PTM databases | |
| PhosphoSite | P12928. |
Proteomic databases | |
| PRIDE | P12928. |
Genome annotation databases | |
| Ensembl | ENSRNOT00000027700; ENSRNOP00000027700; ENSRNOG00000020420; Rattus norvegicus. [Genome view] |
| GeneID | 24651. |
| KEGG | rno:24651. |
| NMPDR | fig|10116.3.peg.16404. |
| UCSC | NM_012624. rat. |
Organism-specific databases | |
| CTD | 24651. |
| RGD | 3336. Pklr. |
Phylogenomic databases | |
| eggNOG | maNOG16019. |
| HOVERGEN | P12928. |
| InParanoid | P12928. |
| OMA | WVSKSQR. |
| OrthoDB | EOG9284MD. |
| PhylomeDB | P12928. |
Enzyme and pathway databases | |
| BRENDA | 2.7.1.40. 248. |
Gene expression databases | |
| ArrayExpress | P12928. |
| Genevestigator | P12928. |
| GermOnline | ENSRNOG00000020420. Rattus norvegicus. |
Family and domain databases | |
| InterPro | IPR001697. Pyr_Knase. IPR015813. Pyrv/PenolPyrv_Kinase_cat. IPR015794. Pyrv_Knase_a/b. IPR018209. Pyrv_Knase_AS. IPR011037. Pyrv_Knase_b-brl-like. IPR015793. Pyrv_Knase_brl. IPR015795. Pyrv_Knase_C-like. [Graphical view] |
| Gene3D | G3DSA:3.20.20.60. Pyrv/PenolPyrv_Kinase_cat. 1 hit. G3DSA:3.40.1380.20. Pyrv_Knase_a/b. 1 hit. |
| PANTHER | PTHR11817. Pyruvate_kinase. 1 hit. |
| Pfam | PF00224. PK. 1 hit. PF02887. PK_C. 1 hit. [Graphical view] |
| PRINTS | PR01050. PYRUVTKNASE. |
| TIGRFAMs | TIGR01064. pyruv_kin. 1 hit. |
| PROSITE | PS00110. PYRUVATE_KINASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | KPYR_RAT | ||||||||
| Accession | Primary (citable) accession number: P12928 Secondary accession number(s): P04763, Q64618 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with


