Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P12252

- PDE4B_DROME

UniProt

P12252 - PDE4B_DROME

Protein

cAMP-specific 3',5'-cyclic phosphodiesterase

Gene

dnc

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 135 (01 Oct 2014)
      Sequence version 4 (16 Aug 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes By similarity. Vital for female fertility. Required for learning/memory.By similarity1 Publication

    Catalytic activityi

    Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.1 Publication

    Cofactori

    Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity.By similarity

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei732 – 7321Proton donorBy similarity
    Metal bindingi736 – 7361Divalent metal cation 1By similarity
    Metal bindingi772 – 7721Divalent metal cation 1By similarity
    Metal bindingi773 – 7731Divalent metal cation 1By similarity
    Metal bindingi773 – 7731Divalent metal cation 2By similarity
    Binding sitei773 – 7731cAMPBy similarity
    Metal bindingi890 – 8901Divalent metal cation 1By similarity
    Binding sitei890 – 8901cAMPBy similarity
    Sitei893 – 8931Binds AMP, but not cAMPBy similarity
    Binding sitei941 – 9411cAMPBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi732 – 7365cAMPBy similarity

    GO - Molecular functioni

    1. 3',5'-cyclic-nucleotide phosphodiesterase activity Source: InterPro
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. associative learning Source: FlyBase
    2. axon extension Source: FlyBase
    3. behavioral response to ethanol Source: FlyBase
    4. cAMP catabolic process Source: UniProtKB-UniPathway
    5. cAMP-mediated signaling Source: FlyBase
    6. circadian rhythm Source: FlyBase
    7. conditioned taste aversion Source: FlyBase
    8. courtship behavior Source: FlyBase
    9. lateral inhibition Source: FlyBase
    10. learning Source: FlyBase
    11. learning or memory Source: FlyBase
    12. locomotor rhythm Source: FlyBase
    13. mating behavior Source: FlyBase
    14. memory Source: FlyBase
    15. nonassociative learning Source: FlyBase
    16. olfactory learning Source: FlyBase
    17. oogenesis Source: FlyBase
    18. regulation of protein kinase A signaling Source: FlyBase
    19. reproduction Source: FlyBase
    20. short-term memory Source: FlyBase
    21. synaptic transmission Source: FlyBase
    22. thermosensory behavior Source: FlyBase

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Ligandi

    cAMP, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_209420. G alpha (s) signalling events.
    REACT_213958. DARPP-32 events.
    UniPathwayiUPA00762; UER00747.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    cAMP-specific 3',5'-cyclic phosphodiesterase (EC:3.1.4.53)
    Alternative name(s):
    Learning/memory process protein
    Protein dunce
    Gene namesi
    Name:dnc
    ORF Names:CG32498
    OrganismiDrosophila melanogaster (Fruit fly)
    Taxonomic identifieri7227 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
    ProteomesiUP000000803: Chromosome X

    Organism-specific databases

    FlyBaseiFBgn0000479. dnc.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10701070cAMP-specific 3',5'-cyclic phosphodiesterasePRO_0000023342Add
    BLAST

    Proteomic databases

    PRIDEiP12252.

    Expressioni

    Gene expression databases

    BgeeiP12252.

    Interactioni

    Subunit structurei

    Monomer.1 Publication

    Protein-protein interaction databases

    BioGridi57834. 7 interactions.
    IntActiP12252. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliP12252.
    SMRiP12252. Positions 552-586, 661-983.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi19 – 235Poly-Pro
    Compositional biasi57 – 210154Ser-richAdd
    BLAST
    Compositional biasi85 – 13046Gln-richAdd
    BLAST
    Compositional biasi1020 – 106950Gly-richAdd
    BLAST

    Sequence similaritiesi

    Phylogenomic databases

    GeneTreeiENSGT00660000095451.
    InParanoidiP12252.
    KOiK01120.
    OMAiTWGIEIF.

    Family and domain databases

    Gene3Di1.10.1300.10. 1 hit.
    InterProiIPR003607. HD/PDEase_dom.
    IPR023088. PDEase.
    IPR002073. PDEase_catalytic_dom.
    IPR023174. PDEase_CS.
    [Graphical view]
    PfamiPF00233. PDEase_I. 1 hit.
    [Graphical view]
    PRINTSiPR00387. PDIESTERASE1.
    SMARTiSM00471. HDc. 1 hit.
    [Graphical view]
    PROSITEiPS00126. PDEASE_I. 1 hit.
    [Graphical view]

    Sequences (12)i

    Sequence statusi: Complete.

    This entry describes 12 isoformsi produced by alternative splicing and alternative initiation. Align

    Isoform II (identifier: P12252-1) [UniParc]FASTAAdd to Basket

    Also known as: I, J

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSQESNGGPA AGGGAAAAPP PPPQYIITTP SEVDPDEVRS MADLELGSPE     50
    KQVQVQSQKF SSTSSTTKVA THSFSMSSSA GTTGQQSKQD SAQQIQQLQQ 100
    LQQLQQLQQQ QQQQQSQRII SSSTRSQSLQ SSTIVGEATT ITSGAAQILS 150
    ASAAASLAQQ LKAQSSTSII TSSEQRTSTS TSSSSSTRYI ASGSSNLAGG 200
    NSNSASSASS KTRFQSFLQQ PEGAHGFLTA HQKHVRQFVR STSAHSEAAA 250
    GVAGARAEKC IRSASTQIDD ASVAGVVESA GNLTDSSATG GSMQLSMSKL 300
    GLQQSSSILI SKSAETIEMK SSSAGMRTQL TLSGGFLAPP GNRKITILSP 350
    IHAPPGLHDM LKRAQGRSPL SPRISFPGSD SDLFGFDVEN GQGARSPLEG 400
    GSPSAGLVLQ NLPQRRESFL YRSDSDFEMS PKSMSRNSSI ASERFKEQEA 450
    SILVDRSHGE DLIVTPFAQI LASLRSVRNN LLSLTNVPAS NKSRRPNQSS 500
    SASRSGNPPG APLSQGEEAY TRLATDTIEE LDWCLDQLET IQTHRSVSDM 550
    ASLKFKRMLN KELSHFSESS RSGNQISEYI CSTFLDKQQE FDLPSLRVED 600
    NPELVAANAA AGQQSAGQYA RSRSPRGPPM SQISGVKRPL SHTNSFTGER 650
    LPTFGVETPR ENELGTLLGE LDTWGIQIFS IGEFSVNRPL TCVAYTIFQS 700
    RELLTSLMIP PKTFLNFMST LEDHYVKDNP FHNSLHAADV TQSTNVLLNT 750
    PALEGVFTPL EVGGALFAAC IHDVDHPGLT NQFLVNSSSE LALMYNDESV 800
    LENHHLAVAF KLLQNQGCDI FCNMQKKQRQ TLRKMVIDIV LSTDMSKHMS 850
    LLADLKTMVE TKKVAGSGVL LLDNYTDRIQ VLENLVHCAD LSNPTKPLPL 900
    YKRWVALLME EFFLQGDKER ESGMDISPMC DRHNATIEKS QVGFIDYIVH 950
    PLWETWADLV HPDAQDILDT LEENRDYYQS MIPPSPPPSG VDENPQEDRI 1000
    RFQVTLEESD QENLAELEEG DESGGESTTT GTTGTTAASA LSGAGGGGGG 1050
    GGGMAPRTGG CQNQPQHGGM 1070
    Length:1,070
    Mass (Da):115,079
    Last modified:August 16, 2005 - v4
    Checksum:i50A63BF7BCC8EDD9
    GO
    Isoform IV (identifier: P12252-3) [UniParc]FASTAAdd to Basket

    Also known as: A

    The sequence of this isoform differs from the canonical sequence as follows:
         1-369: Missing.
         370-385: LSPRISFPGSDSDLFG → MVCSFCCCCYNFRNSP

    Show »
    Length:701
    Mass (Da):77,193
    Checksum:i52B25B32753A0EFE
    GO
    Isoform V (identifier: P12252-4) [UniParc]FASTAAdd to Basket

    Also known as: C

    The sequence of this isoform differs from the canonical sequence as follows:
         444-456: Missing.

    Show »
    Length:1,057
    Mass (Da):113,506
    Checksum:iF6A7B73FAB4F196B
    GO
    Isoform VI (identifier: P12252-5) [UniParc]FASTAAdd to Basket

    Also known as: D

    The sequence of this isoform differs from the canonical sequence as follows:
         493-494: Missing.

    Show »
    Length:1,068
    Mass (Da):114,836
    Checksum:iBA4F5909F5F710C3
    GO
    Isoform VII (identifier: P12252-6) [UniParc]FASTAAdd to Basket

    Also known as: L

    The sequence of this isoform differs from the canonical sequence as follows:
         1-549: Missing.

    Show »
    Length:521
    Mass (Da):57,358
    Checksum:i0F40B7345882579D
    GO
    Isoform III (identifier: P12252-7) [UniParc]FASTAAdd to Basket

    Also known as: E, P

    The sequence of this isoform differs from the canonical sequence as follows:
         1-428: Missing.

    Note: Produced by alternative initiation at Met-429 of isoform II.

    Show »
    Length:642
    Mass (Da):70,625
    Checksum:i5F2BA8CE14598DCD
    GO
    Isoform R (identifier: P12252-8) [UniParc] [UniParc]FASTAAdd to Basket

    Also known as: Q

    The sequence of this isoform differs from the canonical sequence as follows:
         1-367: Missing.
         368-385: SPLSPRISFPGSDSDLFG → MVCSFCCCCYNFRNSPSS

    Note: No experimental confirmation available.

    Show »
    Length:703
    Mass (Da):77,368
    Checksum:iCA37B22CA8E46A0B
    GO
    Isoform U (identifier: P12252-9) [UniParc]FASTAAdd to Basket

    Also known as: T

    The sequence of this isoform differs from the canonical sequence as follows:
         1-355: Missing.
         356-385: GLHDMLKRAQGRSPLSPRISFPGSDSDLFG → MQAEQGSIGDLQKYHSRYLKNRRHTLANVR

    Note: No experimental confirmation available.

    Show »
    Length:715
    Mass (Da):78,887
    Checksum:i595158832F5806D4
    GO
    Isoform I (identifier: Q9W4T4-1) [UniParc]FASTAAdd to Basket

    Also known as: B, S

    The sequence of this isoform can be found in the external entry Q9W4T4.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
    Length:1,209
    Mass (Da):129,413
    GO
    Isoform F (identifier: Q8IRU4-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q8IRU4.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: No experimental confirmation available.

    Length:662
    Mass (Da):72,954
    GO
    Isoform G (identifier: Q9W4S9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q9W4S9.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: No experimental confirmation available.

    Length:814
    Mass (Da):89,085
    GO
    Isoform N (identifier: Q9W4S9-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q9W4S9.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: No experimental confirmation available.

    Length:983
    Mass (Da):107,341
    GO

    Sequence cautioni

    The sequence AAC34201.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAA38960.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAD24781.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti958 – 9581D → S in CAA38960. (PubMed:1660926)Curated
    Sequence conflicti958 – 9581D → S in AAC34201. (PubMed:3025834)Curated
    Sequence conflicti1027 – 10271S → T in CAA38960. (PubMed:1660926)Curated
    Sequence conflicti1027 – 10271S → T in AAC34201. (PubMed:3025834)Curated
    Sequence conflicti1042 – 10432SG → R in CAA38960. (PubMed:1660926)Curated
    Sequence conflicti1042 – 10432SG → R in AAC34201. (PubMed:3025834)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 549549Missing in isoform VII. 1 PublicationVSP_004587Add
    BLAST
    Alternative sequencei1 – 428428Missing in isoform III. 1 PublicationVSP_018826Add
    BLAST
    Alternative sequencei1 – 369369Missing in isoform IV. 1 PublicationVSP_004585Add
    BLAST
    Alternative sequencei1 – 367367Missing in isoform R. 1 PublicationVSP_054955Add
    BLAST
    Alternative sequencei1 – 355355Missing in isoform U. CuratedVSP_054956Add
    BLAST
    Alternative sequencei356 – 38530GLHDM…SDLFG → MQAEQGSIGDLQKYHSRYLK NRRHTLANVR in isoform U. CuratedVSP_054957Add
    BLAST
    Alternative sequencei368 – 38518SPLSP…SDLFG → MVCSFCCCCYNFRNSPSS in isoform R. 1 PublicationVSP_054958Add
    BLAST
    Alternative sequencei370 – 38516LSPRI…SDLFG → MVCSFCCCCYNFRNSP in isoform IV. 1 PublicationVSP_004586Add
    BLAST
    Alternative sequencei444 – 45613Missing in isoform V. 1 PublicationVSP_004588Add
    BLAST
    Alternative sequencei493 – 4942Missing in isoform VI. 1 PublicationVSP_004589

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X55167
    , X55168, X55169, X55170, X55171, X55172, X55173, X55174, X55175 Genomic DNA. Translation: CAA38960.1. Sequence problems.
    M14982
    , M14978, M14979, M14980, M14981 Unassigned DNA. Translation: AAC34201.1. Different initiation.
    AE014298 Genomic DNA. Translation: AAF45861.2.
    AE014298 Genomic DNA. Translation: AAF45862.3.
    AE014298 Genomic DNA. Translation: AAF45865.2.
    AE014298 Genomic DNA. Translation: AAN09600.1.
    AE014298 Genomic DNA. Translation: AAN09601.3.
    AE014298 Genomic DNA. Translation: AAN09602.2.
    AE014298 Genomic DNA. Translation: AAN09604.1.
    AE014298 Genomic DNA. Translation: AAN09607.2.
    AE014298 Genomic DNA. Translation: AGB95048.1.
    AE014298 Genomic DNA. Translation: AGB95049.1.
    AL121800 Genomic DNA. Translation: CAD24781.1. Sequence problems.
    AY119511 mRNA. Translation: AAM50165.1.
    PIRiS65543.
    RefSeqiNP_001259201.1. NM_001272272.1. [P12252-7]
    NP_001259202.1. NM_001272273.1. [P12252-8]
    NP_001259203.1. NM_001272274.1. [P12252-9]
    NP_726849.1. NM_166961.2. [P12252-1]
    NP_726850.1. NM_166962.2. [P12252-4]
    NP_726851.3. NM_166963.2. [P12252-9]
    NP_726852.2. NM_166964.2. [P12252-5]
    NP_726853.2. NM_166965.2. [P12252-1]
    NP_726854.2. NM_166966.3. [P12252-8]
    NP_726855.1. NM_166967.2. [P12252-3]
    NP_726857.1. NM_166969.2. [P12252-7]
    NP_726859.2. NM_166971.2. [P12252-6]
    UniGeneiDm.4817.

    Genome annotation databases

    EnsemblMetazoaiFBtr0070511; FBpp0070487; FBgn0000479. [P12252-1]
    FBtr0070513; FBpp0070489; FBgn0000479. [P12252-1]
    FBtr0333313; FBpp0305505; FBgn0000479. [P12252-8]
    FBtr0333314; FBpp0305506; FBgn0000479. [P12252-8]
    FBtr0333316; FBpp0305508; FBgn0000479. [P12252-9]
    FBtr0333317; FBpp0305509; FBgn0000479. [P12252-9]
    GeneIDi31309.
    KEGGidme:Dmel_CG32498.
    UCSCiCG32498-RA. d. melanogaster. [P12252-1]

    Keywords - Coding sequence diversityi

    Alternative initiation, Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X55167
    , X55168 , X55169 , X55170 , X55171 , X55172 , X55173 , X55174 , X55175 Genomic DNA. Translation: CAA38960.1 . Sequence problems.
    M14982
    , M14978 , M14979 , M14980 , M14981 Unassigned DNA. Translation: AAC34201.1 . Different initiation.
    AE014298 Genomic DNA. Translation: AAF45861.2 .
    AE014298 Genomic DNA. Translation: AAF45862.3 .
    AE014298 Genomic DNA. Translation: AAF45865.2 .
    AE014298 Genomic DNA. Translation: AAN09600.1 .
    AE014298 Genomic DNA. Translation: AAN09601.3 .
    AE014298 Genomic DNA. Translation: AAN09602.2 .
    AE014298 Genomic DNA. Translation: AAN09604.1 .
    AE014298 Genomic DNA. Translation: AAN09607.2 .
    AE014298 Genomic DNA. Translation: AGB95048.1 .
    AE014298 Genomic DNA. Translation: AGB95049.1 .
    AL121800 Genomic DNA. Translation: CAD24781.1 . Sequence problems.
    AY119511 mRNA. Translation: AAM50165.1 .
    PIRi S65543.
    RefSeqi NP_001259201.1. NM_001272272.1. [P12252-7 ]
    NP_001259202.1. NM_001272273.1. [P12252-8 ]
    NP_001259203.1. NM_001272274.1. [P12252-9 ]
    NP_726849.1. NM_166961.2. [P12252-1 ]
    NP_726850.1. NM_166962.2. [P12252-4 ]
    NP_726851.3. NM_166963.2. [P12252-9 ]
    NP_726852.2. NM_166964.2. [P12252-5 ]
    NP_726853.2. NM_166965.2. [P12252-1 ]
    NP_726854.2. NM_166966.3. [P12252-8 ]
    NP_726855.1. NM_166967.2. [P12252-3 ]
    NP_726857.1. NM_166969.2. [P12252-7 ]
    NP_726859.2. NM_166971.2. [P12252-6 ]
    UniGenei Dm.4817.

    3D structure databases

    ProteinModelPortali P12252.
    SMRi P12252. Positions 552-586, 661-983.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 57834. 7 interactions.
    IntActi P12252. 1 interaction.

    Proteomic databases

    PRIDEi P12252.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblMetazoai FBtr0070511 ; FBpp0070487 ; FBgn0000479 . [P12252-1 ]
    FBtr0070513 ; FBpp0070489 ; FBgn0000479 . [P12252-1 ]
    FBtr0333313 ; FBpp0305505 ; FBgn0000479 . [P12252-8 ]
    FBtr0333314 ; FBpp0305506 ; FBgn0000479 . [P12252-8 ]
    FBtr0333316 ; FBpp0305508 ; FBgn0000479 . [P12252-9 ]
    FBtr0333317 ; FBpp0305509 ; FBgn0000479 . [P12252-9 ]
    GeneIDi 31309.
    KEGGi dme:Dmel_CG32498.
    UCSCi CG32498-RA. d. melanogaster. [P12252-1 ]

    Organism-specific databases

    CTDi 31309.
    FlyBasei FBgn0000479. dnc.

    Phylogenomic databases

    GeneTreei ENSGT00660000095451.
    InParanoidi P12252.
    KOi K01120.
    OMAi TWGIEIF.

    Enzyme and pathway databases

    UniPathwayi UPA00762 ; UER00747 .
    Reactomei REACT_209420. G alpha (s) signalling events.
    REACT_213958. DARPP-32 events.

    Miscellaneous databases

    ChiTaRSi dnc. drosophila.
    GenomeRNAii 31309.
    NextBioi 772953.

    Gene expression databases

    Bgeei P12252.

    Family and domain databases

    Gene3Di 1.10.1300.10. 1 hit.
    InterProi IPR003607. HD/PDEase_dom.
    IPR023088. PDEase.
    IPR002073. PDEase_catalytic_dom.
    IPR023174. PDEase_CS.
    [Graphical view ]
    Pfami PF00233. PDEase_I. 1 hit.
    [Graphical view ]
    PRINTSi PR00387. PDIESTERASE1.
    SMARTi SM00471. HDc. 1 hit.
    [Graphical view ]
    PROSITEi PS00126. PDEASE_I. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of the memory gene dunce of Drosophila melanogaster."
      Qiu Y.H., Chen C.-N., Malone T., Richter L., Beckendorf S.K., Davis R.L.
      J. Mol. Biol. 222:553-565(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS III; IV AND R), NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 293-1070 (ISOFORMS II; V AND VI), NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 356-1070 (ISOFORM I), SEQUENCE REVISION, FUNCTION, CATALYTIC ACTIVITY, SUBUNIT.
      Strain: Canton-S.
    2. "Molecular analysis of cDNA clones and the corresponding genomic coding sequences of the Drosophila dunce+ gene, the structural gene for cAMP phosphodiesterase."
      Chen C.-N., Denome S., Davis R.L.
      Proc. Natl. Acad. Sci. U.S.A. 83:9313-9317(1986) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 699-1070.
    3. "The genome sequence of Drosophila melanogaster."
      Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
      , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
      Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Berkeley.
    4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
      Strain: Berkeley.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS I; G AND VII).
      Strain: Oregon-R.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM VII).
      Strain: Berkeley.
      Tissue: Head.

    Entry informationi

    Entry nameiPDE4B_DROME
    AccessioniPrimary (citable) accession number: P12252
    Secondary accession number(s): M9PGD1
    , M9PGX1, O76918, Q8IRU3, Q8IRU6, Q8IRU8, Q8IRV0, Q8MRN3, Q8T8M0, Q9NF62, Q9W4S8, Q9W4T0, Q9W4T1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1989
    Last sequence update: August 16, 2005
    Last modified: October 1, 2014
    This is version 135 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programDrosophila annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Drosophila
      Drosophila: entries, gene names and cross-references to FlyBase
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3