Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P12272

- PTHR_HUMAN

UniProt

P12272 - PTHR_HUMAN

Protein

Parathyroid hormone-related protein

Gene

PTHLH

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 166 (01 Oct 2014)
      Sequence version 1 (01 Oct 1989)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath By similarity. Promotes colon cancer cell migration and invasion in an integrin alpha-6/beta-1-dependent manner through activation of Rac1.By similarity1 Publication
    Osteostatin is a potent inhibitor of osteoclastic bone resorption.1 Publication

    GO - Molecular functioni

    1. hormone activity Source: ProtInc
    2. peptide hormone receptor binding Source: UniProtKB

    GO - Biological processi

    1. adenylate cyclase-activating G-protein coupled receptor signaling pathway Source: MGI
    2. cAMP metabolic process Source: ProtInc
    3. cell-cell signaling Source: ProtInc
    4. endochondral ossification Source: Ensembl
    5. endoderm development Source: Ensembl
    6. epidermis development Source: ProtInc
    7. epithelial cell differentiation Source: Ensembl
    8. female pregnancy Source: ProtInc
    9. lung alveolus development Source: Ensembl
    10. mammary gland bud elongation Source: Ensembl
    11. negative regulation of cell proliferation Source: ProtInc
    12. negative regulation of chondrocyte differentiation Source: MGI
    13. negative regulation of sequence-specific DNA binding transcription factor activity Source: Ensembl
    14. nipple sheath formation Source: Ensembl
    15. osteoblast development Source: Ensembl
    16. positive regulation of cAMP biosynthetic process Source: MGI
    17. positive regulation of cell proliferation Source: ProtInc
    18. protein processing Source: Ensembl
    19. regulation of gene expression Source: MGI
    20. skeletal system development Source: MGI
    21. surfactant homeostasis Source: Ensembl

    Keywords - Molecular functioni

    Hormone

    Keywords - Ligandi

    Calcium

    Enzyme and pathway databases

    ReactomeiREACT_18372. Class B/2 (Secretin family receptors).
    REACT_19327. G alpha (s) signalling events.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Parathyroid hormone-related protein
    Short name:
    PTH-rP
    Short name:
    PTHrP
    Alternative name(s):
    Parathyroid hormone-like protein
    Short name:
    PLP
    Cleaved into the following 3 chains:
    Alternative name(s):
    PTHrP[107-139]
    Gene namesi
    Name:PTHLH
    Synonyms:PTHRP
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:9607. PTHLH.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. extracellular region Source: Reactome
    3. extracellular space Source: ProtInc
    4. Golgi apparatus Source: HPA
    5. nucleus Source: HPA

    Keywords - Cellular componenti

    Cytoplasm, Nucleus, Secreted

    Pathology & Biotechi

    Involvement in diseasei

    Brachydactyly E2 (BDE2) [MIM:613382]: A form of brachydactyly. Brachydactyly defines a group of inherited malformations characterized by shortening of the digits due to abnormal development of the phalanges and/or the metacarpals. Brachydactyly type E is characterized by shortening of the fingers mainly in the metacarpals and metatarsals. Wide variability in the number of digits affected occurs from person to person, even in the same family. Some individuals are moderately short of stature. In brachydactyly type E2 variable combinations of metacarpals are involved, with shortening also of the first and third distal and the second and fifth middle phalanges.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti44 – 441L → P in BDE2. 1 Publication
    VAR_063711
    Natural varianti60 – 601L → P in BDE2. 1 Publication
    VAR_063712

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi57 – 571R → A: Strongly reduced affinity for PTH1R. 1 Publication
    Mutagenesisi59 – 591F → A: Reduced affinity for PTH1R. 1 Publication
    Mutagenesisi60 – 601L → A or K: Strongly reduced affinity for PTH1R. 1 Publication
    Mutagenesisi63 – 631L → A: Reduced affinity for PTH1R. 1 Publication
    Mutagenesisi64 – 641I → A: Reduced affinity for PTH1R. 1 Publication
    Mutagenesisi68 – 681H → A: Reduced affinity for PTH1R. 1 Publication

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    MIMi613382. phenotype.
    Orphaneti93387. Brachydactyly type E.
    PharmGKBiPA33952.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2424Sequence AnalysisAdd
    BLAST
    Propeptidei25 – 3410PRO_0000023224
    Chaini37 – 177141Parathyroid hormone-related proteinPRO_0000023225Add
    BLAST
    Peptidei37 – 7236PTHrP[1-36]PRO_0000023226Add
    BLAST
    Peptidei74 – 13057PTHrP[38-94]PRO_0000023227Add
    BLAST
    Peptidei143 – 17533OsteostatinPRO_0000023228Add
    BLAST

    Post-translational modificationi

    There are 3 principal secretory forms, called PTHrP[1-36], PTHrP[38-94], and osteostatin (PTHrP[107-139]) arising from endoproteolytic cleavage of the initial translation product. Each of these secretory forms is believed to have one or more of its own receptors that mediates the normal paracrine, autocrine and endocrine actions.

    Keywords - PTMi

    Cleavage on pair of basic residues

    Proteomic databases

    PaxDbiP12272.
    PRIDEiP12272.

    PTM databases

    PhosphoSiteiP12272.

    Miscellaneous databases

    PMAP-CutDBP12272.

    Expressioni

    Tissue specificityi

    Ubiquitous. Also expressed in the mammary gland.

    Gene expression databases

    ArrayExpressiP12272.
    BgeeiP12272.
    CleanExiHS_PTHLH.
    GenevestigatoriP12272.

    Organism-specific databases

    HPAiHPA035982.

    Interactioni

    Subunit structurei

    PTHrP interacts with PTH1R (via N-terminal extracellular domain).1 Publication

    Protein-protein interaction databases

    BioGridi111716. 5 interactions.
    IntActiP12272. 1 interaction.
    MINTiMINT-1742626.
    STRINGi9606.ENSP00000379213.

    Structurei

    Secondary structure

    1
    177
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi41 – 444
    Helixi51 – 6717
    Beta strandi114 – 1163
    Helixi117 – 1193

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1BZGNMR-A37-70[»]
    1ET3model-A37-70[»]
    1M5NX-ray2.90Q103-130[»]
    3FFDX-ray2.00P37-144[»]
    3H3GX-ray1.94B48-70[»]
    DisProtiDP00138.
    ProteinModelPortaliP12272.
    SMRiP12272. Positions 37-70.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP12272.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni57 – 6812Important for receptor bindingAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi108 – 12922Nuclear localization signal1 PublicationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the parathyroid hormone family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG40343.
    HOGENOMiHOG000115765.
    HOVERGENiHBG003236.
    InParanoidiP12272.
    OMAiPATNTKN.
    OrthoDBiEOG7FBRK8.
    PhylomeDBiP12272.
    TreeFamiTF332953.

    Family and domain databases

    InterProiIPR003626. PTH-rel.
    IPR001415. PTH/PTH-rel.
    [Graphical view]
    PANTHERiPTHR17223. PTHR17223. 1 hit.
    PfamiPF01279. Parathyroid. 1 hit.
    [Graphical view]
    SMARTiSM00087. PTH. 1 hit.
    [Graphical view]
    PROSITEiPS00335. PARATHYROID. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: P12272-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQRRLVQQWS VAVFLLSYAV PSCGRSVEGL SRRLKRAVSE HQLLHDKGKS    50
    IQDLRRRFFL HHLIAEIHTA EIRATSEVSP NSKPSPNTKN HPVRFGSDDE 100
    GRYLTQETNK VETYKEQPLK TPGKKKKGKP GKRKEQEKKK RRTRSAWLDS 150
    GVTGSGLEGD HLSDTSTTSL ELDSRRH 177
    Length:177
    Mass (Da):20,194
    Last modified:October 1, 1989 - v1
    Checksum:i449FDFEE954C51DB
    GO
    Isoform 2 (identifier: P12272-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         176-177: Missing.

    Show »
    Length:175
    Mass (Da):19,901
    Checksum:i4FEE954C51DB3E7D
    GO
    Isoform 3 (identifier: P12272-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         176-177: RH → TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL

    Show »
    Length:209
    Mass (Da):23,942
    Checksum:iA994463A90B8EA0F
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti44 – 441L → P in BDE2. 1 Publication
    VAR_063711
    Natural varianti60 – 601L → P in BDE2. 1 Publication
    VAR_063712
    Natural varianti169 – 1691S → T in a breast cancer sample; somatic mutation. 1 Publication
    VAR_036433

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei176 – 1772Missing in isoform 2. 2 PublicationsVSP_004534
    Alternative sequencei176 – 1772RH → TALLWGLKKKKENNRRTHHM QLMISLFKSPLLLL in isoform 3. CuratedVSP_004535

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M17183 Genomic DNA. Translation: AAA60221.1.
    X14304 Genomic DNA. Translation: CAA32480.1.
    J03580 mRNA. Translation: AAA60216.1. Sequence problems.
    M24349, M24348 Genomic DNA. Translation: AAA60358.1.
    M24350, M24348, M24349 Genomic DNA. Translation: AAA60359.1.
    M24351, M24348, M24349 Genomic DNA. Translation: AAA60360.1.
    CR541882 mRNA. Translation: CAG46680.1.
    CH471094 Genomic DNA. Translation: EAW96573.1.
    BC005961 mRNA. Translation: AAH05961.1.
    J03802 mRNA. Translation: AAA60218.1.
    M34071 mRNA. Translation: AAA60217.1.
    CCDSiCCDS44853.1. [P12272-1]
    CCDS8715.1. [P12272-2]
    PIRiA33360. PTHU2L.
    C33360. PTHU3L.
    RefSeqiNP_002811.1. NM_002820.2. [P12272-2]
    NP_945315.1. NM_198964.1. [P12272-2]
    NP_945316.1. NM_198965.1. [P12272-1]
    NP_945317.1. NM_198966.1. [P12272-1]
    XP_005253491.1. XM_005253434.1.
    XP_006719178.1. XM_006719115.1. [P12272-1]
    UniGeneiHs.591159.

    Genome annotation databases

    EnsembliENST00000201015; ENSP00000201015; ENSG00000087494. [P12272-2]
    ENST00000395868; ENSP00000379209; ENSG00000087494. [P12272-2]
    ENST00000395872; ENSP00000379213; ENSG00000087494. [P12272-1]
    ENST00000535992; ENSP00000440613; ENSG00000087494. [P12272-2]
    ENST00000538310; ENSP00000441890; ENSG00000087494. [P12272-3]
    ENST00000539239; ENSP00000441571; ENSG00000087494. [P12272-1]
    ENST00000545234; ENSP00000441765; ENSG00000087494. [P12272-1]
    GeneIDi5744.
    KEGGihsa:5744.
    UCSCiuc001rik.3. human. [P12272-1]

    Polymorphism databases

    DMDMi131542.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M17183 Genomic DNA. Translation: AAA60221.1 .
    X14304 Genomic DNA. Translation: CAA32480.1 .
    J03580 mRNA. Translation: AAA60216.1 . Sequence problems.
    M24349 , M24348 Genomic DNA. Translation: AAA60358.1 .
    M24350 , M24348 , M24349 Genomic DNA. Translation: AAA60359.1 .
    M24351 , M24348 , M24349 Genomic DNA. Translation: AAA60360.1 .
    CR541882 mRNA. Translation: CAG46680.1 .
    CH471094 Genomic DNA. Translation: EAW96573.1 .
    BC005961 mRNA. Translation: AAH05961.1 .
    J03802 mRNA. Translation: AAA60218.1 .
    M34071 mRNA. Translation: AAA60217.1 .
    CCDSi CCDS44853.1. [P12272-1 ]
    CCDS8715.1. [P12272-2 ]
    PIRi A33360. PTHU2L.
    C33360. PTHU3L.
    RefSeqi NP_002811.1. NM_002820.2. [P12272-2 ]
    NP_945315.1. NM_198964.1. [P12272-2 ]
    NP_945316.1. NM_198965.1. [P12272-1 ]
    NP_945317.1. NM_198966.1. [P12272-1 ]
    XP_005253491.1. XM_005253434.1.
    XP_006719178.1. XM_006719115.1. [P12272-1 ]
    UniGenei Hs.591159.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1BZG NMR - A 37-70 [» ]
    1ET3 model - A 37-70 [» ]
    1M5N X-ray 2.90 Q 103-130 [» ]
    3FFD X-ray 2.00 P 37-144 [» ]
    3H3G X-ray 1.94 B 48-70 [» ]
    DisProti DP00138.
    ProteinModelPortali P12272.
    SMRi P12272. Positions 37-70.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111716. 5 interactions.
    IntActi P12272. 1 interaction.
    MINTi MINT-1742626.
    STRINGi 9606.ENSP00000379213.

    PTM databases

    PhosphoSitei P12272.

    Polymorphism databases

    DMDMi 131542.

    Proteomic databases

    PaxDbi P12272.
    PRIDEi P12272.

    Protocols and materials databases

    DNASUi 5744.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000201015 ; ENSP00000201015 ; ENSG00000087494 . [P12272-2 ]
    ENST00000395868 ; ENSP00000379209 ; ENSG00000087494 . [P12272-2 ]
    ENST00000395872 ; ENSP00000379213 ; ENSG00000087494 . [P12272-1 ]
    ENST00000535992 ; ENSP00000440613 ; ENSG00000087494 . [P12272-2 ]
    ENST00000538310 ; ENSP00000441890 ; ENSG00000087494 . [P12272-3 ]
    ENST00000539239 ; ENSP00000441571 ; ENSG00000087494 . [P12272-1 ]
    ENST00000545234 ; ENSP00000441765 ; ENSG00000087494 . [P12272-1 ]
    GeneIDi 5744.
    KEGGi hsa:5744.
    UCSCi uc001rik.3. human. [P12272-1 ]

    Organism-specific databases

    CTDi 5744.
    GeneCardsi GC12M028111.
    HGNCi HGNC:9607. PTHLH.
    HPAi HPA035982.
    MIMi 168470. gene.
    613382. phenotype.
    neXtProti NX_P12272.
    Orphaneti 93387. Brachydactyly type E.
    PharmGKBi PA33952.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG40343.
    HOGENOMi HOG000115765.
    HOVERGENi HBG003236.
    InParanoidi P12272.
    OMAi PATNTKN.
    OrthoDBi EOG7FBRK8.
    PhylomeDBi P12272.
    TreeFami TF332953.

    Enzyme and pathway databases

    Reactomei REACT_18372. Class B/2 (Secretin family receptors).
    REACT_19327. G alpha (s) signalling events.

    Miscellaneous databases

    EvolutionaryTracei P12272.
    GeneWikii Parathyroid_hormone-related_protein.
    GenomeRNAii 5744.
    NextBioi 22362.
    PMAP-CutDB P12272.
    PROi P12272.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P12272.
    Bgeei P12272.
    CleanExi HS_PTHLH.
    Genevestigatori P12272.

    Family and domain databases

    InterProi IPR003626. PTH-rel.
    IPR001415. PTH/PTH-rel.
    [Graphical view ]
    PANTHERi PTHR17223. PTHR17223. 1 hit.
    Pfami PF01279. Parathyroid. 1 hit.
    [Graphical view ]
    SMARTi SM00087. PTH. 1 hit.
    [Graphical view ]
    PROSITEi PS00335. PARATHYROID. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PARTIAL PROTEIN SEQUENCE.
    2. "Identification of a cDNA encoding a parathyroid hormone-like peptide from a human tumor associated with humoral hypercalcemia of malignancy."
      Mangin M., Webb A.C., Dreyer B.E., Posillico J.T., Ikeda K., Weir E.C., Stewart A.F., Bander N.H., Milstone L., Barton D.E., Francke U., Broadus A.E.
      Proc. Natl. Acad. Sci. U.S.A. 85:597-601(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    3. "Characterization of the human parathyroid hormone-like peptide gene. Functional and evolutionary aspects."
      Yasuda T., Banville D., Hendy G.N., Goltzman D.
      J. Biol. Chem. 264:7720-7725(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    4. "Human renal carcinoma expresses two messages encoding a parathyroid hormone-like peptide: evidence for the alternative splicing of a single-copy gene."
      Thiede M.A., Strewler G.J., Nissenson R.A., Rosenblatt M., Rodan G.A.
      Proc. Natl. Acad. Sci. U.S.A. 85:4605-4609(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    8. "Structure of the 5' flanking region of the gene encoding human parathyroid-hormone-related protein (PTHrP)."
      Suva L.J., Mather K.A., Gillespie M.T., Webb G.C., Ng K.W., Winslow G.A., Wood W.I., Martin T.J., Hudson P.J.
      Gene 77:95-105(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE OF 1-33.
      Tissue: Liver.
    9. Cited for: PROTEIN SEQUENCE OF 37-52.
    10. "Isolation and characterization of the human parathyroid hormone-like peptide gene."
      Mangin M., Ikeda K., Dreyer B.E., Broadus A.E.
      Proc. Natl. Acad. Sci. U.S.A. 86:2408-2412(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING (ISOFORM 3).
    11. "A carboxyl-terminal peptide from the parathyroid hormone-related protein inhibits bone resorption by osteoclasts."
      Fenton A.J., Kemp B.E., Kent G.N., Moseley J.M., Zheng M.H., Rowe D.J., Britto J.M., Martin T.J., Nicholson G.C.
      Endocrinology 129:1762-1768(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION OF OSTEOSTATIN ACTIVITY.
    12. "A potent inhibitor of osteoclastic bone resorption within a highly conserved pentapeptide region of parathyroid hormone-related protein; PTHrP107-111."
      Fenton A.J., Kemp B.E., Hammonds R.G., Mitchelhill K., Moseley J.M., Martin T.J., Nicholson G.C.
      Endocrinology 129:3424-3426(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION OF OSTEOSTATIN ACTIVITY.
    13. "C-terminal parathyroid hormone-related protein inhibits proliferation and differentiation of human osteoblast-like cells."
      Martinez M.E., Garcia-Ocana A., Sanchez M., Medina S., del Campo T., Valin A., Sanchez-Cabezudo M.J., Esbrit P.
      J. Bone Miner. Res. 12:778-785(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION OF OSTEOSTATIN ACTIVITY.
    14. "Parathyroid hormone-related protein-(107-139) inhibits bone resorption in vivo."
      Cornish J., Callon K.E., Nicholson G.C., Reid I.R.
      Endocrinology 138:1299-1304(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION OF OSTEOSTATIN ACTIVITY.
    15. "Parathyroid hormone-related protein (PTHrP): a nucleocytoplasmic shuttling protein with distinct paracrine and intracrine roles."
      Jans D.A., Thomas R.J., Gillespie M.T.
      Vitam. Horm. 66:345-384(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOCYTOPLASMIC SHUTTLING.
    16. "Molecular dissection of the importin beta1-recognized nuclear targeting signal of parathyroid hormone-related protein."
      Lam M.H., Hu W., Xiao C.Y., Gillespie M.T., Jans D.A.
      Biochem. Biophys. Res. Commun. 282:629-634(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEAR LOCALIZATION SIGNAL.
    17. "Minireview: parathyroid hormone-related protein as an intracrine factor -- trafficking mechanisms and functional consequences."
      Fiaschi-Taesch N.M., Stewart A.F.
      Endocrinology 144:407-411(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW.
    18. "PTHrP promotes colon cancer cell migration and invasion in an integrin alpha6beta4-dependent manner through activation of Rac1."
      Mula R.V., Bhatia V., Falzon M.
      Cancer Lett. 298:119-127(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    19. "The structure of human parathyroid hormone-related protein(1-34) in near-physiological solution."
      Weidler M., Marx U.C., Seidel G., Schafer W., Hoffmann E., Esswein A., Rosch P.
      FEBS Lett. 444:239-244(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 37-70.
    20. "Molecular basis for the recognition of a nonclassical nuclear localization signal by importin beta."
      Cingolani G., Bednenko J., Gillespie M.T., Gerace L.
      Mol. Cell 10:1345-1353(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 103-130.
    21. "Structural basis for parathyroid hormone-related protein binding to the parathyroid hormone receptor and design of conformation-selective peptides."
      Pioszak A.A., Parker N.R., Gardella T.J., Xu H.E.
      J. Biol. Chem. 284:28382-28391(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.94 ANGSTROMS) OF 48-70 IN COMPLEX WITH PTH1R, INTERACTION WITH PTH1R, MUTAGENESIS OF ARG-57; PHE-59; LEU-60; LEU-63; ILE-64 AND HIS-68.
    22. Cited for: VARIANT [LARGE SCALE ANALYSIS] THR-169.
    23. Cited for: VARIANTS BDE2 PRO-44 AND PRO-60.

    Entry informationi

    Entry nameiPTHR_HUMAN
    AccessioniPrimary (citable) accession number: P12272
    Secondary accession number(s): Q15251, Q6FH74
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1989
    Last sequence update: October 1, 1989
    Last modified: October 1, 2014
    This is version 166 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3