Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P12524

- MYCL_HUMAN

UniProt

P12524 - MYCL_HUMAN

Protein

Protein L-Myc

Gene

MYCL

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 139 (01 Oct 2014)
      Sequence version 2 (02 Nov 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB
    2. sequence-specific DNA binding transcription factor activity Source: InterPro

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein L-Myc
    Alternative name(s):
    Class E basic helix-loop-helix protein 38
    Short name:
    bHLHe38
    Protein L-Myc-1
    V-myc myelocytomatosis viral oncogene homolog
    Gene namesi
    Name:MYCL
    Synonyms:BHLHE38, LMYC, MYCL1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:7555. MYCL.

    Subcellular locationi

    Nucleus 1 PublicationPROSITE-ProRule annotation

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31355.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 364364Protein L-MycPRO_0000127333Add
    BLAST

    Proteomic databases

    PaxDbiP12524.
    PRIDEiP12524.

    PTM databases

    PhosphoSiteiP12524.

    Expressioni

    Gene expression databases

    ArrayExpressiP12524.
    BgeeiP12524.
    CleanExiHS_MYCL1.
    GenevestigatoriP12524.

    Interactioni

    Subunit structurei

    Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX.

    Protein-protein interaction databases

    BioGridi110695. 1 interaction.
    STRINGi9606.ENSP00000335376.

    Structurei

    3D structure databases

    ProteinModelPortaliP12524.
    SMRiP12524. Positions 282-363.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini281 – 33353bHLHPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni333 – 36129Leucine-zipperAdd
    BLAST

    Sequence similaritiesi

    Contains 1 bHLH (basic helix-loop-helix) domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG43031.
    HOGENOMiHOG000043075.
    HOVERGENiHBG000472.
    InParanoidiP12524.
    KOiK09110.
    OrthoDBiEOG7GJ6CX.
    PhylomeDBiP12524.
    TreeFamiTF106001.

    Family and domain databases

    Gene3Di4.10.280.10. 1 hit.
    InterProiIPR011598. bHLH_dom.
    IPR002418. Tscrpt_reg_Myc.
    IPR012682. Tscrpt_reg_Myc_N.
    [Graphical view]
    PfamiPF00010. HLH. 1 hit.
    PF01056. Myc_N. 2 hits.
    [Graphical view]
    PIRSFiPIRSF001705. Myc_protein. 1 hit.
    PRINTSiPR00044. LEUZIPPRMYC.
    SMARTiSM00353. HLH. 1 hit.
    [Graphical view]
    SUPFAMiSSF47459. SSF47459. 1 hit.
    PROSITEiPS50888. BHLH. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P12524-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDYDSYQHYF YDYDCGEDFY RSTAPSEDIW KKFELVPSPP TSPPWGLGPG    50
    AGDPAPGIGP PEPWPGGCTG DEAESRGHSK GWGRNYASII RRDCMWSGFS 100
    ARERLERAVS DRLAPGAPRG NPPKASAAPD CTPSLEAGNP APAAPCPLGE 150
    PKTQACSGSE SPSDSENEEI DVVTVEKRQS LGIRKPVTIT VRADPLDPCM 200
    KHFHISIHQQ QHNYAARFPP ESCSQEEASE RGPQEEVLER DAAGEKEDEE 250
    DEEIVSPPPV ESEAAQSCHP KPVSSDTEDV TKRKNHNFLE RKRRNDLRSR 300
    FLALRDQVPT LASCSKAPKV VILSKALEYL QALVGAEKRM ATEKRQLRCR 350
    QQQLQKRIAY LTGY 364
    Length:364
    Mass (Da):40,327
    Last modified:November 2, 2010 - v2
    Checksum:i58F8A30A1C2ED6D4
    GO
    Isoform 2 (identifier: P12524-2) [UniParc]FASTAAdd to Basket

    Also known as: Short

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MCVCAGCRAAPSRRGAGPLQVAGGWSEGADM
         166-206: ENEEIDVVTV...DPCMKHFHIS → GKDLPEPSKR...ALGPSPPLFG
         207-364: Missing.

    Show »
    Length:236
    Mass (Da):24,682
    Checksum:i5059EED93CE18391
    GO
    Isoform 3 (identifier: P12524-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MCVCAGCRAAPSRRGAGPLQVAGGWSEGADM

    Show »
    Length:394
    Mass (Da):43,243
    Checksum:i518156A7EC80C6E2
    GO

    Sequence cautioni

    The sequence AAH11864.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAA30248.1 differs from that shown. Reason: Erroneous gene model prediction.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti362 – 3621T → S.4 Publications
    Corresponds to variant rs3134614 [ dbSNP | Ensembl ].
    VAR_027802

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MCVCAGCRAAPSRRGAGPLQ VAGGWSEGADM in isoform 2 and isoform 3. 2 PublicationsVSP_053766
    Alternative sequencei166 – 20641ENEEI…HFHIS → GKDLPEPSKRGPPHGWPKLC PCLRSGIGSSQALGPSPPLF G in isoform 2. 1 PublicationVSP_015539Add
    BLAST
    Alternative sequencei207 – 364158Missing in isoform 2. 1 PublicationVSP_015540Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X07262 Genomic DNA. Translation: CAA30248.1. Sequence problems.
    X07263 Genomic DNA. Translation: CAA30249.1.
    M19720 Genomic DNA. Translation: AAA59879.1.
    M19720 Genomic DNA. Translation: AAA59878.1.
    AK296078 mRNA. Translation: BAG58834.1.
    AL033527 Genomic DNA. No translation available.
    CH471059 Genomic DNA. Translation: EAX07251.1.
    BC011864 mRNA. Translation: AAH11864.1. Different initiation.
    CCDSiCCDS30682.1. [P12524-1]
    CCDS44117.2. [P12524-2]
    CCDS53300.1. [P12524-3]
    PIRiA27675. TVHUML.
    RefSeqiNP_001028253.1. NM_001033081.2. [P12524-1]
    NP_001028254.2. NM_001033082.2. [P12524-3]
    NP_005367.2. NM_005376.4. [P12524-2]
    UniGeneiHs.437922.

    Genome annotation databases

    EnsembliENST00000372815; ENSP00000361902; ENSG00000116990. [P12524-2]
    ENST00000372816; ENSP00000361903; ENSG00000116990. [P12524-1]
    ENST00000397332; ENSP00000380494; ENSG00000116990. [P12524-3]
    GeneIDi4610.
    KEGGihsa:4610.
    UCSCiuc001cer.2. human.
    uc001ces.2. human. [P12524-1]
    uc001cet.2. human. [P12524-2]

    Polymorphism databases

    DMDMi311033401.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X07262 Genomic DNA. Translation: CAA30248.1 . Sequence problems.
    X07263 Genomic DNA. Translation: CAA30249.1 .
    M19720 Genomic DNA. Translation: AAA59879.1 .
    M19720 Genomic DNA. Translation: AAA59878.1 .
    AK296078 mRNA. Translation: BAG58834.1 .
    AL033527 Genomic DNA. No translation available.
    CH471059 Genomic DNA. Translation: EAX07251.1 .
    BC011864 mRNA. Translation: AAH11864.1 . Different initiation.
    CCDSi CCDS30682.1. [P12524-1 ]
    CCDS44117.2. [P12524-2 ]
    CCDS53300.1. [P12524-3 ]
    PIRi A27675. TVHUML.
    RefSeqi NP_001028253.1. NM_001033081.2. [P12524-1 ]
    NP_001028254.2. NM_001033082.2. [P12524-3 ]
    NP_005367.2. NM_005376.4. [P12524-2 ]
    UniGenei Hs.437922.

    3D structure databases

    ProteinModelPortali P12524.
    SMRi P12524. Positions 282-363.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110695. 1 interaction.
    STRINGi 9606.ENSP00000335376.

    PTM databases

    PhosphoSitei P12524.

    Polymorphism databases

    DMDMi 311033401.

    Proteomic databases

    PaxDbi P12524.
    PRIDEi P12524.

    Protocols and materials databases

    DNASUi 4610.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000372815 ; ENSP00000361902 ; ENSG00000116990 . [P12524-2 ]
    ENST00000372816 ; ENSP00000361903 ; ENSG00000116990 . [P12524-1 ]
    ENST00000397332 ; ENSP00000380494 ; ENSG00000116990 . [P12524-3 ]
    GeneIDi 4610.
    KEGGi hsa:4610.
    UCSCi uc001cer.2. human.
    uc001ces.2. human. [P12524-1 ]
    uc001cet.2. human. [P12524-2 ]

    Organism-specific databases

    CTDi 4610.
    GeneCardsi GC01M040362.
    HGNCi HGNC:7555. MYCL.
    MIMi 164850. gene.
    neXtProti NX_P12524.
    PharmGKBi PA31355.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG43031.
    HOGENOMi HOG000043075.
    HOVERGENi HBG000472.
    InParanoidi P12524.
    KOi K09110.
    OrthoDBi EOG7GJ6CX.
    PhylomeDBi P12524.
    TreeFami TF106001.

    Miscellaneous databases

    ChiTaRSi MYCL1. human.
    GeneWikii MYCL1.
    GenomeRNAii 4610.
    NextBioi 17746.
    PROi P12524.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P12524.
    Bgeei P12524.
    CleanExi HS_MYCL1.
    Genevestigatori P12524.

    Family and domain databases

    Gene3Di 4.10.280.10. 1 hit.
    InterProi IPR011598. bHLH_dom.
    IPR002418. Tscrpt_reg_Myc.
    IPR012682. Tscrpt_reg_Myc_N.
    [Graphical view ]
    Pfami PF00010. HLH. 1 hit.
    PF01056. Myc_N. 2 hits.
    [Graphical view ]
    PIRSFi PIRSF001705. Myc_protein. 1 hit.
    PRINTSi PR00044. LEUZIPPRMYC.
    SMARTi SM00353. HLH. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47459. SSF47459. 1 hit.
    PROSITEi PS50888. BHLH. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The human myc gene family: structure and activity of L-myc and an L-myc pseudogene."
      DePinho R.A., Hatton K.S., Tesfaye A., Yancopoulos G.D., Alt F.W.
      Genes Dev. 1:1311-1326(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT SER-362.
      Tissue: Placenta.
    2. "Structure and expression of the human L-myc gene reveal a complex pattern of alternative mRNA processing."
      Kaye F., Battey J., Nau M., Brooks B., Seifter E., de Greve J., Birrer M., Sausville E., Minna J.
      Mol. Cell. Biol. 8:186-195(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING, VARIANT SER-362.
      Tissue: Placenta.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT SER-362.
      Tissue: Thalamus.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT SER-362.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Placenta.
    7. "The human L-myc gene is expressed as two forms of protein in small cell lung carcinoma cell lines: detection by monoclonal antibodies specific to two myc homology box sequences."
      Ikegaki N., Minna J., Kennett R.H.
      EMBO J. 8:1793-1799(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 165-179 (ISOFORM 1), SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiMYCL_HUMAN
    AccessioniPrimary (citable) accession number: P12524
    Secondary accession number(s): A2A2C9
    , B4DJH2, Q14897, Q5QPL0, Q5QPL1, Q9NUE9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1989
    Last sequence update: November 2, 2010
    Last modified: October 1, 2014
    This is version 139 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3