Reviewed,
UniProtKB/Swiss-Prot P12272 (PTHR_HUMAN)
Last modified
June 16, 2009.
Version 109.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Parathyroid hormone-related protein Short name=PTH-rP Short name=PTHrP Cleaved into the following 3 chains: 1- Recommended name: PTHrP[1-36] 2- Recommended name: PTHrP[38-94] 3- Recommended name: Osteostatin Alternative name(s): PTHrP[107-139] | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 177 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Osteostatin is a potent inhibitor of osteoclastic bone resorption. |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Also expressed in the mammary gland. |
| Post-translational modification | There are 3 principal secretory forms, called PTHrP[1-36], PTHrP[38-94], and osteostatin (PTHrP[107-139]) arising from endoproteolytic cleavage of the initial translation product. Each of these secretory forms is believed to have one or more of its own receptors that mediates the normal paracrine, autocrine and endocrine actions. |
| Involvement in disease | Produced by many tumors from patients with HHM (humoral hypercalcemia of malignancy). |
| Sequence similarities | Belongs to the parathyroid hormone family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P12272-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P12272-2) The sequence of this isoform differs from the canonical sequence as follows: 176-177: Missing. | ||||||
| Isoform 3 (identifier: P12272-3) The sequence of this isoform differs from the canonical sequence as follows: 176-177: RH → TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||
Molecule processing | ||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Potential | |||||||||||||
| Propeptide | 25 – 34 | 10 | PRO_0000023224 | |||||||||||||
| Chain | 37 – 177 | 141 | Parathyroid hormone-related protein | PRO_0000023225 | ||||||||||||
| Peptide | 37 – 72 | 36 | PTHrP[1-36] | PRO_0000023226 | ||||||||||||
| Peptide | 74 – 130 | 57 | PTHrP[38-94] | PRO_0000023227 | ||||||||||||
| Peptide | 143 – 175 | 33 | Osteostatin | PRO_0000023228 | ||||||||||||
Regions | ||||||||||||||||
| Motif | 108 – 129 | 22 | Nuclear localization signal Ref.14 | |||||||||||||
Natural variations | ||||||||||||||||
| Alternative sequence | 176 – 177 | 2 | Missing in isoform 2. | VSP_004534 | ||||||||||||
| Alternative sequence | 176 – 177 | 2 | RH → TALLWGLKKKKENNRRTHHM QLMISLFKSPLLLL in isoform 3. | VSP_004535 | ||||||||||||
| Natural variant | 169 | 1 | S → T in a breast cancer sample; somatic mutation. Ref.18 | VAR_036433 | ||||||||||||
Secondary structure | ||||||||||||||||
Helix Strand Turn | ||||||||||||||||
| Helix | 41 – 44 | 4 | ||||||||||||||
| Helix | 52 – 63 | 12 | ||||||||||||||
| Beta strand | 114 – 116 | 3 | ||||||||||||||
| Helix | 117 – 119 | 3 | ||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A parathyroid hormone-related protein implicated in malignant hypercalcemia: cloning and expression." Suva L.J., Winslow G.A., Wettenhall R.E.H., Hammonds R.G., Moseley J.M., Diefenbach-Jagger H., Rodda C.P., Kemp B.E., Rodriguez H., Chen E.Y., Hudson P.J., Martin T.J., Wood W.I. Science 237:893-896(1987) [PubMed: 3616618] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PARTIAL PROTEIN SEQUENCE. |
| [2] | "Identification of a cDNA encoding a parathyroid hormone-like peptide from a human tumor associated with humoral hypercalcemia of malignancy." Mangin M., Webb A.C., Dreyer B.E., Posillico J.T., Ikeda K., Weir E.C., Stewart A.F., Bander N.H., Milstone L., Barton D.E., Francke U., Broadus A.E. Proc. Natl. Acad. Sci. U.S.A. 85:597-601(1988) [PubMed: 2829195] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [3] | "Characterization of the human parathyroid hormone-like peptide gene. Functional and evolutionary aspects." Yasuda T., Banville D., Hendy G.N., Goltzman D. J. Biol. Chem. 264:7720-7725(1989) [PubMed: 2708388] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Human renal carcinoma expresses two messages encoding a parathyroid hormone-like peptide: evidence for the alternative splicing of a single-copy gene." Thiede M.A., Strewler G.J., Nissenson R.A., Rosenblatt M., Rodan G.A. Proc. Natl. Acad. Sci. U.S.A. 85:4605-4609(1988) [PubMed: 3290897] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [6] | "Structure of the 5' flanking region of the gene encoding human parathyroid-hormone-related protein (PTHrP)." Suva L.J., Mather K.A., Gillespie M.T., Webb G.C., Ng K.W., Winslow G.A., Wood W.I., Martin T.J., Hudson P.J. Gene 77:95-105(1989) [PubMed: 2744490] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 1-33. Tissue: Liver. |
| [7] | "Parathyroid hormone-related protein purified from a human lung cancer cell line." Moseley J.M., Kubota M., Diefenbach-Jagger H., Wettenhall R.E.H., Kemp B.E., Suva L.J., Rodda C.P., Ebeling P.R., Hudson P.J., Zajac J.D., Martin T.J. Proc. Natl. Acad. Sci. U.S.A. 84:5048-5052(1987) [PubMed: 2885845] [Abstract] Cited for: PROTEIN SEQUENCE OF 37-52. |
| [8] | "Isolation and characterization of the human parathyroid hormone-like peptide gene." Mangin M., Ikeda K., Dreyer B.E., Broadus A.E. Proc. Natl. Acad. Sci. U.S.A. 86:2408-2412(1989) [PubMed: 2928340] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM 3). |
| [9] | "A carboxyl-terminal peptide from the parathyroid hormone-related protein inhibits bone resorption by osteoclasts." Fenton A.J., Kemp B.E., Kent G.N., Moseley J.M., Zheng M.H., Rowe D.J., Britto J.M., Martin T.J., Nicholson G.C. Endocrinology 129:1762-1768(1991) [PubMed: 1915066] [Abstract] Cited for: CHARACTERIZATION OF OSTEOSTATIN ACTIVITY. |
| [10] | "A potent inhibitor of osteoclastic bone resorption within a highly conserved pentapeptide region of parathyroid hormone-related protein; PTHrP107-111." Fenton A.J., Kemp B.E., Hammonds R.G., Mitchelhill K., Moseley J.M., Martin T.J., Nicholson G.C. Endocrinology 129:3424-3426(1991) [PubMed: 1954916] [Abstract] Cited for: CHARACTERIZATION OF OSTEOSTATIN ACTIVITY. |
| [11] | "C-terminal parathyroid hormone-related protein inhibits proliferation and differentiation of human osteoblast-like cells." Martinez M.E., Garcia-Ocana A., Sanchez M., Medina S., del Campo T., Valin A., Sanchez-Cabezudo M.J., Esbrit P. J. Bone Miner. Res. 12:778-785(1997) [PubMed: 9144344] [Abstract] Cited for: CHARACTERIZATION OF OSTEOSTATIN ACTIVITY. |
| [12] | "Parathyroid hormone-related protein-(107-139) inhibits bone resorption in vivo." Cornish J., Callon K.E., Nicholson G.C., Reid I.R. Endocrinology 138:1299-1304(1997) [PubMed: 9048639] [Abstract] Cited for: CHARACTERIZATION OF OSTEOSTATIN ACTIVITY. |
| [13] | "Parathyroid hormone-related protein (PTHrP): a nucleocytoplasmic shuttling protein with distinct paracrine and intracrine roles." Jans D.A., Thomas R.J., Gillespie M.T. Vitam. Horm. 66:345-384(2003) [PubMed: 12852260] [Abstract] Cited for: NUCLEOCYTOPLASMIC SHUTTLING. |
| [14] | "Molecular dissection of the importin beta1-recognized nuclear targeting signal of parathyroid hormone-related protein." Lam M.H., Hu W., Xiao C.Y., Gillespie M.T., Jans D.A. Biochem. Biophys. Res. Commun. 282:629-634(2001) [PubMed: 11401507] [Abstract] Cited for: NUCLEAR LOCALIZATION SIGNAL. |
| [15] | "Minireview: parathyroid hormone-related protein as an intracrine factor -- trafficking mechanisms and functional consequences." Fiaschi-Taesch N.M., Stewart A.F. Endocrinology 144:407-411(2003) [PubMed: 12538599] [Abstract] Cited for: REVIEW. |
| [16] | "The structure of human parathyroid hormone-related protein(1-34) in near-physiological solution." Weidler M., Marx U.C., Seidel G., Schafer W., Hoffmann E., Esswein A., Rosch P. FEBS Lett. 444:239-244(1999) [PubMed: 10050767] [Abstract] Cited for: STRUCTURE BY NMR OF 37-70. |
| [17] | "Molecular basis for the recognition of a nonclassical nuclear localization signal by importin beta." Cingolani G., Bednenko J., Gillespie M.T., Gerace L. Mol. Cell 10:1345-1353(2002) [PubMed: 12504010] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 103-130. |
| [18] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] THR-169. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M17183 Genomic DNA. Translation: AAA60221.1. X14304 Genomic DNA. Translation: CAA32480.1. J03580 mRNA. Translation: AAA60216.1. Sequence problems. M24349, M24348 Genomic DNA. Translation: AAA60358.1. M24350, M24348, M24349 Genomic DNA. Translation: AAA60359.1. M24351, M24348, M24349 Genomic DNA. Translation: AAA60360.1. BC005961 mRNA. Translation: AAH05961.1. J03802 mRNA. Translation: AAA60218.1. M34071 mRNA. Translation: AAA60217.1. | |||||||||||||||||||||||||||||||
| IPI | IPI00221080. IPI00221081. IPI00414875. | ||||||||||||||||||||||||||||||
| PIR | PTHU2L. A33360. PTHU3L. C33360. | ||||||||||||||||||||||||||||||
| RefSeq | NP_002811.1. NP_945315.1. NP_945316.1. NP_945317.1. | ||||||||||||||||||||||||||||||
| UniGene | Hs.591159 | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||
| DisProt | DP00138. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | P12272. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PRIDE | P12272. | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENSG00000087494. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||
| GeneID | 5744. | ||||||||||||||||||||||||||||||
| KEGG | hsa:5744. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| GeneCards | GC12M028002. | ||||||||||||||||||||||||||||||
| H-InvDB | HIX0010511. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:9607. PTHLH. | ||||||||||||||||||||||||||||||
| MIM | 168470. gene+phenotype. | ||||||||||||||||||||||||||||||
| PharmGKB | PA33952. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| HOGENOM | P12272. | ||||||||||||||||||||||||||||||
| HOVERGEN | P12272. | ||||||||||||||||||||||||||||||
| OMA | P12272. SSWFLNK. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | hedgehog_2pathway. Signaling events mediated by the Hedgehog family. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | P12272. | ||||||||||||||||||||||||||||||
| Bgee | P12272. | ||||||||||||||||||||||||||||||
| CleanEx | HS_PTHLH. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000087494. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR001415. Parathyrd_hrm. IPR003626. PTH_related. [Graphical view] | ||||||||||||||||||||||||||||||
| PANTHER | PTHR17223. PTH_related. 1 hit. | ||||||||||||||||||||||||||||||
| Pfam | PF01279. Parathyroid. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProDom | PD013225. PTH_related. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||||||||
| SMART | SM00087. PTH. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PROSITE | PS00335. PARATHYROID. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||
| NextBio | 22362. | ||||||||||||||||||||||||||||||
| PMAP-CutDB | P12272. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | PTHR_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P12272 Secondary accession number(s): Q15251 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


