Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P12928 (KPYR_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 137. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Pyruvate kinase PKLR

EC=2.7.1.40
Alternative name(s):
L-PK
Pyruvate kinase isozymes L/R
Gene names
Name:Pklr
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length574 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Plays a key role in glycolysis By similarity.

Catalytic activity

ATP + pyruvate = ADP + phosphoenolpyruvate.

Cofactor

Magnesium.

Potassium.

Enzyme regulation

Allosterically activated by fructose 1,6-bisphosphate By similarity.

Pathway

Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 5/5.

Subunit structure

Homotetramer.

Miscellaneous

There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues.

Sequence similarities

Belongs to the pyruvate kinase family.

Ontologies

Keywords
   Biological processGlycolysis
   Coding sequence diversityAlternative splicing
   LigandATP-binding
Magnesium
Metal-binding
Nucleotide-binding
Potassium
Pyruvate
   Molecular functionKinase
Transferase
   Technical termAllosteric enzyme
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processATP biosynthetic process

Inferred from direct assay PubMed 4273555PubMed 5492954. Source: RGD

carbohydrate metabolic process

Inferred from direct assay PubMed 1834654. Source: RGD

cellular response to insulin stimulus

Inferred from direct assay PubMed 9395079. Source: RGD

glycolysis

Inferred from direct assay PubMed 4273555PubMed 4353083. Source: RGD

pyruvate biosynthetic process

Inferred from direct assay PubMed 4273555PubMed 5492954. Source: RGD

response to ATP

Inferred from direct assay PubMed 11104754. Source: RGD

response to cAMP

Inferred from direct assay PubMed 9395079. Source: RGD

response to glucose

Inferred from expression pattern PubMed 16644726. Source: RGD

response to heat

Inferred from direct assay PubMed 12417155. Source: RGD

response to hypoxia

Inferred from expression pattern PubMed 11356723. Source: RGD

response to lithium ion

Inferred from direct assay PubMed 10700396. Source: RGD

response to metal ion

Inferred from expression pattern PubMed 11357483. Source: RGD

response to nutrient

Inferred from expression pattern PubMed 11368649. Source: RGD

response to organic cyclic compound

Inferred from expression pattern PubMed 10620345. Source: RGD

response to other organism

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentcytosol

Inferred from direct assay PubMed 1834654. Source: RGD

   Molecular_functionATP binding

Inferred from electronic annotation. Source: UniProtKB-KW

magnesium ion binding

Inferred from electronic annotation. Source: InterPro

potassium ion binding

Inferred from electronic annotation. Source: InterPro

pyruvate kinase activity

Inferred from direct assay PubMed 18062843PubMed 1834654PubMed 4273555PubMed 4353083PubMed 5492954. Source: RGD

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform R-type (identifier: P12928-1)

Also known as: PKR;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform L-type (identifier: P12928-2)

Also known as: PKL;

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MSVQENTLPQQLWPWIFRSQKDLAKSALSGAPG → ME

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 574574Pyruvate kinase PKLR
PRO_0000112096

Regions

Region475 – 4806Allosteric activator binding By similarity
Region559 – 5646Allosteric activator binding By similarity

Sites

Metal binding1181Potassium By similarity
Metal binding1201Potassium By similarity
Metal binding1561Potassium By similarity
Metal binding1571Potassium; via carbonyl oxygen By similarity
Metal binding3151Magnesium By similarity
Metal binding3391Magnesium By similarity
Binding site1161Substrate By similarity
Binding site3381Substrate; via amide nitrogen By similarity
Binding site3391Substrate; via amide nitrogen By similarity
Binding site3711Substrate By similarity
Binding site5251Allosteric activator By similarity
Binding site5321Allosteric activator By similarity
Site3131Transition state stabilizer By similarity

Natural variations

Alternative sequence1 – 3333MSVQE…SGAPG → ME in isoform L-type.
VSP_002884

Experimental info

Sequence conflict1301S → Y in AAA41882. Ref.1
Sequence conflict1301S → Y in AAA41883. Ref.1
Sequence conflict3221K → R in AAA41882. Ref.1
Sequence conflict3221K → R in AAA41883. Ref.1
Sequence conflict4981R → G in AAA41880. Ref.3
Sequence conflict5011Q → K in AAA41880. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform R-type (PKR) [UniParc].

Last modified February 1, 1995. Version 2.
Checksum: 6BBC544653C51380

FASTA57462,200
        10         20         30         40         50         60 
MSVQENTLPQ QLWPWIFRSQ KDLAKSALSG APGGPAGYLR RASVAQLTQE LGTAFFQQQQ 

        70         80         90        100        110        120 
LPAAMADTFL EHLCLLDIDS QPVAARSTSI IATIGPASRS VDRLKEMIKA GMNIARLNFS 

       130        140        150        160        170        180 
HGSHEYHAES IANIREATES FATSPLSYRP VAIALDTKGP EIRTGVLQGG PESEVEIVKG 

       190        200        210        220        230        240 
SQVLVTVDPK FQTRGDAKTV WVDYHNITRV VAVGGRIYID DGLISLVVQK IGPEGLVTEV 

       250        260        270        280        290        300 
EHGGILGSRK GVNLPNTEVD LPGLSEQDLL DLRFGVQHNV DIIFASFVRK ASDVLAVRDA 

       310        320        330        340        350        360 
LGPEGQNIKI ISKIENHEGV KKFDEILEVS DGIMVARGDL GIEIPAEKVF LAQKMMIGRC 

       370        380        390        400        410        420 
NLAGKPVVCA TQMLESMITK ARPTRAETSD VANAVLDGAD CIMLSGETAK GSFPVEAVMM 

       430        440        450        460        470        480 
QHAIAREAEA AVYHRQLFEE LRRAAPLSRD PTEVTAIGAV EASFKCCAAA IIVLTKTGRS 

       490        500        510        520        530        540 
AQLLSQYRPR AAVIAVTRSA QAARQVHLSR GVFPLLYREP PEAIWADDVD RRVQFGIESG 

       550        560        570 
KLRGFLRVGD LVIVVTGWRP GSGYTNIMRV LSVS 

« Hide

Isoform L-type (PKL) [UniParc].

Checksum: E5472B97649E2A47
Show »

FASTA54358,794

References

[1]"The L- and R-type isozymes of rat pyruvate kinase are produced from a single gene by use of different promoters."
Noguchi T., Yamada K., Inoue H., Matsuda T., Tanaka T.
J. Biol. Chem. 262:14366-14371(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[2]"Complete amino acid sequence of rat L-type pyruvate kinase deduced from the cDNA sequence."
Inoue H., Noguchi T., Tanaka T.
Eur. J. Biochem. 154:465-469(1986) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
[3]"Complete nucleotide and deduced amino acid sequences of rat L-type pyruvate kinase."
Lone Y.-C., Simon M.-P., Kahn A., Marie J.
FEBS Lett. 195:97-100(1986) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
[4]"Structure of the rat L-type pyruvate kinase gene."
Cognet M., Lone Y.C., Vaulont S., Kahn A., Marie J.
J. Mol. Biol. 196:11-25(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M17091 expand/collapse EMBL AC list , M17088, M17089, M17090 Genomic DNA. Translation: AAA41882.1.
M17091 expand/collapse EMBL AC list , M17088, M17089, M17090 Genomic DNA. Translation: AAA41883.1.
M17685 mRNA. Translation: AAA41881.1.
X05684 Genomic DNA. Translation: CAA29169.1.
M11709 mRNA. Translation: AAA41880.1.
PIRKIRTPR. A27427.
KIRTPL. A92940.
RefSeqNP_036756.3. NM_012624.3.
XP_006232655.1. XM_006232593.1.
UniGeneRn.48821.

3D structure databases

ProteinModelPortalP12928.
SMRP12928. Positions 57-573.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActP12928. 1 interaction.

Chemistry

BindingDBP12928.
ChEMBLCHEMBL3089.

PTM databases

PhosphoSiteP12928.

Proteomic databases

PaxDbP12928.
PRIDEP12928.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSRNOT00000027700; ENSRNOP00000027700; ENSRNOG00000020420. [P12928-1]
ENSRNOT00000065791; ENSRNOP00000058886; ENSRNOG00000020420. [P12928-2]
GeneID24651.
KEGGrno:24651.
UCSCRGD:3336. rat. [P12928-1]

Organism-specific databases

CTD5313.
RGD3336. Pklr.

Phylogenomic databases

eggNOGCOG0469.
GeneTreeENSGT00390000008859.
HOGENOMHOG000021559.
HOVERGENHBG000941.
InParanoidP12928.
KOK12406.
OMAIHTIVKV.
OrthoDBEOG78M01Q.
PhylomeDBP12928.
TreeFamTF300390.

Enzyme and pathway databases

SABIO-RKP12928.
UniPathwayUPA00109; UER00188.

Gene expression databases

GenevestigatorP12928.

Family and domain databases

Gene3D2.40.33.10. 1 hit.
3.20.20.60. 2 hits.
3.40.1380.20. 1 hit.
InterProIPR001697. Pyr_Knase.
IPR015813. Pyrv/PenolPyrv_Kinase-like_dom.
IPR011037. Pyrv_Knase-like_insert_dom.
IPR015794. Pyrv_Knase_a/b.
IPR018209. Pyrv_Knase_AS.
IPR015793. Pyrv_Knase_brl.
IPR015795. Pyrv_Knase_C.
IPR015806. Pyrv_Knase_insert_dom.
[Graphical view]
PANTHERPTHR11817. PTHR11817. 1 hit.
PfamPF00224. PK. 1 hit.
PF02887. PK_C. 1 hit.
[Graphical view]
PRINTSPR01050. PYRUVTKNASE.
SUPFAMSSF50800. SSF50800. 1 hit.
SSF51621. SSF51621. 2 hits.
SSF52935. SSF52935. 1 hit.
TIGRFAMsTIGR01064. pyruv_kin. 1 hit.
PROSITEPS00110. PYRUVATE_KINASE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio603974.
PROP12928.

Entry information

Entry nameKPYR_RAT
AccessionPrimary (citable) accession number: P12928
Secondary accession number(s): P04763, Q64618
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: February 1, 1995
Last modified: April 16, 2014
This is version 137 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways