Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P12524 (MYCL_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 137. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein L-Myc
Alternative name(s):
Class E basic helix-loop-helix protein 38
Short name=bHLHe38
Protein L-Myc-1
V-myc myelocytomatosis viral oncogene homolog
Gene names
Name:MYCL
Synonyms:BHLHE38, LMYC, MYCL1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length364 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subunit structure

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX.

Subcellular location

Nucleus Ref.7.

Sequence similarities

Contains 1 bHLH (basic helix-loop-helix) domain.

Sequence caution

The sequence AAH11864.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence CAA30248.1 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Keywords
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandDNA-binding
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionDNA binding

Non-traceable author statement Ref.1. Source: UniProtKB

sequence-specific DNA binding transcription factor activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P12524-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P12524-2)

Also known as: Short;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCVCAGCRAAPSRRGAGPLQVAGGWSEGADM
     166-206: ENEEIDVVTV...DPCMKHFHIS → GKDLPEPSKR...ALGPSPPLFG
     207-364: Missing.
Isoform 3 (identifier: P12524-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCVCAGCRAAPSRRGAGPLQVAGGWSEGADM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 364364Protein L-Myc
PRO_0000127333

Regions

Domain281 – 33353bHLH
Region333 – 36129Leucine-zipper

Natural variations

Alternative sequence11M → MCVCAGCRAAPSRRGAGPLQ VAGGWSEGADM in isoform 2 and isoform 3.
VSP_053766
Alternative sequence166 – 20641ENEEI…HFHIS → GKDLPEPSKRGPPHGWPKLC PCLRSGIGSSQALGPSPPLF G in isoform 2.
VSP_015539
Alternative sequence207 – 364158Missing in isoform 2.
VSP_015540
Natural variant3621T → S. Ref.1 Ref.2 Ref.3 Ref.5
Corresponds to variant rs3134614 [ dbSNP | Ensembl ].
VAR_027802

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 2, 2010. Version 2.
Checksum: 58F8A30A1C2ED6D4

FASTA36440,327
        10         20         30         40         50         60 
MDYDSYQHYF YDYDCGEDFY RSTAPSEDIW KKFELVPSPP TSPPWGLGPG AGDPAPGIGP 

        70         80         90        100        110        120 
PEPWPGGCTG DEAESRGHSK GWGRNYASII RRDCMWSGFS ARERLERAVS DRLAPGAPRG 

       130        140        150        160        170        180 
NPPKASAAPD CTPSLEAGNP APAAPCPLGE PKTQACSGSE SPSDSENEEI DVVTVEKRQS 

       190        200        210        220        230        240 
LGIRKPVTIT VRADPLDPCM KHFHISIHQQ QHNYAARFPP ESCSQEEASE RGPQEEVLER 

       250        260        270        280        290        300 
DAAGEKEDEE DEEIVSPPPV ESEAAQSCHP KPVSSDTEDV TKRKNHNFLE RKRRNDLRSR 

       310        320        330        340        350        360 
FLALRDQVPT LASCSKAPKV VILSKALEYL QALVGAEKRM ATEKRQLRCR QQQLQKRIAY 


LTGY 

« Hide

Isoform 2 (Short) [UniParc].

Checksum: 5059EED93CE18391
Show »

FASTA23624,682
Isoform 3 [UniParc].

Checksum: 518156A7EC80C6E2
Show »

FASTA39443,243

References

« Hide 'large scale' references
[1]"The human myc gene family: structure and activity of L-myc and an L-myc pseudogene."
DePinho R.A., Hatton K.S., Tesfaye A., Yancopoulos G.D., Alt F.W.
Genes Dev. 1:1311-1326(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT SER-362.
Tissue: Placenta.
[2]"Structure and expression of the human L-myc gene reveal a complex pattern of alternative mRNA processing."
Kaye F., Battey J., Nau M., Brooks B., Seifter E., de Greve J., Birrer M., Sausville E., Minna J.
Mol. Cell. Biol. 8:186-195(1988) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING, VARIANT SER-362.
Tissue: Placenta.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT SER-362.
Tissue: Thalamus.
[4]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT SER-362.
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Placenta.
[7]"The human L-myc gene is expressed as two forms of protein in small cell lung carcinoma cell lines: detection by monoclonal antibodies specific to two myc homology box sequences."
Ikegaki N., Minna J., Kennett R.H.
EMBO J. 8:1793-1799(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 165-179 (ISOFORM 1), SUBCELLULAR LOCATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X07262 Genomic DNA. Translation: CAA30248.1. Sequence problems.
X07263 Genomic DNA. Translation: CAA30249.1.
M19720 Genomic DNA. Translation: AAA59879.1.
M19720 Genomic DNA. Translation: AAA59878.1.
AK296078 mRNA. Translation: BAG58834.1.
AL033527 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07251.1.
BC011864 mRNA. Translation: AAH11864.1. Different initiation.
CCDSCCDS30682.1. [P12524-1]
PIRTVHUML. A27675.
RefSeqNP_001028253.1. NM_001033081.2. [P12524-1]
NP_001028254.2. NM_001033082.2. [P12524-3]
NP_005367.2. NM_005376.4. [P12524-2]
UniGeneHs.437922.

3D structure databases

ProteinModelPortalP12524.
SMRP12524. Positions 282-363.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110695. 1 interaction.
STRING9606.ENSP00000335376.

PTM databases

PhosphoSiteP12524.

Polymorphism databases

DMDM311033401.

Proteomic databases

PaxDbP12524.
PRIDEP12524.

Protocols and materials databases

DNASU4610.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000372816; ENSP00000361903; ENSG00000116990. [P12524-1]
ENST00000429311; ENSP00000389358; ENSG00000116990. [P12524-2]
GeneID4610.
KEGGhsa:4610.
UCSCuc001ces.2. human. [P12524-1]
uc001cet.2. human. [P12524-2]

Organism-specific databases

CTD4610.
GeneCardsGC01M040362.
HGNCHGNC:7555. MYCL.
MIM164850. gene.
neXtProtNX_P12524.
PharmGKBPA31355.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG43031.
HOGENOMHOG000043075.
HOVERGENHBG000472.
InParanoidP12524.
KOK09110.
OrthoDBEOG7GJ6CX.
PhylomeDBP12524.
TreeFamTF106001.

Gene expression databases

ArrayExpressP12524.
BgeeP12524.
CleanExHS_MYCL1.
GenevestigatorP12524.

Family and domain databases

Gene3D4.10.280.10. 1 hit.
InterProIPR011598. bHLH_dom.
IPR002418. Tscrpt_reg_Myc.
IPR012682. Tscrpt_reg_Myc_N.
[Graphical view]
PfamPF00010. HLH. 1 hit.
PF01056. Myc_N. 2 hits.
[Graphical view]
PIRSFPIRSF001705. Myc_protein. 1 hit.
PRINTSPR00044. LEUZIPPRMYC.
SMARTSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMSSF47459. SSF47459. 1 hit.
PROSITEPS50888. BHLH. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSMYCL1. human.
GeneWikiMYCL1.
GenomeRNAi4610.
NextBio17746.
PROP12524.
SOURCESearch...

Entry information

Entry nameMYCL_HUMAN
AccessionPrimary (citable) accession number: P12524
Secondary accession number(s): A2A2C9 expand/collapse secondary AC list , B4DJH2, Q14897, Q5QPL0, Q5QPL1, Q9NUE9
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: November 2, 2010
Last modified: July 9, 2014
This is version 137 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM