@prefix @prefix rdf @prefix rdfs @prefix owl @prefix skos @prefix bibo @prefix dcterms @prefix uniprot @prefix keyword @prefix taxon @prefix tissue @prefix location @prefix enzyme @prefix citation @prefix annotation @prefix isoform @prefix go uniprot:P12345 rdf:type Protein reviewed true created 1989-10-01 modified 2011-11-16 version 75 mnemonic "AATM_RABIT" citation citation:4030726 rdf:type Journal_Citation title "Aspartate aminotransferase isozymes from rabbit liver. Purification and properties." author "Kuramitsu S." author "Inoue K." author "Kondo K." author "Aki K." author "Kagamiyama H." skos:exactMatch skos:exactMatch date 1985 name "J. Biochem." volume 97 pages "1337-1345" +rdf:type Citation_Statement +scope "PROTEIN SEQUENCE" +context rdf:type Tissue rdfs:label "Liver" rdfs:seeAlso rdf:type Resource database rdfs:seeAlso rdf:type Resource database rdfs:seeAlso rdf:type Resource database rdfs:comment "1-30" rdfs:seeAlso rdf:type Resource database rdfs:seeAlso rdf:type Resource database rdfs:seeAlso rdf:type Resource database rdfs:seeAlso rdf:type Resource database rdfs:seeAlso rdf:type Resource database rdfs:comment "Asp_trans" rdfs:seeAlso rdf:type Resource database rdfs:comment "PyrdxlP-dep_Trfase_major_sub2" rdfs:seeAlso rdf:type Resource database rdfs:comment "PyrdxlP-dep_Trfase_major_sub2" +rdf:type Domain_Assignment_Statement +hits 1 rdfs:seeAlso rdf:type Resource database rdfs:comment "Asp_trans" +rdf:type Domain_Assignment_Statement +hits 1 rdfs:seeAlso rdf:type Resource database rdfs:comment "AA_TRANSFER_CLASS_1" +rdf:type Domain_Assignment_Statement +partial true recommendedName rdf:type Structured_Name fullName "Aspartate aminotransferase, mitochondrial" shortName "mAspAT" ecName "2.6.1.1" alternativeName rdf:type Structured_Name fullName "Fatty acid-binding protein" shortName "FABP-1" alternativeName rdf:type Structured_Name fullName "Glutamate oxaloacetate transaminase 2" alternativeName rdf:type Structured_Name fullName "Plasma membrane-associated fatty acid-binding protein" shortName "FABPpm" alternativeName rdf:type Structured_Name fullName "Transaminase A" enzyme enzyme:2.6.1.1 organism taxon:9986 isolatedFrom tissue:564 +citation citation:4030726 encodedBy rdf:type Gene skos:prefLabel "GOT2" annotation rdf:type Function_Annotation rdfs:comment "Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids (By similarity)." annotation rdf:type Catalytic_Activity_Annotation rdfs:comment "L-aspartate + 2-oxoglutarate = oxaloacetate + L-glutamate." annotation rdf:type Cofactor_Annotation rdfs:comment "Pyridoxal phosphate." annotation rdf:type Subunit_Annotation rdfs:comment "Homodimer." annotation rdf:type Subcellular_Location_Annotation locatedIn cellularComponent location:170 locatedIn cellularComponent location:39 +status By_Similarity annotation rdf:type Annotation rdfs:comment "In eukaryotes there are cytoplasmic, mitochondrial and chloroplastic isozymes." annotation rdf:type Similarity_Annotation rdfs:comment "Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family." annotation annotation:PRO_0000123886 rdf:type Chain_Annotation rdfs:comment "Aspartate aminotransferase, mitochondrial" range rdf:type Range begin 1 end 30 +rdf:type Endpoint_Statement +limit false annotation rdf:type Non-terminal_Residue_Annotation range rdf:type Range begin 30 end 30 existence Evidence_at_Protein_Level_Existence classifiedWith keyword:32 classifiedWith keyword:1003 classifiedWith keyword:181 classifiedWith keyword:903 classifiedWith keyword:445 classifiedWith keyword:496 classifiedWith keyword:663 classifiedWith go:0005759 +attribution :1 dcterms:creator evidence classifiedWith go:0005886 +attribution :2 dcterms:creator evidence classifiedWith go:0004069 +attribution :3 dcterms:creator evidence classifiedWith go:0080130 +attribution :4 dcterms:creator evidence classifiedWith go:0030170 +attribution :5 dcterms:creator evidence classifiedWith go:0006457 +attribution :6 dcterms:creator evidence attribution :1 attribution :2 attribution :3 attribution :4 attribution :5 attribution :6 sequence isoform:P12345-1 rdf:type Simple_Sequence modified 1989-10-01 version 1 fragment "single" mass 3401 crc64Checksum "410321530B95B673" rdf:value "SSWWAHVEMGPPDPILGVTEAYKRDTNSKK"