Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P12252

- PDE4B_DROME

UniProt

P12252 - PDE4B_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

cAMP-specific 3',5'-cyclic phosphodiesterase

Gene

dnc

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes By similarity. Vital for female fertility. Required for learning/memory.By similarity1 Publication

Catalytic activityi

Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.1 Publication

Cofactori

Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity.By similarity

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei732 – 7321Proton donorBy similarity
Metal bindingi736 – 7361Divalent metal cation 1By similarity
Metal bindingi772 – 7721Divalent metal cation 1By similarity
Metal bindingi773 – 7731Divalent metal cation 1By similarity
Metal bindingi773 – 7731Divalent metal cation 2By similarity
Binding sitei773 – 7731cAMPBy similarity
Metal bindingi890 – 8901Divalent metal cation 1By similarity
Binding sitei890 – 8901cAMPBy similarity
Sitei893 – 8931Binds AMP, but not cAMPBy similarity
Binding sitei941 – 9411cAMPBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi732 – 7365cAMPBy similarity

GO - Molecular functioni

  1. 3',5'-cyclic-nucleotide phosphodiesterase activity Source: InterPro
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. associative learning Source: FlyBase
  2. axon extension Source: FlyBase
  3. behavioral response to ethanol Source: FlyBase
  4. cAMP catabolic process Source: UniProtKB-UniPathway
  5. cAMP-mediated signaling Source: FlyBase
  6. circadian rhythm Source: FlyBase
  7. conditioned taste aversion Source: FlyBase
  8. courtship behavior Source: FlyBase
  9. lateral inhibition Source: FlyBase
  10. learning Source: FlyBase
  11. learning or memory Source: FlyBase
  12. locomotor rhythm Source: FlyBase
  13. mating behavior Source: FlyBase
  14. memory Source: FlyBase
  15. nonassociative learning Source: FlyBase
  16. olfactory learning Source: FlyBase
  17. oogenesis Source: FlyBase
  18. regulation of protein kinase A signaling Source: FlyBase
  19. reproduction Source: FlyBase
  20. short-term memory Source: FlyBase
  21. synaptic transmission Source: FlyBase
  22. thermosensory behavior Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

cAMP, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_209420. G alpha (s) signalling events.
REACT_213958. DARPP-32 events.
UniPathwayiUPA00762; UER00747.

Names & Taxonomyi

Protein namesi
Recommended name:
cAMP-specific 3',5'-cyclic phosphodiesterase (EC:3.1.4.53)
Alternative name(s):
Learning/memory process protein
Protein dunce
Gene namesi
Name:dnc
ORF Names:CG32498
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome X

Organism-specific databases

FlyBaseiFBgn0000479. dnc.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10701070cAMP-specific 3',5'-cyclic phosphodiesterasePRO_0000023342Add
BLAST

Proteomic databases

PRIDEiP12252.

Expressioni

Gene expression databases

BgeeiP12252.

Interactioni

Subunit structurei

Monomer.1 Publication

Protein-protein interaction databases

BioGridi57834. 7 interactions.
IntActiP12252. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliP12252.
SMRiP12252. Positions 552-586, 661-983.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi19 – 235Poly-Pro
Compositional biasi57 – 210154Ser-richAdd
BLAST
Compositional biasi85 – 13046Gln-richAdd
BLAST
Compositional biasi1020 – 106950Gly-richAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

GeneTreeiENSGT00760000118889.
KOiK13293.
OMAiTWGIEIF.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
InterProiIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]

Sequences (12)i

Sequence statusi: Complete.

This entry describes 12 isoformsi produced by alternative splicing and alternative initiation. Align

Isoform II (identifier: P12252-1) [UniParc]FASTAAdd to Basket

Also known as: I, J

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQESNGGPA AGGGAAAAPP PPPQYIITTP SEVDPDEVRS MADLELGSPE
60 70 80 90 100
KQVQVQSQKF SSTSSTTKVA THSFSMSSSA GTTGQQSKQD SAQQIQQLQQ
110 120 130 140 150
LQQLQQLQQQ QQQQQSQRII SSSTRSQSLQ SSTIVGEATT ITSGAAQILS
160 170 180 190 200
ASAAASLAQQ LKAQSSTSII TSSEQRTSTS TSSSSSTRYI ASGSSNLAGG
210 220 230 240 250
NSNSASSASS KTRFQSFLQQ PEGAHGFLTA HQKHVRQFVR STSAHSEAAA
260 270 280 290 300
GVAGARAEKC IRSASTQIDD ASVAGVVESA GNLTDSSATG GSMQLSMSKL
310 320 330 340 350
GLQQSSSILI SKSAETIEMK SSSAGMRTQL TLSGGFLAPP GNRKITILSP
360 370 380 390 400
IHAPPGLHDM LKRAQGRSPL SPRISFPGSD SDLFGFDVEN GQGARSPLEG
410 420 430 440 450
GSPSAGLVLQ NLPQRRESFL YRSDSDFEMS PKSMSRNSSI ASERFKEQEA
460 470 480 490 500
SILVDRSHGE DLIVTPFAQI LASLRSVRNN LLSLTNVPAS NKSRRPNQSS
510 520 530 540 550
SASRSGNPPG APLSQGEEAY TRLATDTIEE LDWCLDQLET IQTHRSVSDM
560 570 580 590 600
ASLKFKRMLN KELSHFSESS RSGNQISEYI CSTFLDKQQE FDLPSLRVED
610 620 630 640 650
NPELVAANAA AGQQSAGQYA RSRSPRGPPM SQISGVKRPL SHTNSFTGER
660 670 680 690 700
LPTFGVETPR ENELGTLLGE LDTWGIQIFS IGEFSVNRPL TCVAYTIFQS
710 720 730 740 750
RELLTSLMIP PKTFLNFMST LEDHYVKDNP FHNSLHAADV TQSTNVLLNT
760 770 780 790 800
PALEGVFTPL EVGGALFAAC IHDVDHPGLT NQFLVNSSSE LALMYNDESV
810 820 830 840 850
LENHHLAVAF KLLQNQGCDI FCNMQKKQRQ TLRKMVIDIV LSTDMSKHMS
860 870 880 890 900
LLADLKTMVE TKKVAGSGVL LLDNYTDRIQ VLENLVHCAD LSNPTKPLPL
910 920 930 940 950
YKRWVALLME EFFLQGDKER ESGMDISPMC DRHNATIEKS QVGFIDYIVH
960 970 980 990 1000
PLWETWADLV HPDAQDILDT LEENRDYYQS MIPPSPPPSG VDENPQEDRI
1010 1020 1030 1040 1050
RFQVTLEESD QENLAELEEG DESGGESTTT GTTGTTAASA LSGAGGGGGG
1060 1070
GGGMAPRTGG CQNQPQHGGM
Length:1,070
Mass (Da):115,079
Last modified:August 16, 2005 - v4
Checksum:i50A63BF7BCC8EDD9
GO
Isoform IV (identifier: P12252-3) [UniParc]FASTAAdd to Basket

Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     1-369: Missing.
     370-385: LSPRISFPGSDSDLFG → MVCSFCCCCYNFRNSP

Show »
Length:701
Mass (Da):77,193
Checksum:i52B25B32753A0EFE
GO
Isoform V (identifier: P12252-4) [UniParc]FASTAAdd to Basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     444-456: Missing.

Show »
Length:1,057
Mass (Da):113,506
Checksum:iF6A7B73FAB4F196B
GO
Isoform VI (identifier: P12252-5) [UniParc]FASTAAdd to Basket

Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     493-494: Missing.

Show »
Length:1,068
Mass (Da):114,836
Checksum:iBA4F5909F5F710C3
GO
Isoform VII (identifier: P12252-6) [UniParc]FASTAAdd to Basket

Also known as: L

The sequence of this isoform differs from the canonical sequence as follows:
     1-549: Missing.

Show »
Length:521
Mass (Da):57,358
Checksum:i0F40B7345882579D
GO
Isoform III (identifier: P12252-7) [UniParc]FASTAAdd to Basket

Also known as: E, P

The sequence of this isoform differs from the canonical sequence as follows:
     1-428: Missing.

Note: Produced by alternative initiation at Met-429 of isoform II.

Show »
Length:642
Mass (Da):70,625
Checksum:i5F2BA8CE14598DCD
GO
Isoform R (identifier: P12252-8) [UniParc] [UniParc]FASTAAdd to Basket

Also known as: Q

The sequence of this isoform differs from the canonical sequence as follows:
     1-367: Missing.
     368-385: SPLSPRISFPGSDSDLFG → MVCSFCCCCYNFRNSPSS

Note: No experimental confirmation available.

Show »
Length:703
Mass (Da):77,368
Checksum:iCA37B22CA8E46A0B
GO
Isoform U (identifier: P12252-9) [UniParc]FASTAAdd to Basket

Also known as: T

The sequence of this isoform differs from the canonical sequence as follows:
     1-355: Missing.
     356-385: GLHDMLKRAQGRSPLSPRISFPGSDSDLFG → MQAEQGSIGDLQKYHSRYLKNRRHTLANVR

Note: No experimental confirmation available.

Show »
Length:715
Mass (Da):78,887
Checksum:i595158832F5806D4
GO
Isoform I (identifier: Q9W4T4-1) [UniParc]FASTAAdd to Basket

Also known as: B, S

The sequence of this isoform can be found in the external entry Q9W4T4.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,209
Mass (Da):129,413
GO
Isoform F (identifier: Q8IRU4-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q8IRU4.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: No experimental confirmation available.

Length:662
Mass (Da):72,954
GO
Isoform G (identifier: Q9W4S9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q9W4S9.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: No experimental confirmation available.

Length:814
Mass (Da):89,085
GO
Isoform N (identifier: Q9W4S9-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q9W4S9.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: No experimental confirmation available.

Length:983
Mass (Da):107,341
GO

Sequence cautioni

The sequence AAC34201.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAA38960.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAD24781.1 differs from that shown. Reason: Erroneous gene model prediction.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti958 – 9581D → S in CAA38960. (PubMed:1660926)Curated
Sequence conflicti958 – 9581D → S in AAC34201. (PubMed:3025834)Curated
Sequence conflicti1027 – 10271S → T in CAA38960. (PubMed:1660926)Curated
Sequence conflicti1027 – 10271S → T in AAC34201. (PubMed:3025834)Curated
Sequence conflicti1042 – 10432SG → R in CAA38960. (PubMed:1660926)Curated
Sequence conflicti1042 – 10432SG → R in AAC34201. (PubMed:3025834)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 549549Missing in isoform VII. 1 PublicationVSP_004587Add
BLAST
Alternative sequencei1 – 428428Missing in isoform III. 1 PublicationVSP_018826Add
BLAST
Alternative sequencei1 – 369369Missing in isoform IV. 1 PublicationVSP_004585Add
BLAST
Alternative sequencei1 – 367367Missing in isoform R. 1 PublicationVSP_054955Add
BLAST
Alternative sequencei1 – 355355Missing in isoform U. CuratedVSP_054956Add
BLAST
Alternative sequencei356 – 38530GLHDM…SDLFG → MQAEQGSIGDLQKYHSRYLK NRRHTLANVR in isoform U. CuratedVSP_054957Add
BLAST
Alternative sequencei368 – 38518SPLSP…SDLFG → MVCSFCCCCYNFRNSPSS in isoform R. 1 PublicationVSP_054958Add
BLAST
Alternative sequencei370 – 38516LSPRI…SDLFG → MVCSFCCCCYNFRNSP in isoform IV. 1 PublicationVSP_004586Add
BLAST
Alternative sequencei444 – 45613Missing in isoform V. 1 PublicationVSP_004588Add
BLAST
Alternative sequencei493 – 4942Missing in isoform VI. 1 PublicationVSP_004589

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X55167
, X55168, X55169, X55170, X55171, X55172, X55173, X55174, X55175 Genomic DNA. Translation: CAA38960.1. Sequence problems.
M14982
, M14978, M14979, M14980, M14981 Unassigned DNA. Translation: AAC34201.1. Different initiation.
AE014298 Genomic DNA. Translation: AAF45861.2.
AE014298 Genomic DNA. Translation: AAF45862.3.
AE014298 Genomic DNA. Translation: AAF45865.2.
AE014298 Genomic DNA. Translation: AAN09600.1.
AE014298 Genomic DNA. Translation: AAN09601.3.
AE014298 Genomic DNA. Translation: AAN09602.2.
AE014298 Genomic DNA. Translation: AAN09604.1.
AE014298 Genomic DNA. Translation: AAN09607.2.
AE014298 Genomic DNA. Translation: AGB95048.1.
AE014298 Genomic DNA. Translation: AGB95049.1.
AL121800 Genomic DNA. Translation: CAD24781.1. Sequence problems.
AY119511 mRNA. Translation: AAM50165.1.
PIRiS65543.
RefSeqiNP_001259201.1. NM_001272272.1. [P12252-7]
NP_001259202.1. NM_001272273.1. [P12252-8]
NP_001259203.1. NM_001272274.1. [P12252-9]
NP_726849.1. NM_166961.2. [P12252-1]
NP_726850.1. NM_166962.2. [P12252-4]
NP_726851.3. NM_166963.2. [P12252-9]
NP_726852.2. NM_166964.2. [P12252-5]
NP_726853.2. NM_166965.2. [P12252-1]
NP_726854.2. NM_166966.3. [P12252-8]
NP_726855.1. NM_166967.2. [P12252-3]
NP_726857.1. NM_166969.2. [P12252-7]
NP_726859.2. NM_166971.2. [P12252-6]
UniGeneiDm.4817.

Genome annotation databases

EnsemblMetazoaiFBtr0070511; FBpp0070487; FBgn0000479. [P12252-1]
FBtr0070513; FBpp0070489; FBgn0000479. [P12252-1]
FBtr0333313; FBpp0305505; FBgn0000479. [P12252-8]
FBtr0333314; FBpp0305506; FBgn0000479. [P12252-8]
FBtr0333316; FBpp0305508; FBgn0000479. [P12252-9]
FBtr0333317; FBpp0305509; FBgn0000479. [P12252-9]
GeneIDi31309.
KEGGidme:Dmel_CG32498.
UCSCiCG32498-RA. d. melanogaster. [P12252-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X55167
, X55168 , X55169 , X55170 , X55171 , X55172 , X55173 , X55174 , X55175 Genomic DNA. Translation: CAA38960.1 . Sequence problems.
M14982
, M14978 , M14979 , M14980 , M14981 Unassigned DNA. Translation: AAC34201.1 . Different initiation.
AE014298 Genomic DNA. Translation: AAF45861.2 .
AE014298 Genomic DNA. Translation: AAF45862.3 .
AE014298 Genomic DNA. Translation: AAF45865.2 .
AE014298 Genomic DNA. Translation: AAN09600.1 .
AE014298 Genomic DNA. Translation: AAN09601.3 .
AE014298 Genomic DNA. Translation: AAN09602.2 .
AE014298 Genomic DNA. Translation: AAN09604.1 .
AE014298 Genomic DNA. Translation: AAN09607.2 .
AE014298 Genomic DNA. Translation: AGB95048.1 .
AE014298 Genomic DNA. Translation: AGB95049.1 .
AL121800 Genomic DNA. Translation: CAD24781.1 . Sequence problems.
AY119511 mRNA. Translation: AAM50165.1 .
PIRi S65543.
RefSeqi NP_001259201.1. NM_001272272.1. [P12252-7 ]
NP_001259202.1. NM_001272273.1. [P12252-8 ]
NP_001259203.1. NM_001272274.1. [P12252-9 ]
NP_726849.1. NM_166961.2. [P12252-1 ]
NP_726850.1. NM_166962.2. [P12252-4 ]
NP_726851.3. NM_166963.2. [P12252-9 ]
NP_726852.2. NM_166964.2. [P12252-5 ]
NP_726853.2. NM_166965.2. [P12252-1 ]
NP_726854.2. NM_166966.3. [P12252-8 ]
NP_726855.1. NM_166967.2. [P12252-3 ]
NP_726857.1. NM_166969.2. [P12252-7 ]
NP_726859.2. NM_166971.2. [P12252-6 ]
UniGenei Dm.4817.

3D structure databases

ProteinModelPortali P12252.
SMRi P12252. Positions 552-586, 661-983.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 57834. 7 interactions.
IntActi P12252. 1 interaction.

Proteomic databases

PRIDEi P12252.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai FBtr0070511 ; FBpp0070487 ; FBgn0000479 . [P12252-1 ]
FBtr0070513 ; FBpp0070489 ; FBgn0000479 . [P12252-1 ]
FBtr0333313 ; FBpp0305505 ; FBgn0000479 . [P12252-8 ]
FBtr0333314 ; FBpp0305506 ; FBgn0000479 . [P12252-8 ]
FBtr0333316 ; FBpp0305508 ; FBgn0000479 . [P12252-9 ]
FBtr0333317 ; FBpp0305509 ; FBgn0000479 . [P12252-9 ]
GeneIDi 31309.
KEGGi dme:Dmel_CG32498.
UCSCi CG32498-RA. d. melanogaster. [P12252-1 ]

Organism-specific databases

CTDi 31309.
FlyBasei FBgn0000479. dnc.

Phylogenomic databases

GeneTreei ENSGT00760000118889.
KOi K13293.
OMAi TWGIEIF.

Enzyme and pathway databases

UniPathwayi UPA00762 ; UER00747 .
Reactomei REACT_209420. G alpha (s) signalling events.
REACT_213958. DARPP-32 events.

Miscellaneous databases

ChiTaRSi dnc. drosophila.
GenomeRNAii 31309.
NextBioi 772953.

Gene expression databases

Bgeei P12252.

Family and domain databases

Gene3Di 1.10.1300.10. 1 hit.
InterProi IPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view ]
Pfami PF00233. PDEase_I. 1 hit.
[Graphical view ]
PRINTSi PR00387. PDIESTERASE1.
SMARTi SM00471. HDc. 1 hit.
[Graphical view ]
PROSITEi PS00126. PDEASE_I. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of the memory gene dunce of Drosophila melanogaster."
    Qiu Y.H., Chen C.-N., Malone T., Richter L., Beckendorf S.K., Davis R.L.
    J. Mol. Biol. 222:553-565(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS III; IV AND R), NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 293-1070 (ISOFORMS II; V AND VI), NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 356-1070 (ISOFORM I), SEQUENCE REVISION, FUNCTION, CATALYTIC ACTIVITY, SUBUNIT.
    Strain: Canton-S.
  2. "Molecular analysis of cDNA clones and the corresponding genomic coding sequences of the Drosophila dunce+ gene, the structural gene for cAMP phosphodiesterase."
    Chen C.-N., Denome S., Davis R.L.
    Proc. Natl. Acad. Sci. U.S.A. 83:9313-9317(1986) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 699-1070.
  3. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS I; G AND VII).
    Strain: Oregon-R.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM VII).
    Strain: Berkeley.
    Tissue: Head.

Entry informationi

Entry nameiPDE4B_DROME
AccessioniPrimary (citable) accession number: P12252
Secondary accession number(s): M9PGD1
, M9PGX1, O76918, Q8IRU3, Q8IRU6, Q8IRU8, Q8IRV0, Q8MRN3, Q8T8M0, Q9NF62, Q9W4S8, Q9W4T0, Q9W4T1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: August 16, 2005
Last modified: October 29, 2014
This is version 136 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3