Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P12252 (PDE4B_DROME) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 133. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
cAMP-specific 3',5'-cyclic phosphodiesterase

EC=3.1.4.53
Alternative name(s):
Learning/memory process protein
Protein dunce
Gene names
Name:dnc
ORF Names:CG32498
OrganismDrosophila melanogaster (Fruit fly) [Reference proteome]
Taxonomic identifier7227 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora

Protein attributes

Sequence length1070 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes By similarity. Vital for female fertility. Required for learning/memory. Ref.1

Catalytic activity

Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate. Ref.1

Cofactor

Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity.

Pathway

Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.

Subunit structure

Monomer. Ref.1

Sequence similarities

Belongs to the cyclic nucleotide phosphodiesterase family. PDE4 subfamily.

Sequence caution

The sequence AAC34201.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence CAA38960.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAD24781.1 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Keywords
   Coding sequence diversityAlternative initiation
Alternative splicing
   LigandcAMP
Metal-binding
   Molecular functionHydrolase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processassociative learning

Inferred from mutant phenotype PubMed 10970024. Source: FlyBase

axon extension

Inferred from mutant phenotype PubMed 14960616. Source: FlyBase

behavioral response to ethanol

Non-traceable author statement PubMed 11715043. Source: FlyBase

cAMP catabolic process

Inferred from electronic annotation. Source: UniProtKB-UniPathway

cAMP-mediated signaling

Non-traceable author statement PubMed 11092827PubMed 11462211PubMed 11741030PubMed 14515157. Source: FlyBase

circadian rhythm

Traceable author statement PubMed 12486701. Source: FlyBase

conditioned taste aversion

Inferred from mutant phenotype PubMed 19158309. Source: FlyBase

courtship behavior

Traceable author statement PubMed 11092827PubMed 11715043PubMed 12486700. Source: FlyBase

lateral inhibition

Inferred from mutant phenotype PubMed 19363474. Source: FlyBase

learning

Inferred from mutant phenotype PubMed 16135747. Source: FlyBase

learning or memory

Non-traceable author statement PubMed 11715043PubMed 14515157. Source: FlyBase

locomotor rhythm

Non-traceable author statement PubMed 11715043. Source: FlyBase

mating behavior

Traceable author statement PubMed 14504657. Source: FlyBase

memory

Inferred from mutant phenotype PubMed 10970024. Source: FlyBase

nonassociative learning

Traceable author statement PubMed 14504657. Source: FlyBase

olfactory learning

Traceable author statement PubMed 11462211PubMed 11715043. Source: FlyBase

oogenesis

Traceable author statement PubMed 3089870. Source: FlyBase

regulation of protein kinase A signaling

Inferred from mutant phenotype PubMed 20188656. Source: FlyBase

reproduction

Non-traceable author statement PubMed 11715043. Source: FlyBase

short-term memory

Inferred from mutant phenotype PubMed 19158309. Source: FlyBase

synaptic transmission

Inferred from mutant phenotype PubMed 12040051PubMed 14507965. Source: FlyBase

thermosensory behavior

Inferred from mutant phenotype PubMed 18594510. Source: FlyBase

   Molecular_function3',5'-cyclic-nucleotide phosphodiesterase activity

Inferred from electronic annotation. Source: InterPro

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 12 isoforms produced by alternative splicing and alternative initiation. [Align] [Select]
Isoform II (identifier: P12252-1)

Also known as: I; J;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform IV (identifier: P12252-3)

Also known as: A;

The sequence of this isoform differs from the canonical sequence as follows:
     1-369: Missing.
     370-385: LSPRISFPGSDSDLFG → MVCSFCCCCYNFRNSP
Isoform V (identifier: P12252-4)

Also known as: C;

The sequence of this isoform differs from the canonical sequence as follows:
     444-456: Missing.
Isoform VI (identifier: P12252-5)

Also known as: D;

The sequence of this isoform differs from the canonical sequence as follows:
     493-494: Missing.
Isoform VII (identifier: P12252-6)

Also known as: L;

The sequence of this isoform differs from the canonical sequence as follows:
     1-549: Missing.
Isoform III (identifier: P12252-7)

Also known as: E; P;

The sequence of this isoform differs from the canonical sequence as follows:
     1-428: Missing.
Note: Produced by alternative initiation at Met-429 of isoform II.
Isoform R (identifier: P12252-8)

Also known as: Q;

The sequence of this isoform differs from the canonical sequence as follows:
     1-367: Missing.
     368-385: SPLSPRISFPGSDSDLFG → MVCSFCCCCYNFRNSPSS
Note: No experimental confirmation available.
Isoform U (identifier: P12252-9)

Also known as: T;

The sequence of this isoform differs from the canonical sequence as follows:
     1-355: Missing.
     356-385: GLHDMLKRAQGRSPLSPRISFPGSDSDLFG → MQAEQGSIGDLQKYHSRYLKNRRHTLANVR
Note: No experimental confirmation available.
Isoform I (identifier: Q9W4T4-1)

Also known as: B; S;

The sequence of this isoform can be found in the external entry Q9W4T4.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Isoform F (identifier: Q8IRU4-1)

The sequence of this isoform can be found in the external entry Q8IRU4.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: No experimental confirmation available.
Isoform G (identifier: Q9W4S9-2)

The sequence of this isoform can be found in the external entry Q9W4S9.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: No experimental confirmation available.
Isoform N (identifier: Q9W4S9-1)

The sequence of this isoform can be found in the external entry Q9W4S9.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10701070cAMP-specific 3',5'-cyclic phosphodiesterase
PRO_0000023342

Regions

Nucleotide binding732 – 7365cAMP By similarity
Compositional bias19 – 235Poly-Pro
Compositional bias57 – 210154Ser-rich
Compositional bias85 – 13046Gln-rich
Compositional bias1020 – 106950Gly-rich

Sites

Active site7321Proton donor By similarity
Metal binding7361Divalent metal cation 1 By similarity
Metal binding7721Divalent metal cation 1 By similarity
Metal binding7731Divalent metal cation 1 By similarity
Metal binding7731Divalent metal cation 2 By similarity
Metal binding8901Divalent metal cation 1 By similarity
Binding site7731cAMP By similarity
Binding site8901cAMP By similarity
Binding site9411cAMP By similarity
Site8931Binds AMP, but not cAMP By similarity

Natural variations

Alternative sequence1 – 549549Missing in isoform VII.
VSP_004587
Alternative sequence1 – 428428Missing in isoform III.
VSP_018826
Alternative sequence1 – 369369Missing in isoform IV.
VSP_004585
Alternative sequence1 – 367367Missing in isoform R.
VSP_054955
Alternative sequence1 – 355355Missing in isoform U.
VSP_054956
Alternative sequence356 – 38530GLHDM…SDLFG → MQAEQGSIGDLQKYHSRYLK NRRHTLANVR in isoform U.
VSP_054957
Alternative sequence368 – 38518SPLSP…SDLFG → MVCSFCCCCYNFRNSPSS in isoform R.
VSP_054958
Alternative sequence370 – 38516LSPRI…SDLFG → MVCSFCCCCYNFRNSP in isoform IV.
VSP_004586
Alternative sequence444 – 45613Missing in isoform V.
VSP_004588
Alternative sequence493 – 4942Missing in isoform VI.
VSP_004589

Experimental info

Sequence conflict9581D → S in CAA38960. Ref.1
Sequence conflict9581D → S in AAC34201. Ref.2
Sequence conflict10271S → T in CAA38960. Ref.1
Sequence conflict10271S → T in AAC34201. Ref.2
Sequence conflict1042 – 10432SG → R in CAA38960. Ref.1
Sequence conflict1042 – 10432SG → R in AAC34201. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform II (I) (J) [UniParc].

Last modified August 16, 2005. Version 4.
Checksum: 50A63BF7BCC8EDD9

FASTA1,070115,079
        10         20         30         40         50         60 
MSQESNGGPA AGGGAAAAPP PPPQYIITTP SEVDPDEVRS MADLELGSPE KQVQVQSQKF 

        70         80         90        100        110        120 
SSTSSTTKVA THSFSMSSSA GTTGQQSKQD SAQQIQQLQQ LQQLQQLQQQ QQQQQSQRII 

       130        140        150        160        170        180 
SSSTRSQSLQ SSTIVGEATT ITSGAAQILS ASAAASLAQQ LKAQSSTSII TSSEQRTSTS 

       190        200        210        220        230        240 
TSSSSSTRYI ASGSSNLAGG NSNSASSASS KTRFQSFLQQ PEGAHGFLTA HQKHVRQFVR 

       250        260        270        280        290        300 
STSAHSEAAA GVAGARAEKC IRSASTQIDD ASVAGVVESA GNLTDSSATG GSMQLSMSKL 

       310        320        330        340        350        360 
GLQQSSSILI SKSAETIEMK SSSAGMRTQL TLSGGFLAPP GNRKITILSP IHAPPGLHDM 

       370        380        390        400        410        420 
LKRAQGRSPL SPRISFPGSD SDLFGFDVEN GQGARSPLEG GSPSAGLVLQ NLPQRRESFL 

       430        440        450        460        470        480 
YRSDSDFEMS PKSMSRNSSI ASERFKEQEA SILVDRSHGE DLIVTPFAQI LASLRSVRNN 

       490        500        510        520        530        540 
LLSLTNVPAS NKSRRPNQSS SASRSGNPPG APLSQGEEAY TRLATDTIEE LDWCLDQLET 

       550        560        570        580        590        600 
IQTHRSVSDM ASLKFKRMLN KELSHFSESS RSGNQISEYI CSTFLDKQQE FDLPSLRVED 

       610        620        630        640        650        660 
NPELVAANAA AGQQSAGQYA RSRSPRGPPM SQISGVKRPL SHTNSFTGER LPTFGVETPR 

       670        680        690        700        710        720 
ENELGTLLGE LDTWGIQIFS IGEFSVNRPL TCVAYTIFQS RELLTSLMIP PKTFLNFMST 

       730        740        750        760        770        780 
LEDHYVKDNP FHNSLHAADV TQSTNVLLNT PALEGVFTPL EVGGALFAAC IHDVDHPGLT 

       790        800        810        820        830        840 
NQFLVNSSSE LALMYNDESV LENHHLAVAF KLLQNQGCDI FCNMQKKQRQ TLRKMVIDIV 

       850        860        870        880        890        900 
LSTDMSKHMS LLADLKTMVE TKKVAGSGVL LLDNYTDRIQ VLENLVHCAD LSNPTKPLPL 

       910        920        930        940        950        960 
YKRWVALLME EFFLQGDKER ESGMDISPMC DRHNATIEKS QVGFIDYIVH PLWETWADLV 

       970        980        990       1000       1010       1020 
HPDAQDILDT LEENRDYYQS MIPPSPPPSG VDENPQEDRI RFQVTLEESD QENLAELEEG 

      1030       1040       1050       1060       1070 
DESGGESTTT GTTGTTAASA LSGAGGGGGG GGGMAPRTGG CQNQPQHGGM 

« Hide

Isoform IV (A) [UniParc].

Checksum: 52B25B32753A0EFE
Show »

FASTA70177,193
Isoform V (C) [UniParc].

Checksum: F6A7B73FAB4F196B
Show »

FASTA1,057113,506
Isoform VI (D) [UniParc].

Checksum: BA4F5909F5F710C3
Show »

FASTA1,068114,836
Isoform VII (L) [UniParc].

Checksum: 0F40B7345882579D
Show »

FASTA52157,358
Isoform III (E) (P) [UniParc].

Checksum: 5F2BA8CE14598DCD
Show »

FASTA64270,625
Isoform R (Q) [UniParc] [UniParc].

Checksum: CA37B22CA8E46A0B
Show »

FASTA70377,368
Isoform U (T) [UniParc].

Checksum: 595158832F5806D4
Show »

FASTA71578,887
Isoform I (B) (S) [UniParc].

See Q9W4T4.

Isoform F [UniParc].

See Q8IRU4.

Isoform G [UniParc].

See Q9W4S9.

Isoform N [UniParc].

See Q9W4S9.

References

« Hide 'large scale' references
[1]"Characterization of the memory gene dunce of Drosophila melanogaster."
Qiu Y.H., Chen C.-N., Malone T., Richter L., Beckendorf S.K., Davis R.L.
J. Mol. Biol. 222:553-565(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS III; IV AND R), NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 293-1070 (ISOFORMS II; V AND VI), NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 356-1070 (ISOFORM I), SEQUENCE REVISION, FUNCTION, CATALYTIC ACTIVITY, SUBUNIT.
Strain: Canton-S.
[2]"Molecular analysis of cDNA clones and the corresponding genomic coding sequences of the Drosophila dunce+ gene, the structural gene for cAMP phosphodiesterase."
Chen C.-N., Denome S., Davis R.L.
Proc. Natl. Acad. Sci. U.S.A. 83:9313-9317(1986) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 699-1070.
[3]"The genome sequence of Drosophila melanogaster."
Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. expand/collapse author list , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: Berkeley.
[4]"Annotation of the Drosophila melanogaster euchromatic genome: a systematic review."
Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. expand/collapse author list , Drysdale R.A., Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q., Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M., Lewis S.E.
Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
Strain: Berkeley.
[5]"From sequence to chromosome: the tip of the X chromosome of D. melanogaster."
Benos P.V., Gatt M.K., Ashburner M., Murphy L., Harris D., Barrell B.G., Ferraz C., Vidal S., Brun C., Demailles J., Cadieu E., Dreano S., Gloux S., Lelaure V., Mottier S., Galibert F., Borkova D., Minana B. expand/collapse author list , Kafatos F.C., Louis C., Siden-Kiamos I., Bolshakov S., Papagiannakis G., Spanos L., Cox S., Madueno E., de Pablos B., Modolell J., Peter A., Schoettler P., Werner M., Mourkioti F., Beinert N., Dowe G., Schaefer U., Jaeckle H., Bucheton A., Callister D.M., Campbell L.A., Darlamitsou A., Henderson N.S., McMillan P.J., Salles C., Tait E.A., Valenti P., Saunders R.D.C., Glover D.M.
Science 287:2220-2222(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS I; G AND VII).
Strain: Oregon-R.
[6]"A Drosophila full-length cDNA resource."
Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E.
Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM VII).
Strain: Berkeley.
Tissue: Head.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X55167 expand/collapse EMBL AC list , X55168, X55169, X55170, X55171, X55172, X55173, X55174, X55175 Genomic DNA. Translation: CAA38960.1. Sequence problems.
M14982 expand/collapse EMBL AC list , M14978, M14979, M14980, M14981 Unassigned DNA. Translation: AAC34201.1. Different initiation.
AE014298 Genomic DNA. Translation: AAF45861.2.
AE014298 Genomic DNA. Translation: AAF45862.3.
AE014298 Genomic DNA. Translation: AAF45865.2.
AE014298 Genomic DNA. Translation: AAN09600.1.
AE014298 Genomic DNA. Translation: AAN09601.3.
AE014298 Genomic DNA. Translation: AAN09602.2.
AE014298 Genomic DNA. Translation: AAN09604.1.
AE014298 Genomic DNA. Translation: AAN09607.2.
AE014298 Genomic DNA. Translation: AGB95048.1.
AE014298 Genomic DNA. Translation: AGB95049.1.
AL121800 Genomic DNA. Translation: CAD24781.1. Sequence problems.
AY119511 mRNA. Translation: AAM50165.1.
PIRS65543.
RefSeqNP_001259201.1. NM_001272272.1. [P12252-7]
NP_001259202.1. NM_001272273.1.
NP_001259203.1. NM_001272274.1.
NP_726849.1. NM_166961.2. [P12252-1]
NP_726850.1. NM_166962.2. [P12252-4]
NP_726851.3. NM_166963.2.
NP_726852.2. NM_166964.2. [P12252-5]
NP_726853.2. NM_166965.2. [P12252-1]
NP_726854.2. NM_166966.3.
NP_726855.1. NM_166967.2. [P12252-3]
NP_726857.1. NM_166969.2. [P12252-7]
NP_726859.2. NM_166971.2. [P12252-6]
UniGeneDm.4817.

3D structure databases

ProteinModelPortalP12252.
SMRP12252. Positions 552-586, 661-983.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid57834. 7 interactions.
IntActP12252. 1 interaction.

Proteomic databases

PRIDEP12252.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaFBtr0070511; FBpp0070487; FBgn0000479. [P12252-1]
FBtr0070513; FBpp0070489; FBgn0000479. [P12252-1]
FBtr0333313; FBpp0305505; FBgn0000479. [P12252-8]
FBtr0333314; FBpp0305506; FBgn0000479. [P12252-8]
FBtr0333316; FBpp0305508; FBgn0000479. [P12252-9]
FBtr0333317; FBpp0305509; FBgn0000479. [P12252-9]
GeneID31309.
KEGGdme:Dmel_CG32498.
UCSCCG32498-RA. d. melanogaster. [P12252-1]

Organism-specific databases

CTD31309.
FlyBaseFBgn0000479. dnc.

Phylogenomic databases

GeneTreeENSGT00660000095451.
InParanoidP12252.
KOK01120.
OMATWGIEIF.

Enzyme and pathway databases

UniPathwayUPA00762; UER00747.

Gene expression databases

BgeeP12252.

Family and domain databases

Gene3D1.10.1300.10. 1 hit.
InterProIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamPF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSPR00387. PDIESTERASE1.
SMARTSM00471. HDc. 1 hit.
[Graphical view]
PROSITEPS00126. PDEASE_I. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSdnc. drosophila.
GenomeRNAi31309.
NextBio772953.

Entry information

Entry namePDE4B_DROME
AccessionPrimary (citable) accession number: P12252
Secondary accession number(s): M9PGD1 expand/collapse secondary AC list , M9PGX1, O76918, Q8IRU3, Q8IRU6, Q8IRU8, Q8IRV0, Q8MRN3, Q8T8M0, Q9NF62, Q9W4S8, Q9W4T0, Q9W4T1
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: August 16, 2005
Last modified: July 9, 2014
This is version 133 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

Drosophila

Drosophila: entries, gene names and cross-references to FlyBase