Reviewed,
UniProtKB/Swiss-Prot P12532 (KCRU_HUMAN)
Last modified
February 9, 2010.
Version 115.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Creatine kinase U-type, mitochondrial EC=2.7.3.2 Alternative name(s): Ubiquitous mitochondrial creatine kinase Short name=U-MtCK Acidic-type mitochondrial creatine kinase Short name=Mia-CK | |||||||||
| Gene names |
| |||||||||
| Organism | Homo sapiens (Human) [Complete proteome] | |||||||||
| Taxonomic identifier | 9606 [NCBI] | |||||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 417 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. |
| Catalytic activity | ATP + creatine = ADP + phosphocreatine. |
| Subunit structure | Exists as an octamer composed of four MTCK homodimers. Ref.9 |
| Subcellular location | Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side. |
| Miscellaneous | Mitochondrial creatine kinase binds cardiolipin. |
| Sequence similarities | Belongs to the ATP:guanido phosphotransferase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane Mitochondrion Mitochondrion inner membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transit peptide |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | creatine metabolic process Inferred from Experiment. Source: Reactome |
| Cellular component | extrinsic to membrane Inferred from electronic annotation. Source: UniProtKB-SubCell mitochondrial inner membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW creatine kinase activity Ref.1Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P12532-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P12532-2) The sequence of this isoform differs from the canonical sequence as follows: 50-50: S → SQTWPTGQLPGNCTRSRRLCPPSMVTGYPLPS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 39 | 39 | Mitochondrion | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 40 – 417 | 378 | Creatine kinase U-type, mitochondrial | PRO_0000016590 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 161 – 165 | 5 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 353 – 358 | 6 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 40 – 64 | 25 | Cardiolipin-binding By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 224 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 269 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 325 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 368 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 153 | 1 | Phosphotyrosine Ref.6 Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 50 | 1 | S → SQTWPTGQLPGNCTRSRRLC PPSMVTGYPLPS in isoform 2. | VSP_038045 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 176 | 1 | P → L in BAG58600. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 401 | 1 | E → G in BAD97085. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 49 – 52 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 62 – 66 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 69 – 75 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 86 – 95 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 100 – 102 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 114 – 117 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 119 – 129 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 130 – 132 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 135 – 137 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 146 – 148 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 156 – 158 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 159 – 168 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 176 – 178 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 181 – 195 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 202 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 204 – 208 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 209 – 211 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 214 – 222 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 233 – 236 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 237 – 247 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 249 – 253 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 258 – 277 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 279 – 298 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 299 – 301 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 308 – 310 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 317 – 319 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 325 – 331 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 333 – 337 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 341 – 348 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 350 – 353 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 359 – 361 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 364 – 372 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 375 – 377 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 379 – 400 | 22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 401 – 403 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of the gene and cDNA encoding human mitochondrial creatine kinase." Haas R.C., Korenfeld C., Zhang Z., Perryman B., Roman D., Strauss A.W. J. Biol. Chem. 264:2890-2897(1989) [PubMed: 2914937] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [2] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Colon and Hippocampus. |
| [4] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cerebellum. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and PNS. |
| [6] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-153, MASS SPECTROMETRY. |
| [7] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [8] | "An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells." Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A., Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D., Wiley H.S., Qian W.-J. J. Proteome Res. 8:3852-3861(2009) [PubMed: 19534553] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-153, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [9] | "Crystal structure of human ubiquitous mitochondrial creatine kinase." Eder M., Fritz-Wolf K., Kabsch W., Wallimann T., Schlattner U. Proteins 39:216-225(2000) [PubMed: 10737943] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 39-417, SUBUNIT. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | J04469 Genomic DNA. Translation: AAA98744.1. BT006628 mRNA. Translation: AAP35274.1. AK295776 mRNA. Translation: BAG58600.1. AK223365 mRNA. Translation: BAD97085.1. AK316124 mRNA. Translation: BAH14495.1. AK316319 mRNA. Translation: BAH14690.1. BC001926 mRNA. Translation: AAH01926.1. BC006467 mRNA. Translation: AAH06467.1. BC108652 mRNA. Translation: AAI08653.1. BC121001 mRNA. Translation: AAI21002.1. BC121002 mRNA. Translation: AAI21003.1. | ||||||||||||
| IPI | IPI00658109. IPI00877726. | ||||||||||||
| PIR | A30789. A31431. | ||||||||||||
| RefSeq | NP_001015001.1. NP_066270.1. | ||||||||||||
| UniGene | Hs.425633 Hs.654988 | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P12532. 4 interactions. | ||||||||||||
| STRING | P12532. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P12532. | ||||||||||||
Proteomic databases | |||||||||||||
| PeptideAtlas | P12532. | ||||||||||||
| PRIDE | P12532. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000300283; ENSP00000300283; ENSG00000237289; Homo sapiens. [Genome view] ENST00000381694; ENSP00000371113; ENSG00000223572; Homo sapiens. [Genome view] ENST00000413453; ENSP00000406577; ENSG00000223572; Homo sapiens. [Genome view] ENST00000413657; ENSP00000390428; ENSG00000237289; Homo sapiens. [Genome view] ENST00000424065; ENSP00000392779; ENSG00000223572; Homo sapiens. [Genome view] ENST00000434505; ENSP00000413165; ENSG00000223572; Homo sapiens. [Genome view] ENST00000441322; ENSP00000413255; ENSG00000237289; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 1159. 548596. | ||||||||||||
| KEGG | hsa:1159. hsa:548596. | ||||||||||||
| UCSC | uc001zsc.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 1159. 548596. | ||||||||||||
| GeneCards | GC15P041674. GC15P041772. GC15P041773. | ||||||||||||
| H-InvDB | HIX0012187. HIX0023245. | ||||||||||||
| HGNC | HGNC:31736. CKMT1A. HGNC:1995. CKMT1B. | ||||||||||||
| MIM | 123290. gene. | ||||||||||||
| PharmGKB | PA142672108. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG10393. | ||||||||||||
| HOVERGEN | P12532. | ||||||||||||
| InParanoid | P12532. | ||||||||||||
| OMA | ATGSVFD. | ||||||||||||
| OrthoDB | EOG986BZ7. | ||||||||||||
| PhylomeDB | P12532. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BioCyc | MetaCyc:MONOMER-14593. | ||||||||||||
| BRENDA | 2.7.3.2. 247. | ||||||||||||
| Reactome | REACT_13. Metabolism of amino acids. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P12532. | ||||||||||||
| Bgee | P12532. | ||||||||||||
| CleanEx | HS_CKMT1A. HS_CKMT1B. | ||||||||||||
| Genevestigator | P12532. | ||||||||||||
| GermOnline | ENSG00000166998. Homo sapiens. ENSG00000168775. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000749. ATP-guanido_PTrfase. IPR014746. Gln_synth/guanido_kin_cat_dom. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:1.10.135.10. ATP-gua_Ptrans. 1 hit. G3DSA:3.30.590.10. ATP-gua_Ptrans. 1 hit. | ||||||||||||
| PANTHER | PTHR11547. ATP-gua_Ptrans. 1 hit. | ||||||||||||
| Pfam | PF00217. ATP-gua_Ptrans. 1 hit. PF02807. ATP-gua_PtransN. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00112. GUANIDO_KINASE. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| DrugBank | DB00148. Creatine. | ||||||||||||
| NextBio | 4808. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | KCRU_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P12532 Secondary accession number(s): B4DIT8 Q53FC4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


