Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein L-Myc

Gene

MYCL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein L-Myc
Alternative name(s):
Class E basic helix-loop-helix protein 38
Short name:
bHLHe38
Protein L-Myc-1
V-myc myelocytomatosis viral oncogene homolog
Gene namesi
Name:MYCL
Synonyms:BHLHE38, LMYC, MYCL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi

Organism-specific databases

EuPathDBiHostDB:ENSG00000116990.10
HGNCiHGNC:7555 MYCL
MIMi164850 gene
neXtProtiNX_P12524

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi4610
OpenTargetsiENSG00000116990
PharmGKBiPA31355

Polymorphism and mutation databases

BioMutaiMYCL1
DMDMi311033401

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001273331 – 364Protein L-MycAdd BLAST364

Proteomic databases

PaxDbiP12524
PeptideAtlasiP12524
PRIDEiP12524

PTM databases

iPTMnetiP12524
PhosphoSitePlusiP12524

Expressioni

Gene expression databases

BgeeiENSG00000116990
CleanExiHS_MYCL1
ExpressionAtlasiP12524 baseline and differential
GenevisibleiP12524 HS

Organism-specific databases

HPAiHPA063132

Interactioni

Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX.

GO - Molecular functioni

Protein-protein interaction databases

BioGridi110695, 40 interactors
IntActiP12524, 1 interactor
STRINGi9606.ENSP00000380494

Structurei

3D structure databases

ProteinModelPortaliP12524
SMRiP12524
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini281 – 333bHLHPROSITE-ProRule annotationAdd BLAST53

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni333 – 361Leucine-zipperAdd BLAST29

Phylogenomic databases

eggNOGiENOG410IFII Eukaryota
ENOG410Y7JV LUCA
GeneTreeiENSGT00510000046414
HOGENOMiHOG000043075
HOVERGENiHBG000472
InParanoidiP12524
KOiK09110
OMAiAWGRNYA
OrthoDBiEOG091G0ZJQ
PhylomeDBiP12524
TreeFamiTF106001

Family and domain databases

CDDicd00083 HLH, 1 hit
Gene3Di4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598 bHLH_dom
IPR036638 HLH_DNA-bd_sf
IPR002418 Tscrpt_reg_Myc
IPR012682 Tscrpt_reg_Myc_N
PfamiView protein in Pfam
PF00010 HLH, 1 hit
PF01056 Myc_N, 2 hits
PIRSFiPIRSF001705 Myc_protein, 1 hit
PRINTSiPR00044 LEUZIPPRMYC
SMARTiView protein in SMART
SM00353 HLH, 1 hit
SUPFAMiSSF47459 SSF47459, 1 hit
PROSITEiView protein in PROSITE
PS50888 BHLH, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P12524-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDYDSYQHYF YDYDCGEDFY RSTAPSEDIW KKFELVPSPP TSPPWGLGPG
60 70 80 90 100
AGDPAPGIGP PEPWPGGCTG DEAESRGHSK GWGRNYASII RRDCMWSGFS
110 120 130 140 150
ARERLERAVS DRLAPGAPRG NPPKASAAPD CTPSLEAGNP APAAPCPLGE
160 170 180 190 200
PKTQACSGSE SPSDSENEEI DVVTVEKRQS LGIRKPVTIT VRADPLDPCM
210 220 230 240 250
KHFHISIHQQ QHNYAARFPP ESCSQEEASE RGPQEEVLER DAAGEKEDEE
260 270 280 290 300
DEEIVSPPPV ESEAAQSCHP KPVSSDTEDV TKRKNHNFLE RKRRNDLRSR
310 320 330 340 350
FLALRDQVPT LASCSKAPKV VILSKALEYL QALVGAEKRM ATEKRQLRCR
360
QQQLQKRIAY LTGY
Length:364
Mass (Da):40,327
Last modified:November 2, 2010 - v2
Checksum:i58F8A30A1C2ED6D4
GO
Isoform 2 (identifier: P12524-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCVCAGCRAAPSRRGAGPLQVAGGWSEGADM
     166-206: ENEEIDVVTV...DPCMKHFHIS → GKDLPEPSKR...ALGPSPPLFG
     207-364: Missing.

Show »
Length:236
Mass (Da):24,682
Checksum:i5059EED93CE18391
GO
Isoform 3 (identifier: P12524-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCVCAGCRAAPSRRGAGPLQVAGGWSEGADM

Show »
Length:394
Mass (Da):43,243
Checksum:i518156A7EC80C6E2
GO

Sequence cautioni

The sequence AAH11864 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAA30248 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_027802362T → S4 PublicationsCorresponds to variant dbSNP:rs3134614Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0537661M → MCVCAGCRAAPSRRGAGPLQ VAGGWSEGADM in isoform 2 and isoform 3. 2 Publications1
Alternative sequenceiVSP_015539166 – 206ENEEI…HFHIS → GKDLPEPSKRGPPHGWPKLC PCLRSGIGSSQALGPSPPLF G in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_015540207 – 364Missing in isoform 2. 1 PublicationAdd BLAST158

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X07262 Genomic DNA Translation: CAA30248.1 Sequence problems.
X07263 Genomic DNA Translation: CAA30249.1
M19720 Genomic DNA Translation: AAA59879.1
M19720 Genomic DNA Translation: AAA59878.1
AK296078 mRNA Translation: BAG58834.1
AL033527 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07251.1
BC011864 mRNA Translation: AAH11864.1 Different initiation.
CCDSiCCDS30682.1 [P12524-1]
CCDS44117.2 [P12524-2]
CCDS53300.1 [P12524-3]
PIRiA27675 TVHUML
RefSeqiNP_001028253.1, NM_001033081.2 [P12524-1]
NP_001028254.2, NM_001033082.2 [P12524-3]
NP_005367.2, NM_005376.4 [P12524-2]
UniGeneiHs.437922

Genome annotation databases

EnsembliENST00000372815; ENSP00000361902; ENSG00000116990 [P12524-2]
ENST00000372816; ENSP00000361903; ENSG00000116990 [P12524-1]
ENST00000397332; ENSP00000380494; ENSG00000116990 [P12524-3]
GeneIDi4610
KEGGihsa:4610
UCSCiuc001cer.3 human [P12524-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Entry informationi

Entry nameiMYCL_HUMAN
AccessioniPrimary (citable) accession number: P12524
Secondary accession number(s): A2A2C9
, B4DJH2, Q14897, Q5QPL0, Q5QPL1, Q9NUE9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: November 2, 2010
Last modified: May 23, 2018
This is version 169 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health