Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P12272

- PTHR_HUMAN

UniProt

P12272 - PTHR_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Parathyroid hormone-related protein

Gene

PTHLH

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath (By similarity). Promotes colon cancer cell migration and invasion in an integrin alpha-6/beta-1-dependent manner through activation of Rac1.By similarity1 Publication
Osteostatin is a potent inhibitor of osteoclastic bone resorption.1 Publication

GO - Molecular functioni

  1. hormone activity Source: ProtInc
  2. peptide hormone receptor binding Source: UniProtKB

GO - Biological processi

  1. adenylate cyclase-activating G-protein coupled receptor signaling pathway Source: MGI
  2. cAMP metabolic process Source: ProtInc
  3. cell-cell signaling Source: ProtInc
  4. endochondral ossification Source: Ensembl
  5. endoderm development Source: Ensembl
  6. epidermis development Source: ProtInc
  7. epithelial cell differentiation Source: Ensembl
  8. female pregnancy Source: ProtInc
  9. lung alveolus development Source: Ensembl
  10. mammary gland bud elongation Source: Ensembl
  11. negative regulation of cell proliferation Source: ProtInc
  12. negative regulation of chondrocyte differentiation Source: MGI
  13. negative regulation of sequence-specific DNA binding transcription factor activity Source: Ensembl
  14. nipple sheath formation Source: Ensembl
  15. osteoblast development Source: Ensembl
  16. positive regulation of cAMP biosynthetic process Source: MGI
  17. positive regulation of cell proliferation Source: ProtInc
  18. protein processing Source: Ensembl
  19. regulation of gene expression Source: MGI
  20. skeletal system development Source: MGI
  21. surfactant homeostasis Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Hormone

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_18372. Class B/2 (Secretin family receptors).
REACT_19327. G alpha (s) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Parathyroid hormone-related protein
Short name:
PTH-rP
Short name:
PTHrP
Alternative name(s):
Parathyroid hormone-like protein
Short name:
PLP
Cleaved into the following 3 chains:
Alternative name(s):
PTHrP[107-139]
Gene namesi
Name:PTHLH
Synonyms:PTHRP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:9607. PTHLH.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. extracellular region Source: Reactome
  3. extracellular space Source: ProtInc
  4. Golgi apparatus Source: HPA
  5. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus, Secreted

Pathology & Biotechi

Involvement in diseasei

Brachydactyly E2 (BDE2) [MIM:613382]: A form of brachydactyly. Brachydactyly defines a group of inherited malformations characterized by shortening of the digits due to abnormal development of the phalanges and/or the metacarpals. Brachydactyly type E is characterized by shortening of the fingers mainly in the metacarpals and metatarsals. Wide variability in the number of digits affected occurs from person to person, even in the same family. Some individuals are moderately short of stature. In brachydactyly type E2 variable combinations of metacarpals are involved, with shortening also of the first and third distal and the second and fifth middle phalanges.1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti44 – 441L → P in BDE2. 1 Publication
VAR_063711
Natural varianti60 – 601L → P in BDE2. 1 Publication
VAR_063712

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi57 – 571R → A: Strongly reduced affinity for PTH1R. 1 Publication
Mutagenesisi59 – 591F → A: Reduced affinity for PTH1R. 1 Publication
Mutagenesisi60 – 601L → A or K: Strongly reduced affinity for PTH1R. 1 Publication
Mutagenesisi63 – 631L → A: Reduced affinity for PTH1R. 1 Publication
Mutagenesisi64 – 641I → A: Reduced affinity for PTH1R. 1 Publication
Mutagenesisi68 – 681H → A: Reduced affinity for PTH1R. 1 Publication

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi613382. phenotype.
Orphaneti93387. Brachydactyly type E.
PharmGKBiPA33952.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424Sequence AnalysisAdd
BLAST
Propeptidei25 – 3410PRO_0000023224
Chaini37 – 177141Parathyroid hormone-related proteinPRO_0000023225Add
BLAST
Peptidei37 – 7236PTHrP[1-36]PRO_0000023226Add
BLAST
Peptidei74 – 13057PTHrP[38-94]PRO_0000023227Add
BLAST
Peptidei143 – 17533OsteostatinPRO_0000023228Add
BLAST

Post-translational modificationi

There are 3 principal secretory forms, called PTHrP[1-36], PTHrP[38-94], and osteostatin (PTHrP[107-139]) arising from endoproteolytic cleavage of the initial translation product. Each of these secretory forms is believed to have one or more of its own receptors that mediates the normal paracrine, autocrine and endocrine actions.

Keywords - PTMi

Cleavage on pair of basic residues

Proteomic databases

PaxDbiP12272.
PRIDEiP12272.

PTM databases

PhosphoSiteiP12272.

Miscellaneous databases

PMAP-CutDBP12272.

Expressioni

Tissue specificityi

Ubiquitous. Also expressed in the mammary gland.

Gene expression databases

BgeeiP12272.
CleanExiHS_PTHLH.
ExpressionAtlasiP12272. baseline and differential.
GenevestigatoriP12272.

Organism-specific databases

HPAiHPA035982.

Interactioni

Subunit structurei

PTHrP interacts with PTH1R (via N-terminal extracellular domain).1 Publication

Protein-protein interaction databases

BioGridi111716. 5 interactions.
IntActiP12272. 1 interaction.
MINTiMINT-1742626.
STRINGi9606.ENSP00000379213.

Structurei

Secondary structure

1
177
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi41 – 444Combined sources
Helixi51 – 6717Combined sources
Beta strandi114 – 1163Combined sources
Helixi117 – 1193Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1BZGNMR-A37-70[»]
1ET3model-A37-70[»]
1M5NX-ray2.90Q103-130[»]
3FFDX-ray2.00P37-144[»]
3H3GX-ray1.94B48-70[»]
DisProtiDP00138.
ProteinModelPortaliP12272.
SMRiP12272. Positions 37-70.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP12272.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni57 – 6812Important for receptor bindingAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi108 – 12922Nuclear localization signal1 PublicationAdd
BLAST

Sequence similaritiesi

Belongs to the parathyroid hormone family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG40343.
GeneTreeiENSGT00390000004933.
HOGENOMiHOG000115765.
HOVERGENiHBG003236.
InParanoidiP12272.
OMAiPATNTKN.
OrthoDBiEOG7FBRK8.
PhylomeDBiP12272.
TreeFamiTF332953.

Family and domain databases

InterProiIPR003626. PTH-rel.
IPR001415. PTH/PTH-rel.
[Graphical view]
PANTHERiPTHR17223. PTHR17223. 1 hit.
PfamiPF01279. Parathyroid. 1 hit.
[Graphical view]
SMARTiSM00087. PTH. 1 hit.
[Graphical view]
PROSITEiPS00335. PARATHYROID. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: P12272-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQRRLVQQWS VAVFLLSYAV PSCGRSVEGL SRRLKRAVSE HQLLHDKGKS
60 70 80 90 100
IQDLRRRFFL HHLIAEIHTA EIRATSEVSP NSKPSPNTKN HPVRFGSDDE
110 120 130 140 150
GRYLTQETNK VETYKEQPLK TPGKKKKGKP GKRKEQEKKK RRTRSAWLDS
160 170
GVTGSGLEGD HLSDTSTTSL ELDSRRH
Length:177
Mass (Da):20,194
Last modified:October 1, 1989 - v1
Checksum:i449FDFEE954C51DB
GO
Isoform 2 (identifier: P12272-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-177: Missing.

Show »
Length:175
Mass (Da):19,901
Checksum:i4FEE954C51DB3E7D
GO
Isoform 3 (identifier: P12272-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-177: RH → TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL

Show »
Length:209
Mass (Da):23,942
Checksum:iA994463A90B8EA0F
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti44 – 441L → P in BDE2. 1 Publication
VAR_063711
Natural varianti60 – 601L → P in BDE2. 1 Publication
VAR_063712
Natural varianti169 – 1691S → T in a breast cancer sample; somatic mutation. 1 Publication
VAR_036433

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei176 – 1772Missing in isoform 2. 2 PublicationsVSP_004534
Alternative sequencei176 – 1772RH → TALLWGLKKKKENNRRTHHM QLMISLFKSPLLLL in isoform 3. CuratedVSP_004535

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M17183 Genomic DNA. Translation: AAA60221.1.
X14304 Genomic DNA. Translation: CAA32480.1.
J03580 mRNA. Translation: AAA60216.1. Sequence problems.
M24349, M24348 Genomic DNA. Translation: AAA60358.1.
M24350, M24348, M24349 Genomic DNA. Translation: AAA60359.1.
M24351, M24348, M24349 Genomic DNA. Translation: AAA60360.1.
CR541882 mRNA. Translation: CAG46680.1.
CH471094 Genomic DNA. Translation: EAW96573.1.
BC005961 mRNA. Translation: AAH05961.1.
J03802 mRNA. Translation: AAA60218.1.
M34071 mRNA. Translation: AAA60217.1.
CCDSiCCDS44853.1. [P12272-1]
CCDS8715.1. [P12272-2]
PIRiA33360. PTHU2L.
C33360. PTHU3L.
RefSeqiNP_002811.1. NM_002820.2. [P12272-2]
NP_945315.1. NM_198964.1. [P12272-2]
NP_945316.1. NM_198965.1. [P12272-1]
NP_945317.1. NM_198966.1. [P12272-1]
XP_005253491.1. XM_005253434.1.
XP_006719178.1. XM_006719115.1. [P12272-1]
UniGeneiHs.591159.

Genome annotation databases

EnsembliENST00000201015; ENSP00000201015; ENSG00000087494. [P12272-2]
ENST00000395868; ENSP00000379209; ENSG00000087494. [P12272-2]
ENST00000395872; ENSP00000379213; ENSG00000087494. [P12272-1]
ENST00000535992; ENSP00000440613; ENSG00000087494. [P12272-2]
ENST00000538310; ENSP00000441890; ENSG00000087494. [P12272-3]
ENST00000539239; ENSP00000441571; ENSG00000087494. [P12272-1]
ENST00000545234; ENSP00000441765; ENSG00000087494. [P12272-1]
GeneIDi5744.
KEGGihsa:5744.
UCSCiuc001rik.3. human. [P12272-1]

Polymorphism databases

DMDMi131542.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M17183 Genomic DNA. Translation: AAA60221.1 .
X14304 Genomic DNA. Translation: CAA32480.1 .
J03580 mRNA. Translation: AAA60216.1 . Sequence problems.
M24349 , M24348 Genomic DNA. Translation: AAA60358.1 .
M24350 , M24348 , M24349 Genomic DNA. Translation: AAA60359.1 .
M24351 , M24348 , M24349 Genomic DNA. Translation: AAA60360.1 .
CR541882 mRNA. Translation: CAG46680.1 .
CH471094 Genomic DNA. Translation: EAW96573.1 .
BC005961 mRNA. Translation: AAH05961.1 .
J03802 mRNA. Translation: AAA60218.1 .
M34071 mRNA. Translation: AAA60217.1 .
CCDSi CCDS44853.1. [P12272-1 ]
CCDS8715.1. [P12272-2 ]
PIRi A33360. PTHU2L.
C33360. PTHU3L.
RefSeqi NP_002811.1. NM_002820.2. [P12272-2 ]
NP_945315.1. NM_198964.1. [P12272-2 ]
NP_945316.1. NM_198965.1. [P12272-1 ]
NP_945317.1. NM_198966.1. [P12272-1 ]
XP_005253491.1. XM_005253434.1.
XP_006719178.1. XM_006719115.1. [P12272-1 ]
UniGenei Hs.591159.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1BZG NMR - A 37-70 [» ]
1ET3 model - A 37-70 [» ]
1M5N X-ray 2.90 Q 103-130 [» ]
3FFD X-ray 2.00 P 37-144 [» ]
3H3G X-ray 1.94 B 48-70 [» ]
DisProti DP00138.
ProteinModelPortali P12272.
SMRi P12272. Positions 37-70.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111716. 5 interactions.
IntActi P12272. 1 interaction.
MINTi MINT-1742626.
STRINGi 9606.ENSP00000379213.

PTM databases

PhosphoSitei P12272.

Polymorphism databases

DMDMi 131542.

Proteomic databases

PaxDbi P12272.
PRIDEi P12272.

Protocols and materials databases

DNASUi 5744.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000201015 ; ENSP00000201015 ; ENSG00000087494 . [P12272-2 ]
ENST00000395868 ; ENSP00000379209 ; ENSG00000087494 . [P12272-2 ]
ENST00000395872 ; ENSP00000379213 ; ENSG00000087494 . [P12272-1 ]
ENST00000535992 ; ENSP00000440613 ; ENSG00000087494 . [P12272-2 ]
ENST00000538310 ; ENSP00000441890 ; ENSG00000087494 . [P12272-3 ]
ENST00000539239 ; ENSP00000441571 ; ENSG00000087494 . [P12272-1 ]
ENST00000545234 ; ENSP00000441765 ; ENSG00000087494 . [P12272-1 ]
GeneIDi 5744.
KEGGi hsa:5744.
UCSCi uc001rik.3. human. [P12272-1 ]

Organism-specific databases

CTDi 5744.
GeneCardsi GC12M028111.
HGNCi HGNC:9607. PTHLH.
HPAi HPA035982.
MIMi 168470. gene.
613382. phenotype.
neXtProti NX_P12272.
Orphaneti 93387. Brachydactyly type E.
PharmGKBi PA33952.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG40343.
GeneTreei ENSGT00390000004933.
HOGENOMi HOG000115765.
HOVERGENi HBG003236.
InParanoidi P12272.
OMAi PATNTKN.
OrthoDBi EOG7FBRK8.
PhylomeDBi P12272.
TreeFami TF332953.

Enzyme and pathway databases

Reactomei REACT_18372. Class B/2 (Secretin family receptors).
REACT_19327. G alpha (s) signalling events.

Miscellaneous databases

EvolutionaryTracei P12272.
GeneWikii Parathyroid_hormone-related_protein.
GenomeRNAii 5744.
NextBioi 22362.
PMAP-CutDB P12272.
PROi P12272.
SOURCEi Search...

Gene expression databases

Bgeei P12272.
CleanExi HS_PTHLH.
ExpressionAtlasi P12272. baseline and differential.
Genevestigatori P12272.

Family and domain databases

InterProi IPR003626. PTH-rel.
IPR001415. PTH/PTH-rel.
[Graphical view ]
PANTHERi PTHR17223. PTHR17223. 1 hit.
Pfami PF01279. Parathyroid. 1 hit.
[Graphical view ]
SMARTi SM00087. PTH. 1 hit.
[Graphical view ]
PROSITEi PS00335. PARATHYROID. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PARTIAL PROTEIN SEQUENCE.
  2. "Identification of a cDNA encoding a parathyroid hormone-like peptide from a human tumor associated with humoral hypercalcemia of malignancy."
    Mangin M., Webb A.C., Dreyer B.E., Posillico J.T., Ikeda K., Weir E.C., Stewart A.F., Bander N.H., Milstone L., Barton D.E., Francke U., Broadus A.E.
    Proc. Natl. Acad. Sci. U.S.A. 85:597-601(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
  3. "Characterization of the human parathyroid hormone-like peptide gene. Functional and evolutionary aspects."
    Yasuda T., Banville D., Hendy G.N., Goltzman D.
    J. Biol. Chem. 264:7720-7725(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  4. "Human renal carcinoma expresses two messages encoding a parathyroid hormone-like peptide: evidence for the alternative splicing of a single-copy gene."
    Thiede M.A., Strewler G.J., Nissenson R.A., Rosenblatt M., Rodan G.A.
    Proc. Natl. Acad. Sci. U.S.A. 85:4605-4609(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  8. "Structure of the 5' flanking region of the gene encoding human parathyroid-hormone-related protein (PTHrP)."
    Suva L.J., Mather K.A., Gillespie M.T., Webb G.C., Ng K.W., Winslow G.A., Wood W.I., Martin T.J., Hudson P.J.
    Gene 77:95-105(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE OF 1-33.
    Tissue: Liver.
  9. Cited for: PROTEIN SEQUENCE OF 37-52.
  10. "Isolation and characterization of the human parathyroid hormone-like peptide gene."
    Mangin M., Ikeda K., Dreyer B.E., Broadus A.E.
    Proc. Natl. Acad. Sci. U.S.A. 86:2408-2412(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING (ISOFORM 3).
  11. "A carboxyl-terminal peptide from the parathyroid hormone-related protein inhibits bone resorption by osteoclasts."
    Fenton A.J., Kemp B.E., Kent G.N., Moseley J.M., Zheng M.H., Rowe D.J., Britto J.M., Martin T.J., Nicholson G.C.
    Endocrinology 129:1762-1768(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION OF OSTEOSTATIN ACTIVITY.
  12. "A potent inhibitor of osteoclastic bone resorption within a highly conserved pentapeptide region of parathyroid hormone-related protein; PTHrP107-111."
    Fenton A.J., Kemp B.E., Hammonds R.G., Mitchelhill K., Moseley J.M., Martin T.J., Nicholson G.C.
    Endocrinology 129:3424-3426(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION OF OSTEOSTATIN ACTIVITY.
  13. "C-terminal parathyroid hormone-related protein inhibits proliferation and differentiation of human osteoblast-like cells."
    Martinez M.E., Garcia-Ocana A., Sanchez M., Medina S., del Campo T., Valin A., Sanchez-Cabezudo M.J., Esbrit P.
    J. Bone Miner. Res. 12:778-785(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION OF OSTEOSTATIN ACTIVITY.
  14. "Parathyroid hormone-related protein-(107-139) inhibits bone resorption in vivo."
    Cornish J., Callon K.E., Nicholson G.C., Reid I.R.
    Endocrinology 138:1299-1304(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION OF OSTEOSTATIN ACTIVITY.
  15. "Parathyroid hormone-related protein (PTHrP): a nucleocytoplasmic shuttling protein with distinct paracrine and intracrine roles."
    Jans D.A., Thomas R.J., Gillespie M.T.
    Vitam. Horm. 66:345-384(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOCYTOPLASMIC SHUTTLING.
  16. "Molecular dissection of the importin beta1-recognized nuclear targeting signal of parathyroid hormone-related protein."
    Lam M.H., Hu W., Xiao C.Y., Gillespie M.T., Jans D.A.
    Biochem. Biophys. Res. Commun. 282:629-634(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEAR LOCALIZATION SIGNAL.
  17. "Minireview: parathyroid hormone-related protein as an intracrine factor -- trafficking mechanisms and functional consequences."
    Fiaschi-Taesch N.M., Stewart A.F.
    Endocrinology 144:407-411(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  18. "PTHrP promotes colon cancer cell migration and invasion in an integrin alpha6beta4-dependent manner through activation of Rac1."
    Mula R.V., Bhatia V., Falzon M.
    Cancer Lett. 298:119-127(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  19. "The structure of human parathyroid hormone-related protein(1-34) in near-physiological solution."
    Weidler M., Marx U.C., Seidel G., Schafer W., Hoffmann E., Esswein A., Rosch P.
    FEBS Lett. 444:239-244(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 37-70.
  20. "Molecular basis for the recognition of a nonclassical nuclear localization signal by importin beta."
    Cingolani G., Bednenko J., Gillespie M.T., Gerace L.
    Mol. Cell 10:1345-1353(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 103-130.
  21. "Structural basis for parathyroid hormone-related protein binding to the parathyroid hormone receptor and design of conformation-selective peptides."
    Pioszak A.A., Parker N.R., Gardella T.J., Xu H.E.
    J. Biol. Chem. 284:28382-28391(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.94 ANGSTROMS) OF 48-70 IN COMPLEX WITH PTH1R, INTERACTION WITH PTH1R, MUTAGENESIS OF ARG-57; PHE-59; LEU-60; LEU-63; ILE-64 AND HIS-68.
  22. Cited for: VARIANT [LARGE SCALE ANALYSIS] THR-169.
  23. Cited for: VARIANTS BDE2 PRO-44 AND PRO-60.

Entry informationi

Entry nameiPTHR_HUMAN
AccessioniPrimary (citable) accession number: P12272
Secondary accession number(s): Q15251, Q6FH74
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: October 1, 1989
Last modified: November 26, 2014
This is version 168 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3