Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein L-Myc

Gene

MYCL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • DNA binding Source: UniProtKB
  • transcription factor activity, sequence-specific DNA binding Source: InterPro

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000116990-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein L-Myc
Alternative name(s):
Class E basic helix-loop-helix protein 38
Short name:
bHLHe38
Protein L-Myc-1
V-myc myelocytomatosis viral oncogene homolog
Gene namesi
Name:MYCL
Synonyms:BHLHE38, LMYC, MYCL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:7555. MYCL.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi4610.
OpenTargetsiENSG00000116990.
PharmGKBiPA31355.

Polymorphism and mutation databases

BioMutaiMYCL1.
DMDMi311033401.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001273331 – 364Protein L-MycAdd BLAST364

Proteomic databases

PaxDbiP12524.
PRIDEiP12524.

PTM databases

iPTMnetiP12524.
PhosphoSitePlusiP12524.

Expressioni

Gene expression databases

BgeeiENSG00000116990.
CleanExiHS_MYCL1.
ExpressionAtlasiP12524. baseline and differential.
GenevisibleiP12524. HS.

Organism-specific databases

HPAiHPA063132.

Interactioni

Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX.

Protein-protein interaction databases

BioGridi110695. 40 interactors.
IntActiP12524. 1 interactor.
STRINGi9606.ENSP00000380494.

Structurei

3D structure databases

ProteinModelPortaliP12524.
SMRiP12524.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini281 – 333bHLHPROSITE-ProRule annotationAdd BLAST53

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni333 – 361Leucine-zipperAdd BLAST29

Sequence similaritiesi

Contains 1 bHLH (basic helix-loop-helix) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IFII. Eukaryota.
ENOG410Y7JV. LUCA.
GeneTreeiENSGT00510000046414.
HOGENOMiHOG000043075.
HOVERGENiHBG000472.
InParanoidiP12524.
KOiK09110.
OMAiCPLAESK.
OrthoDBiEOG091G0ZJQ.
PhylomeDBiP12524.
TreeFamiTF106001.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
IPR002418. Tscrpt_reg_Myc.
IPR012682. Tscrpt_reg_Myc_N.
[Graphical view]
PfamiPF00010. HLH. 1 hit.
PF01056. Myc_N. 2 hits.
[Graphical view]
PRINTSiPR00044. LEUZIPPRMYC.
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P12524-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDYDSYQHYF YDYDCGEDFY RSTAPSEDIW KKFELVPSPP TSPPWGLGPG
60 70 80 90 100
AGDPAPGIGP PEPWPGGCTG DEAESRGHSK GWGRNYASII RRDCMWSGFS
110 120 130 140 150
ARERLERAVS DRLAPGAPRG NPPKASAAPD CTPSLEAGNP APAAPCPLGE
160 170 180 190 200
PKTQACSGSE SPSDSENEEI DVVTVEKRQS LGIRKPVTIT VRADPLDPCM
210 220 230 240 250
KHFHISIHQQ QHNYAARFPP ESCSQEEASE RGPQEEVLER DAAGEKEDEE
260 270 280 290 300
DEEIVSPPPV ESEAAQSCHP KPVSSDTEDV TKRKNHNFLE RKRRNDLRSR
310 320 330 340 350
FLALRDQVPT LASCSKAPKV VILSKALEYL QALVGAEKRM ATEKRQLRCR
360
QQQLQKRIAY LTGY
Length:364
Mass (Da):40,327
Last modified:November 2, 2010 - v2
Checksum:i58F8A30A1C2ED6D4
GO
Isoform 2 (identifier: P12524-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCVCAGCRAAPSRRGAGPLQVAGGWSEGADM
     166-206: ENEEIDVVTV...DPCMKHFHIS → GKDLPEPSKR...ALGPSPPLFG
     207-364: Missing.

Show »
Length:236
Mass (Da):24,682
Checksum:i5059EED93CE18391
GO
Isoform 3 (identifier: P12524-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCVCAGCRAAPSRRGAGPLQVAGGWSEGADM

Show »
Length:394
Mass (Da):43,243
Checksum:i518156A7EC80C6E2
GO

Sequence cautioni

The sequence AAH11864 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAA30248 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_027802362T → S.4 PublicationsCorresponds to variant rs3134614dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0537661M → MCVCAGCRAAPSRRGAGPLQ VAGGWSEGADM in isoform 2 and isoform 3. 2 Publications1
Alternative sequenceiVSP_015539166 – 206ENEEI…HFHIS → GKDLPEPSKRGPPHGWPKLC PCLRSGIGSSQALGPSPPLF G in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_015540207 – 364Missing in isoform 2. 1 PublicationAdd BLAST158

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X07262 Genomic DNA. Translation: CAA30248.1. Sequence problems.
X07263 Genomic DNA. Translation: CAA30249.1.
M19720 Genomic DNA. Translation: AAA59879.1.
M19720 Genomic DNA. Translation: AAA59878.1.
AK296078 mRNA. Translation: BAG58834.1.
AL033527 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07251.1.
BC011864 mRNA. Translation: AAH11864.1. Different initiation.
CCDSiCCDS30682.1. [P12524-1]
CCDS44117.2. [P12524-2]
CCDS53300.1. [P12524-3]
PIRiA27675. TVHUML.
RefSeqiNP_001028253.1. NM_001033081.2. [P12524-1]
NP_001028254.2. NM_001033082.2. [P12524-3]
NP_005367.2. NM_005376.4. [P12524-2]
UniGeneiHs.437922.

Genome annotation databases

EnsembliENST00000372815; ENSP00000361902; ENSG00000116990. [P12524-2]
ENST00000372816; ENSP00000361903; ENSG00000116990. [P12524-1]
ENST00000397332; ENSP00000380494; ENSG00000116990. [P12524-3]
GeneIDi4610.
KEGGihsa:4610.
UCSCiuc001cer.3. human. [P12524-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X07262 Genomic DNA. Translation: CAA30248.1. Sequence problems.
X07263 Genomic DNA. Translation: CAA30249.1.
M19720 Genomic DNA. Translation: AAA59879.1.
M19720 Genomic DNA. Translation: AAA59878.1.
AK296078 mRNA. Translation: BAG58834.1.
AL033527 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07251.1.
BC011864 mRNA. Translation: AAH11864.1. Different initiation.
CCDSiCCDS30682.1. [P12524-1]
CCDS44117.2. [P12524-2]
CCDS53300.1. [P12524-3]
PIRiA27675. TVHUML.
RefSeqiNP_001028253.1. NM_001033081.2. [P12524-1]
NP_001028254.2. NM_001033082.2. [P12524-3]
NP_005367.2. NM_005376.4. [P12524-2]
UniGeneiHs.437922.

3D structure databases

ProteinModelPortaliP12524.
SMRiP12524.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110695. 40 interactors.
IntActiP12524. 1 interactor.
STRINGi9606.ENSP00000380494.

PTM databases

iPTMnetiP12524.
PhosphoSitePlusiP12524.

Polymorphism and mutation databases

BioMutaiMYCL1.
DMDMi311033401.

Proteomic databases

PaxDbiP12524.
PRIDEiP12524.

Protocols and materials databases

DNASUi4610.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372815; ENSP00000361902; ENSG00000116990. [P12524-2]
ENST00000372816; ENSP00000361903; ENSG00000116990. [P12524-1]
ENST00000397332; ENSP00000380494; ENSG00000116990. [P12524-3]
GeneIDi4610.
KEGGihsa:4610.
UCSCiuc001cer.3. human. [P12524-1]

Organism-specific databases

CTDi4610.
DisGeNETi4610.
GeneCardsiMYCL.
HGNCiHGNC:7555. MYCL.
HPAiHPA063132.
MIMi164850. gene.
neXtProtiNX_P12524.
OpenTargetsiENSG00000116990.
PharmGKBiPA31355.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFII. Eukaryota.
ENOG410Y7JV. LUCA.
GeneTreeiENSGT00510000046414.
HOGENOMiHOG000043075.
HOVERGENiHBG000472.
InParanoidiP12524.
KOiK09110.
OMAiCPLAESK.
OrthoDBiEOG091G0ZJQ.
PhylomeDBiP12524.
TreeFamiTF106001.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000116990-MONOMER.

Miscellaneous databases

GeneWikiiMYCL1.
GenomeRNAii4610.
PROiP12524.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000116990.
CleanExiHS_MYCL1.
ExpressionAtlasiP12524. baseline and differential.
GenevisibleiP12524. HS.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
IPR002418. Tscrpt_reg_Myc.
IPR012682. Tscrpt_reg_Myc_N.
[Graphical view]
PfamiPF00010. HLH. 1 hit.
PF01056. Myc_N. 2 hits.
[Graphical view]
PRINTSiPR00044. LEUZIPPRMYC.
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMYCL_HUMAN
AccessioniPrimary (citable) accession number: P12524
Secondary accession number(s): A2A2C9
, B4DJH2, Q14897, Q5QPL0, Q5QPL1, Q9NUE9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: November 2, 2010
Last modified: November 30, 2016
This is version 157 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.