Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein L-Myc

Gene

MYCL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. DNA binding Source: UniProtKB
  2. sequence-specific DNA binding transcription factor activity Source: InterPro
Complete GO annotation...

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein L-Myc
Alternative name(s):
Class E basic helix-loop-helix protein 38
Short name:
bHLHe38
Protein L-Myc-1
V-myc myelocytomatosis viral oncogene homolog
Gene namesi
Name:MYCL
Synonyms:BHLHE38, LMYC, MYCL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:7555. MYCL.

Subcellular locationi

Nucleus 1 PublicationPROSITE-ProRule annotation

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31355.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 364364Protein L-MycPRO_0000127333Add
BLAST

Proteomic databases

PaxDbiP12524.
PRIDEiP12524.

PTM databases

PhosphoSiteiP12524.

Expressioni

Gene expression databases

BgeeiP12524.
CleanExiHS_MYCL1.
ExpressionAtlasiP12524. baseline and differential.
GenevestigatoriP12524.

Interactioni

Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX.

Protein-protein interaction databases

BioGridi110695. 1 interaction.
STRINGi9606.ENSP00000335376.

Structurei

3D structure databases

ProteinModelPortaliP12524.
SMRiP12524. Positions 282-363.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini281 – 33353bHLHPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni333 – 36129Leucine-zipperAdd
BLAST

Sequence similaritiesi

Contains 1 bHLH (basic helix-loop-helix) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG43031.
GeneTreeiENSGT00510000046414.
HOGENOMiHOG000043075.
HOVERGENiHBG000472.
InParanoidiP12524.
KOiK09110.
OMAiEAAQSCH.
OrthoDBiEOG7GJ6CX.
PhylomeDBiP12524.
TreeFamiTF106001.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
IPR002418. Tscrpt_reg_Myc.
IPR012682. Tscrpt_reg_Myc_N.
[Graphical view]
PfamiPF00010. HLH. 1 hit.
PF01056. Myc_N. 2 hits.
[Graphical view]
PIRSFiPIRSF001705. Myc_protein. 1 hit.
PRINTSiPR00044. LEUZIPPRMYC.
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P12524-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDYDSYQHYF YDYDCGEDFY RSTAPSEDIW KKFELVPSPP TSPPWGLGPG
60 70 80 90 100
AGDPAPGIGP PEPWPGGCTG DEAESRGHSK GWGRNYASII RRDCMWSGFS
110 120 130 140 150
ARERLERAVS DRLAPGAPRG NPPKASAAPD CTPSLEAGNP APAAPCPLGE
160 170 180 190 200
PKTQACSGSE SPSDSENEEI DVVTVEKRQS LGIRKPVTIT VRADPLDPCM
210 220 230 240 250
KHFHISIHQQ QHNYAARFPP ESCSQEEASE RGPQEEVLER DAAGEKEDEE
260 270 280 290 300
DEEIVSPPPV ESEAAQSCHP KPVSSDTEDV TKRKNHNFLE RKRRNDLRSR
310 320 330 340 350
FLALRDQVPT LASCSKAPKV VILSKALEYL QALVGAEKRM ATEKRQLRCR
360
QQQLQKRIAY LTGY
Length:364
Mass (Da):40,327
Last modified:November 2, 2010 - v2
Checksum:i58F8A30A1C2ED6D4
GO
Isoform 2 (identifier: P12524-2) [UniParc]FASTAAdd to Basket

Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCVCAGCRAAPSRRGAGPLQVAGGWSEGADM
     166-206: ENEEIDVVTV...DPCMKHFHIS → GKDLPEPSKR...ALGPSPPLFG
     207-364: Missing.

Show »
Length:236
Mass (Da):24,682
Checksum:i5059EED93CE18391
GO
Isoform 3 (identifier: P12524-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCVCAGCRAAPSRRGAGPLQVAGGWSEGADM

Show »
Length:394
Mass (Da):43,243
Checksum:i518156A7EC80C6E2
GO

Sequence cautioni

The sequence AAH11864.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAA30248.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti362 – 3621T → S.4 Publications
Corresponds to variant rs3134614 [ dbSNP | Ensembl ].
VAR_027802

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MCVCAGCRAAPSRRGAGPLQ VAGGWSEGADM in isoform 2 and isoform 3. 2 PublicationsVSP_053766
Alternative sequencei166 – 20641ENEEI…HFHIS → GKDLPEPSKRGPPHGWPKLC PCLRSGIGSSQALGPSPPLF G in isoform 2. 1 PublicationVSP_015539Add
BLAST
Alternative sequencei207 – 364158Missing in isoform 2. 1 PublicationVSP_015540Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X07262 Genomic DNA. Translation: CAA30248.1. Sequence problems.
X07263 Genomic DNA. Translation: CAA30249.1.
M19720 Genomic DNA. Translation: AAA59879.1.
M19720 Genomic DNA. Translation: AAA59878.1.
AK296078 mRNA. Translation: BAG58834.1.
AL033527 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07251.1.
BC011864 mRNA. Translation: AAH11864.1. Different initiation.
CCDSiCCDS30682.1. [P12524-1]
CCDS44117.2. [P12524-2]
CCDS53300.1. [P12524-3]
PIRiA27675. TVHUML.
RefSeqiNP_001028253.1. NM_001033081.2. [P12524-1]
NP_001028254.2. NM_001033082.2. [P12524-3]
NP_005367.2. NM_005376.4. [P12524-2]
UniGeneiHs.437922.

Genome annotation databases

EnsembliENST00000372815; ENSP00000361902; ENSG00000116990. [P12524-2]
ENST00000372816; ENSP00000361903; ENSG00000116990. [P12524-1]
ENST00000397332; ENSP00000380494; ENSG00000116990. [P12524-3]
GeneIDi4610.
KEGGihsa:4610.
UCSCiuc001cer.2. human.
uc001ces.2. human. [P12524-1]
uc001cet.2. human. [P12524-2]

Polymorphism databases

DMDMi311033401.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X07262 Genomic DNA. Translation: CAA30248.1. Sequence problems.
X07263 Genomic DNA. Translation: CAA30249.1.
M19720 Genomic DNA. Translation: AAA59879.1.
M19720 Genomic DNA. Translation: AAA59878.1.
AK296078 mRNA. Translation: BAG58834.1.
AL033527 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07251.1.
BC011864 mRNA. Translation: AAH11864.1. Different initiation.
CCDSiCCDS30682.1. [P12524-1]
CCDS44117.2. [P12524-2]
CCDS53300.1. [P12524-3]
PIRiA27675. TVHUML.
RefSeqiNP_001028253.1. NM_001033081.2. [P12524-1]
NP_001028254.2. NM_001033082.2. [P12524-3]
NP_005367.2. NM_005376.4. [P12524-2]
UniGeneiHs.437922.

3D structure databases

ProteinModelPortaliP12524.
SMRiP12524. Positions 282-363.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110695. 1 interaction.
STRINGi9606.ENSP00000335376.

PTM databases

PhosphoSiteiP12524.

Polymorphism databases

DMDMi311033401.

Proteomic databases

PaxDbiP12524.
PRIDEiP12524.

Protocols and materials databases

DNASUi4610.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372815; ENSP00000361902; ENSG00000116990. [P12524-2]
ENST00000372816; ENSP00000361903; ENSG00000116990. [P12524-1]
ENST00000397332; ENSP00000380494; ENSG00000116990. [P12524-3]
GeneIDi4610.
KEGGihsa:4610.
UCSCiuc001cer.2. human.
uc001ces.2. human. [P12524-1]
uc001cet.2. human. [P12524-2]

Organism-specific databases

CTDi4610.
GeneCardsiGC01M040362.
HGNCiHGNC:7555. MYCL.
MIMi164850. gene.
neXtProtiNX_P12524.
PharmGKBiPA31355.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG43031.
GeneTreeiENSGT00510000046414.
HOGENOMiHOG000043075.
HOVERGENiHBG000472.
InParanoidiP12524.
KOiK09110.
OMAiEAAQSCH.
OrthoDBiEOG7GJ6CX.
PhylomeDBiP12524.
TreeFamiTF106001.

Miscellaneous databases

GeneWikiiMYCL1.
GenomeRNAii4610.
NextBioi17746.
PROiP12524.
SOURCEiSearch...

Gene expression databases

BgeeiP12524.
CleanExiHS_MYCL1.
ExpressionAtlasiP12524. baseline and differential.
GenevestigatoriP12524.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
IPR002418. Tscrpt_reg_Myc.
IPR012682. Tscrpt_reg_Myc_N.
[Graphical view]
PfamiPF00010. HLH. 1 hit.
PF01056. Myc_N. 2 hits.
[Graphical view]
PIRSFiPIRSF001705. Myc_protein. 1 hit.
PRINTSiPR00044. LEUZIPPRMYC.
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The human myc gene family: structure and activity of L-myc and an L-myc pseudogene."
    DePinho R.A., Hatton K.S., Tesfaye A., Yancopoulos G.D., Alt F.W.
    Genes Dev. 1:1311-1326(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT SER-362.
    Tissue: Placenta.
  2. "Structure and expression of the human L-myc gene reveal a complex pattern of alternative mRNA processing."
    Kaye F., Battey J., Nau M., Brooks B., Seifter E., de Greve J., Birrer M., Sausville E., Minna J.
    Mol. Cell. Biol. 8:186-195(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING, VARIANT SER-362.
    Tissue: Placenta.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT SER-362.
    Tissue: Thalamus.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT SER-362.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Placenta.
  7. "The human L-myc gene is expressed as two forms of protein in small cell lung carcinoma cell lines: detection by monoclonal antibodies specific to two myc homology box sequences."
    Ikegaki N., Minna J., Kennett R.H.
    EMBO J. 8:1793-1799(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 165-179 (ISOFORM 1), SUBCELLULAR LOCATION.

Entry informationi

Entry nameiMYCL_HUMAN
AccessioniPrimary (citable) accession number: P12524
Secondary accession number(s): A2A2C9
, B4DJH2, Q14897, Q5QPL0, Q5QPL1, Q9NUE9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: November 2, 2010
Last modified: January 7, 2015
This is version 142 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.