P11607 (AT2A2_PIG) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 Short name=SERCA2 Short name=SR Ca(2+)-ATPase 2 EC=3.6.3.8 Alternative name(s): Calcium pump 2 Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform Endoplasmic reticulum class 1/2 Ca(2+) ATPase | ||
| Gene names |
| ||
| Organism | Sus scrofa (Pig) [Complete proteome] | ||
| Taxonomic identifier | 9823 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Laurasiatheria › Cetartiodactyla › Suina › Suidae › Sus |
Protein attributes
| Sequence length | 1042 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Isoform SERCA2A is involved in the regulation of the contraction/relaxation cycle By similarity. |
| Catalytic activity | ATP + H2O + Ca2+[side 1] = ADP + phosphate + Ca2+[side 2]. |
| Enzyme regulation | Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN By similarity. |
| Subunit structure | Associated with phospholamban (PLN) By similarity. Isoform SERCA2B interacts with TRAM2 (via C-terminus). Interacts with HAX1 By similarity. |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein. |
| Tissue specificity | Isoform SERCA2A is highly expressed in heart and slow twitch skeletal muscle. Isoform SERCA2B is widely expressed. Ref.3 |
| Post-translational modification | Nitrated under oxidative stress. Nitration on the two tyrosine residues inhibits catalytic activity By similarity. |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Calcium transport Ion transport Transport |
| Cellular component | Endoplasmic reticulum Membrane Sarcoplasmic reticulum |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | ATP-binding Calcium Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Hydrolase |
| PTM | Acetylation Isopeptide bond Nitration Phosphoprotein Ubl conjugation |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | ATP biosynthetic process Inferred from electronic annotation. Source: InterPro |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW sarcoplasmic reticulum membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW calcium-transporting ATPase activityInferred from electronic annotation. Source: EC metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform SERCA2B (identifier: P11607-1) Also known as: ATP2A2B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SERCA2A (identifier: P11607-2) Also known as: ATP2A2A; The sequence of this isoform differs from the canonical sequence as follows: 994-1042: GKECVQPATKSCSFSACTDGISWPFVLLIMPLVIWVYSTDTNFSDMFWS → AILE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1042 | 1042 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 | PRO_0000046198 | |||||
Regions | |||||||||
| Topological domain | 1 – 48 | 48 | Cytoplasmic By similarity | ||||||
| Transmembrane | 49 – 69 | 21 | Helical; Name=1; By similarity | ||||||
| Topological domain | 70 – 89 | 20 | Lumenal By similarity | ||||||
| Transmembrane | 90 – 110 | 21 | Helical; Name=2; By similarity | ||||||
| Topological domain | 111 – 253 | 143 | Cytoplasmic By similarity | ||||||
| Transmembrane | 254 – 273 | 20 | Helical; Name=3; By similarity | ||||||
| Topological domain | 274 – 295 | 22 | Lumenal By similarity | ||||||
| Transmembrane | 296 – 313 | 18 | Helical; Name=4; By similarity | ||||||
| Topological domain | 314 – 756 | 443 | Cytoplasmic By similarity | ||||||
| Transmembrane | 757 – 776 | 20 | Helical; Name=5; By similarity | ||||||
| Topological domain | 777 – 786 | 10 | Lumenal By similarity | ||||||
| Transmembrane | 787 – 807 | 21 | Helical; Name=6; By similarity | ||||||
| Topological domain | 808 – 827 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 828 – 850 | 23 | Helical; Name=7; By similarity | ||||||
| Topological domain | 851 – 896 | 46 | Lumenal By similarity | ||||||
| Transmembrane | 897 – 916 | 20 | Helical; Name=8; By similarity | ||||||
| Topological domain | 917 – 929 | 13 | Cytoplasmic By similarity | ||||||
| Transmembrane | 930 – 948 | 19 | Helical; Name=9; By similarity | ||||||
| Topological domain | 949 – 963 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 964 – 984 | 21 | Helical; Name=10; By similarity | ||||||
| Topological domain | 985 – 1042 | 58 | Cytoplasmic By similarity | ||||||
| Region | 370 – 400 | 31 | Interacts with phospholamban 1 By similarity | ||||||
| Region | 575 – 594 | 20 | Interacts with HAX1 By similarity | ||||||
| Region | 787 – 807 | 21 | Interacts with phospholamban 2 By similarity | ||||||
Sites | |||||||||
| Active site | 351 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 304 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 305 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 307 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 309 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 702 | 1 | Magnesium By similarity | ||||||
| Metal binding | 706 | 1 | Magnesium By similarity | ||||||
| Metal binding | 767 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 770 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 795 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 798 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 907 | 1 | Calcium 1 By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 294 | 1 | Nitrated tyrosine By similarity | ||||||
| Modified residue | 295 | 1 | Nitrated tyrosine By similarity | ||||||
| Modified residue | 464 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 537 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 663 | 1 | Phosphoserine By similarity | ||||||
| Cross-link | 143 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 994 – 1042 | 49 | GKECV…DMFWS → AILE in isoform SERCA2A. | VSP_000360 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Evidence for two isoforms of the endoplasmic-reticulum Ca2+ pump in pig smooth muscle." Eggermont J.A., Wuytack F., de Jaegere S., Nelles L., Casteels R. Biochem. J. 260:757-761(1989) [PubMed: 2527496] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA2A AND SERCA2B). Tissue: Stomach smooth muscle. |
| [2] | "Characterization of the 3' end of the pig sarcoplasmic/endoplasmic-reticulum Ca2+ pump gene 2." Eggermont J.A., Wuytack F., Casteels R. Biochim. Biophys. Acta 1088:448-451(1991) [PubMed: 2015309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 842-997 (ISOFORM SERCA2A). |
| [3] | "Characterization of the mRNAs encoding the gene 2 sarcoplasmic/endoplasmic-reticulum Ca2+ pump in pig smooth muscle." Eggermont J.A., Wuytack F., Casteels R. Biochem. J. 266:901-907(1990) [PubMed: 2158303] [Abstract] Cited for: TISSUE SPECIFICITY, ALTERNATIVE SPLICING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X15074 mRNA. Translation: CAA33170.1. X15073 mRNA. Translation: CAA33169.1. X53754 Genomic DNA. Translation: CAA37783.1. |
| PIR | S04651. S04652. |
| RefSeq | NP_999030.1. NM_213865.1. |
| UniGene | Ssc.22641. |
3D structure databases | |
| ProteinModelPortal | P11607. |
| SMR | P11607. Positions 1-992. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P11607. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 396875. |
| KEGG | ssc:396875. |
Organism-specific databases | |
| CTD | 488. |
Phylogenomic databases | |
| HOVERGEN | HBG105648. |
Family and domain databases | |
| InterPro | IPR023306. ATPase_cation_domN. IPR008250. ATPase_P-typ_ATPase-assoc-dom. IPR005782. ATPase_P-typ_Ca-transp. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR023300. ATPase_P-typ_cyto_domA. IPR023299. ATPase_P-typ_cyto_domN. IPR000695. ATPase_P-typ_H-transp. IPR001757. ATPase_P-typ_ion-transptr. IPR018303. ATPase_P-typ_P_site. IPR023298. ATPase_P-typ_TM_dom. IPR005834. Dehalogen-like_hydro. IPR023214. HAD-like_dom. [Graphical view] |
| Gene3D | G3DSA:2.70.150.10. ATPase_P-typ_cyto_domA. 2 hits. G3DSA:3.40.1110.10. ATPase_P-typ_cyto_domN. 1 hit. G3DSA:1.20.1110.10. ATPase_P-typ_TM_dom. 2 hits. |
| KO | K05853. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. PR00120. HATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| SUPFAM | SSF81660. ATPase_cation_domN. 1 hit. SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR01116. ATPase-IIA1_Ca. 1 hit. TIGR01494. ATPase_P-type. 2 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | AT2A2_PIG | ||||||||
| Accession | Primary (citable) accession number: P11607 Secondary accession number(s): P11606 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with