Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

cAMP-specific 3',5'-cyclic phosphodiesterase

Gene

dnc

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes (By similarity). Vital for female fertility. Required for learning/memory.By similarity1 Publication

Catalytic activityi

Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.1 Publication

Cofactori

a divalent metal cationBy similarityNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.By similarity

Pathwayi: 3',5'-cyclic AMP degradation

This protein is involved in step 1 of the subpathway that synthesizes AMP from 3',5'-cyclic AMP.
Proteins known to be involved in this subpathway in this organism are:
  1. cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I (dnc), cAMP-specific 3',5'-cyclic phosphodiesterase (dnc), cAMP-specific 3',5'-cyclic phosphodiesterase, isoforms N/G (dnc), cAMP-specific 3',5'-cyclic phosphodiesterase, isoform F (dnc)
This subpathway is part of the pathway 3',5'-cyclic AMP degradation, which is itself part of Purine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes AMP from 3',5'-cyclic AMP, the pathway 3',5'-cyclic AMP degradation and in Purine metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei732Proton donorBy similarity1
Metal bindingi736Divalent metal cation 1By similarity1
Metal bindingi772Divalent metal cation 1By similarity1
Metal bindingi773Divalent metal cation 1By similarity1
Metal bindingi773Divalent metal cation 2By similarity1
Binding sitei773cAMPBy similarity1
Metal bindingi890Divalent metal cation 1By similarity1
Binding sitei890cAMPBy similarity1
Sitei893Binds AMP, but not cAMPBy similarity1
Binding sitei941cAMPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi732 – 736cAMPBy similarity5

GO - Molecular functioni

GO - Biological processi

  • associative learning Source: FlyBase
  • axon extension Source: FlyBase
  • behavioral response to ethanol Source: FlyBase
  • cAMP catabolic process Source: UniProtKB-UniPathway
  • cAMP-mediated signaling Source: FlyBase
  • chemical synaptic transmission Source: FlyBase
  • circadian rhythm Source: FlyBase
  • conditioned taste aversion Source: FlyBase
  • courtship behavior Source: FlyBase
  • lateral inhibition Source: FlyBase
  • learning Source: FlyBase
  • learning or memory Source: FlyBase
  • locomotor rhythm Source: FlyBase
  • mating behavior Source: FlyBase
  • memory Source: FlyBase
  • nonassociative learning Source: FlyBase
  • olfactory learning Source: FlyBase
  • oogenesis Source: FlyBase
  • regulation of protein kinase A signaling Source: FlyBase
  • reproduction Source: FlyBase
  • short-term memory Source: FlyBase
  • thermosensory behavior Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

cAMP, Metal-binding

Enzyme and pathway databases

ReactomeiR-DME-180024. DARPP-32 events.
R-DME-418555. G alpha (s) signalling events.
UniPathwayiUPA00762; UER00747.

Names & Taxonomyi

Protein namesi
Recommended name:
cAMP-specific 3',5'-cyclic phosphodiesterase (EC:3.1.4.53)
Alternative name(s):
Learning/memory process protein
Protein dunce
Gene namesi
Name:dnc
ORF Names:CG32498
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome X

Organism-specific databases

FlyBaseiFBgn0000479. dnc.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000233421 – 1070cAMP-specific 3',5'-cyclic phosphodiesteraseAdd BLAST1070

Proteomic databases

PRIDEiP12252.

Expressioni

Gene expression databases

BgeeiFBgn0000479.
ExpressionAtlasiP12252. baseline.
GenevisibleiP12252. DM.

Interactioni

Subunit structurei

Monomer.1 Publication

Protein-protein interaction databases

BioGridi57834. 8 interactors.
IntActiP12252. 3 interactors.

Structurei

3D structure databases

ProteinModelPortaliP12252.
SMRiP12252.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi19 – 23Poly-Pro5
Compositional biasi57 – 210Ser-richAdd BLAST154
Compositional biasi85 – 130Gln-richAdd BLAST46
Compositional biasi1020 – 1069Gly-richAdd BLAST50

Sequence similaritiesi

Phylogenomic databases

GeneTreeiENSGT00760000118889.
OrthoDBiEOG091G06CD.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
InterProiIPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]

Sequences (12)i

Sequence statusi: Complete.

This entry describes 12 isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

Isoform II (identifier: P12252-1) [UniParc]FASTAAdd to basket
Also known as: I, J

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQESNGGPA AGGGAAAAPP PPPQYIITTP SEVDPDEVRS MADLELGSPE
60 70 80 90 100
KQVQVQSQKF SSTSSTTKVA THSFSMSSSA GTTGQQSKQD SAQQIQQLQQ
110 120 130 140 150
LQQLQQLQQQ QQQQQSQRII SSSTRSQSLQ SSTIVGEATT ITSGAAQILS
160 170 180 190 200
ASAAASLAQQ LKAQSSTSII TSSEQRTSTS TSSSSSTRYI ASGSSNLAGG
210 220 230 240 250
NSNSASSASS KTRFQSFLQQ PEGAHGFLTA HQKHVRQFVR STSAHSEAAA
260 270 280 290 300
GVAGARAEKC IRSASTQIDD ASVAGVVESA GNLTDSSATG GSMQLSMSKL
310 320 330 340 350
GLQQSSSILI SKSAETIEMK SSSAGMRTQL TLSGGFLAPP GNRKITILSP
360 370 380 390 400
IHAPPGLHDM LKRAQGRSPL SPRISFPGSD SDLFGFDVEN GQGARSPLEG
410 420 430 440 450
GSPSAGLVLQ NLPQRRESFL YRSDSDFEMS PKSMSRNSSI ASERFKEQEA
460 470 480 490 500
SILVDRSHGE DLIVTPFAQI LASLRSVRNN LLSLTNVPAS NKSRRPNQSS
510 520 530 540 550
SASRSGNPPG APLSQGEEAY TRLATDTIEE LDWCLDQLET IQTHRSVSDM
560 570 580 590 600
ASLKFKRMLN KELSHFSESS RSGNQISEYI CSTFLDKQQE FDLPSLRVED
610 620 630 640 650
NPELVAANAA AGQQSAGQYA RSRSPRGPPM SQISGVKRPL SHTNSFTGER
660 670 680 690 700
LPTFGVETPR ENELGTLLGE LDTWGIQIFS IGEFSVNRPL TCVAYTIFQS
710 720 730 740 750
RELLTSLMIP PKTFLNFMST LEDHYVKDNP FHNSLHAADV TQSTNVLLNT
760 770 780 790 800
PALEGVFTPL EVGGALFAAC IHDVDHPGLT NQFLVNSSSE LALMYNDESV
810 820 830 840 850
LENHHLAVAF KLLQNQGCDI FCNMQKKQRQ TLRKMVIDIV LSTDMSKHMS
860 870 880 890 900
LLADLKTMVE TKKVAGSGVL LLDNYTDRIQ VLENLVHCAD LSNPTKPLPL
910 920 930 940 950
YKRWVALLME EFFLQGDKER ESGMDISPMC DRHNATIEKS QVGFIDYIVH
960 970 980 990 1000
PLWETWADLV HPDAQDILDT LEENRDYYQS MIPPSPPPSG VDENPQEDRI
1010 1020 1030 1040 1050
RFQVTLEESD QENLAELEEG DESGGESTTT GTTGTTAASA LSGAGGGGGG
1060 1070
GGGMAPRTGG CQNQPQHGGM
Length:1,070
Mass (Da):115,079
Last modified:August 16, 2005 - v4
Checksum:i50A63BF7BCC8EDD9
GO
Isoform IV (identifier: P12252-3) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     1-369: Missing.
     370-385: LSPRISFPGSDSDLFG → MVCSFCCCCYNFRNSP

Show »
Length:701
Mass (Da):77,193
Checksum:i52B25B32753A0EFE
GO
Isoform V (identifier: P12252-4) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     444-456: Missing.

Show »
Length:1,057
Mass (Da):113,506
Checksum:iF6A7B73FAB4F196B
GO
Isoform VI (identifier: P12252-5) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     493-494: Missing.

Show »
Length:1,068
Mass (Da):114,836
Checksum:iBA4F5909F5F710C3
GO
Isoform VII (identifier: P12252-6) [UniParc]FASTAAdd to basket
Also known as: L

The sequence of this isoform differs from the canonical sequence as follows:
     1-549: Missing.

Show »
Length:521
Mass (Da):57,358
Checksum:i0F40B7345882579D
GO
Isoform III (identifier: P12252-7) [UniParc]FASTAAdd to basket
Also known as: E, P

The sequence of this isoform differs from the canonical sequence as follows:
     1-428: Missing.

Note: Produced by alternative initiation at Met-429 of isoform II.
Show »
Length:642
Mass (Da):70,625
Checksum:i5F2BA8CE14598DCD
GO
Isoform R (identifier: P12252-8) [UniParc] [UniParc]FASTAAdd to basket
Also known as: Q

The sequence of this isoform differs from the canonical sequence as follows:
     1-367: Missing.
     368-385: SPLSPRISFPGSDSDLFG → MVCSFCCCCYNFRNSPSS

Note: No experimental confirmation available.
Show »
Length:703
Mass (Da):77,368
Checksum:iCA37B22CA8E46A0B
GO
Isoform U (identifier: P12252-9) [UniParc]FASTAAdd to basket
Also known as: T

The sequence of this isoform differs from the canonical sequence as follows:
     1-355: Missing.
     356-385: GLHDMLKRAQGRSPLSPRISFPGSDSDLFG → MQAEQGSIGDLQKYHSRYLKNRRHTLANVR

Note: No experimental confirmation available.
Show »
Length:715
Mass (Da):78,887
Checksum:i595158832F5806D4
GO
Isoform I (identifier: Q9W4T4-1) [UniParc]FASTAAdd to basket
Also known as: B, S
The sequence of this isoform can be found in the external entry Q9W4T4.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,209
Mass (Da):129,413
GO
Isoform F (identifier: Q8IRU4-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q8IRU4.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: No experimental confirmation available.
Length:662
Mass (Da):72,954
GO
Isoform G (identifier: Q9W4S9-2) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q9W4S9.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: No experimental confirmation available.
Length:814
Mass (Da):89,085
GO
Isoform N (identifier: Q9W4S9-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q9W4S9.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: No experimental confirmation available.
Length:983
Mass (Da):107,341
GO

Sequence cautioni

The sequence AAC34201 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAA38960 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAD24781 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti958D → S in CAA38960 (PubMed:1660926).Curated1
Sequence conflicti958D → S in AAC34201 (PubMed:3025834).Curated1
Sequence conflicti1027S → T in CAA38960 (PubMed:1660926).Curated1
Sequence conflicti1027S → T in AAC34201 (PubMed:3025834).Curated1
Sequence conflicti1042 – 1043SG → R in CAA38960 (PubMed:1660926).Curated2
Sequence conflicti1042 – 1043SG → R in AAC34201 (PubMed:3025834).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0045871 – 549Missing in isoform VII. 1 PublicationAdd BLAST549
Alternative sequenceiVSP_0188261 – 428Missing in isoform III. 1 PublicationAdd BLAST428
Alternative sequenceiVSP_0045851 – 369Missing in isoform IV. 1 PublicationAdd BLAST369
Alternative sequenceiVSP_0549551 – 367Missing in isoform R. 1 PublicationAdd BLAST367
Alternative sequenceiVSP_0549561 – 355Missing in isoform U. CuratedAdd BLAST355
Alternative sequenceiVSP_054957356 – 385GLHDM…SDLFG → MQAEQGSIGDLQKYHSRYLK NRRHTLANVR in isoform U. CuratedAdd BLAST30
Alternative sequenceiVSP_054958368 – 385SPLSP…SDLFG → MVCSFCCCCYNFRNSPSS in isoform R. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_004586370 – 385LSPRI…SDLFG → MVCSFCCCCYNFRNSP in isoform IV. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_004588444 – 456Missing in isoform V. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_004589493 – 494Missing in isoform VI. 1 Publication2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X55167
, X55168, X55169, X55170, X55171, X55172, X55173, X55174, X55175 Genomic DNA. Translation: CAA38960.1. Sequence problems.
M14982
, M14978, M14979, M14980, M14981 Unassigned DNA. Translation: AAC34201.1. Different initiation.
AE014298 Genomic DNA. Translation: AAF45861.2.
AE014298 Genomic DNA. Translation: AAF45862.3.
AE014298 Genomic DNA. Translation: AAF45865.2.
AE014298 Genomic DNA. Translation: AAN09600.1.
AE014298 Genomic DNA. Translation: AAN09601.3.
AE014298 Genomic DNA. Translation: AAN09602.2.
AE014298 Genomic DNA. Translation: AAN09604.1.
AE014298 Genomic DNA. Translation: AAN09607.2.
AE014298 Genomic DNA. Translation: AGB95048.1.
AE014298 Genomic DNA. Translation: AGB95049.1.
AL121800 Genomic DNA. Translation: CAD24781.1. Sequence problems.
AY119511 mRNA. Translation: AAM50165.1.
PIRiS65543.
RefSeqiNP_001259201.1. NM_001272272.1. [P12252-7]
NP_001259202.1. NM_001272273.1. [P12252-8]
NP_001259203.1. NM_001272274.1. [P12252-9]
NP_726849.1. NM_166961.2. [P12252-1]
NP_726850.1. NM_166962.2. [P12252-4]
NP_726851.3. NM_166963.2. [P12252-9]
NP_726852.2. NM_166964.2. [P12252-5]
NP_726853.2. NM_166965.2. [P12252-1]
NP_726854.2. NM_166966.3. [P12252-8]
NP_726855.1. NM_166967.2. [P12252-3]
NP_726857.1. NM_166969.2. [P12252-7]
NP_726859.2. NM_166971.2. [P12252-6]
UniGeneiDm.4817.

Genome annotation databases

EnsemblMetazoaiFBtr0070511; FBpp0070487; FBgn0000479. [P12252-1]
FBtr0070513; FBpp0070489; FBgn0000479. [P12252-1]
GeneIDi31309.
UCSCiCG32498-RA. d. melanogaster. [P12252-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X55167
, X55168, X55169, X55170, X55171, X55172, X55173, X55174, X55175 Genomic DNA. Translation: CAA38960.1. Sequence problems.
M14982
, M14978, M14979, M14980, M14981 Unassigned DNA. Translation: AAC34201.1. Different initiation.
AE014298 Genomic DNA. Translation: AAF45861.2.
AE014298 Genomic DNA. Translation: AAF45862.3.
AE014298 Genomic DNA. Translation: AAF45865.2.
AE014298 Genomic DNA. Translation: AAN09600.1.
AE014298 Genomic DNA. Translation: AAN09601.3.
AE014298 Genomic DNA. Translation: AAN09602.2.
AE014298 Genomic DNA. Translation: AAN09604.1.
AE014298 Genomic DNA. Translation: AAN09607.2.
AE014298 Genomic DNA. Translation: AGB95048.1.
AE014298 Genomic DNA. Translation: AGB95049.1.
AL121800 Genomic DNA. Translation: CAD24781.1. Sequence problems.
AY119511 mRNA. Translation: AAM50165.1.
PIRiS65543.
RefSeqiNP_001259201.1. NM_001272272.1. [P12252-7]
NP_001259202.1. NM_001272273.1. [P12252-8]
NP_001259203.1. NM_001272274.1. [P12252-9]
NP_726849.1. NM_166961.2. [P12252-1]
NP_726850.1. NM_166962.2. [P12252-4]
NP_726851.3. NM_166963.2. [P12252-9]
NP_726852.2. NM_166964.2. [P12252-5]
NP_726853.2. NM_166965.2. [P12252-1]
NP_726854.2. NM_166966.3. [P12252-8]
NP_726855.1. NM_166967.2. [P12252-3]
NP_726857.1. NM_166969.2. [P12252-7]
NP_726859.2. NM_166971.2. [P12252-6]
UniGeneiDm.4817.

3D structure databases

ProteinModelPortaliP12252.
SMRiP12252.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi57834. 8 interactors.
IntActiP12252. 3 interactors.

Proteomic databases

PRIDEiP12252.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0070511; FBpp0070487; FBgn0000479. [P12252-1]
FBtr0070513; FBpp0070489; FBgn0000479. [P12252-1]
GeneIDi31309.
UCSCiCG32498-RA. d. melanogaster. [P12252-1]

Organism-specific databases

CTDi31309.
FlyBaseiFBgn0000479. dnc.

Phylogenomic databases

GeneTreeiENSGT00760000118889.
OrthoDBiEOG091G06CD.

Enzyme and pathway databases

UniPathwayiUPA00762; UER00747.
ReactomeiR-DME-180024. DARPP-32 events.
R-DME-418555. G alpha (s) signalling events.

Miscellaneous databases

ChiTaRSidnc. fly.
GenomeRNAii31309.

Gene expression databases

BgeeiFBgn0000479.
ExpressionAtlasiP12252. baseline.
GenevisibleiP12252. DM.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
InterProiIPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPDE4B_DROME
AccessioniPrimary (citable) accession number: P12252
Secondary accession number(s): M9PGD1
, M9PGX1, O76918, Q8IRU3, Q8IRU6, Q8IRU8, Q8IRV0, Q8MRN3, Q8T8M0, Q9NF62, Q9W4S8, Q9W4T0, Q9W4T1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: August 16, 2005
Last modified: November 30, 2016
This is version 154 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.