Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P11507

- AT2A2_RAT

UniProt

P11507 - AT2A2_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 2

Gene

Atp2a2

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Isoform SERCA2A is involved in the regulation of the contraction/relaxation cycle (By similarity).By similarity

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Enzyme regulationi

Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi304 – 3041Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi305 – 3051Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi307 – 3071Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi309 – 3091Calcium 2By similarity
Active sitei351 – 35114-aspartylphosphate intermediateBy similarity
Metal bindingi702 – 7021MagnesiumBy similarity
Metal bindingi706 – 7061MagnesiumBy similarity
Metal bindingi767 – 7671Calcium 1By similarity
Metal bindingi770 – 7701Calcium 1By similarity
Metal bindingi795 – 7951Calcium 2By similarity
Metal bindingi798 – 7981Calcium 1By similarity
Metal bindingi799 – 7991Calcium 1By similarity
Metal bindingi799 – 7991Calcium 2By similarity
Metal bindingi907 – 9071Calcium 1By similarity

GO - Molecular functioni

  1. ATP binding Source: RGD
  2. calcium ion binding Source: RGD
  3. calcium-transporting ATPase activity Source: RGD
  4. lutropin-choriogonadotropic hormone receptor binding Source: RGD

GO - Biological processi

  1. ATP catabolic process Source: RGD
  2. calcium ion transmembrane transport Source: GOC
  3. calcium ion transport Source: RGD
  4. regulation of muscle contraction Source: RGD
  5. response to peptide hormone Source: UniProtKB
  6. sarcoplasmic reticulum calcium ion transport Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (EC:3.6.3.8)
Short name:
SERCA2
Short name:
SR Ca(2+)-ATPase 2
Alternative name(s):
Calcium pump 2
Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform
Endoplasmic reticulum class 1/2 Ca(2+) ATPase
Gene namesi
Name:Atp2a2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi2174. Atp2a2.

Subcellular locationi

GO - Cellular componenti

  1. extrinsic component of cytoplasmic side of plasma membrane Source: RGD
  2. integral component of membrane Source: UniProtKB-KW
  3. perinuclear region of cytoplasm Source: RGD
  4. protein complex Source: RGD
  5. sarcoplasmic reticulum Source: RGD
  6. sarcoplasmic reticulum membrane Source: RGD
  7. vesicle membrane Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Sarcoplasmic reticulum

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10431043Sarcoplasmic/endoplasmic reticulum calcium ATPase 2PRO_0000046200Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki143 – 143Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei294 – 2941Nitrated tyrosine2 Publications
Modified residuei295 – 2951Nitrated tyrosine2 Publications
Modified residuei663 – 6631PhosphoserineBy similarity

Post-translational modificationi

Nitrated under oxidative stress. Nitration on the two tyrosine residues inhibits catalytic activity (By similarity).By similarity

Keywords - PTMi

Isopeptide bond, Nitration, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiP11507.
PRIDEiP11507.

PTM databases

PhosphoSiteiP11507.

Expressioni

Tissue specificityi

Isoform 2 is highly expressed in heart and slow twitch skeletal muscle. Isoform 1 is widely expressed.

Gene expression databases

GenevestigatoriP11507.

Interactioni

Subunit structurei

Associated with phospholamban (PLN) (By similarity). Isoform SERCA2B interacts with TRAM2 (via C-terminus). Interacts with HAX1 (By similarity). Interacts with S100A8 and S100A9 (By similarity). Interacts with SLC35G1 and STIM1 (By similarity).By similarity

Protein-protein interaction databases

BioGridi248313. 1 interaction.
IntActiP11507. 2 interactions.
MINTiMINT-4563897.

Structurei

3D structure databases

ProteinModelPortaliP11507.
SMRiP11507. Positions 1-992.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4848CytoplasmicBy similarityAdd
BLAST
Topological domaini70 – 8920LumenalBy similarityAdd
BLAST
Topological domaini111 – 253143CytoplasmicBy similarityAdd
BLAST
Topological domaini274 – 29522LumenalBy similarityAdd
BLAST
Topological domaini314 – 756443CytoplasmicBy similarityAdd
BLAST
Topological domaini777 – 78610LumenalBy similarity
Topological domaini808 – 82720CytoplasmicBy similarityAdd
BLAST
Topological domaini851 – 89646LumenalBy similarityAdd
BLAST
Topological domaini917 – 92913CytoplasmicBy similarityAdd
BLAST
Topological domaini949 – 96315LumenalBy similarityAdd
BLAST
Topological domaini985 – 104359CytoplasmicBy similarityAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei49 – 6921Helical; Name=1By similarityAdd
BLAST
Transmembranei90 – 11021Helical; Name=2By similarityAdd
BLAST
Transmembranei254 – 27320Helical; Name=3By similarityAdd
BLAST
Transmembranei296 – 31318Helical; Name=4By similarityAdd
BLAST
Transmembranei757 – 77620Helical; Name=5By similarityAdd
BLAST
Transmembranei787 – 80721Helical; Name=6By similarityAdd
BLAST
Transmembranei828 – 85023Helical; Name=7By similarityAdd
BLAST
Transmembranei897 – 91620Helical; Name=8By similarityAdd
BLAST
Transmembranei930 – 94819Helical; Name=9By similarityAdd
BLAST
Transmembranei964 – 98421Helical; Name=10By similarityAdd
BLAST

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni370 – 40031Interacts with phospholamban 1By similarityAdd
BLAST
Regioni575 – 59420Interacts with HAX1By similarityAdd
BLAST
Regioni787 – 80721Interacts with phospholamban 2By similarityAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0474.
HOGENOMiHOG000265621.
HOVERGENiHBG105648.
InParanoidiP11507.
KOiK05853.
PhylomeDBiP11507.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR005782. ATPase_P-typ_Ca-transp_IIA.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view]
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
PR00120. HATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P11507-1) [UniParc]FASTAAdd to Basket

Also known as: Atp2a2b, SERCA2b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MENAHTKTVE EVLGHFGVNE STGLSLEQVK KLKERWGSNE LPAEEGKTLL
60 70 80 90 100
ELVIEQFEDL LVRILLLAAC ISFVLAWFEE GEETITAFVE PFVILLILVA
110 120 130 140 150
NAIVGVWQER NAENAIEALK EYEPEMGKVY RQDRKSVQRI KAKDIVPGDI
160 170 180 190 200
VEIAVGDKVP ADIRLTSIKS TTLRVDQSIL TGESVSVIKH TDPVPDPRAV
210 220 230 240 250
NQDKKNMLFS GTNIAAGKAM GVVVATGVNT EIGKIRDEMV ATEQERTPLQ
260 270 280 290 300
QKLDEFGEQL SKVISLICIA VWIINIGHFN DPVHGGSWIR GAIYYFKIAV
310 320 330 340 350
ALAVAAIPEG LPAVITTCLA LGTRRMAKKN AIVRSLPSVE TLGCTSVICS
360 370 380 390 400
DKTGTLTTNQ MSVCRMFILD KVEGDTCSLN EFTITGSTYA PIGEVQKDDK
410 420 430 440 450
PVKCHQYDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE
460 470 480 490 500
KMNVFDTELK GLSKIERANA CNSVIKQLMK KEFTLEFSRD RKSMSVYCTP
510 520 530 540 550
NKPSRTSMSK MFVKGAPEGV IDRCTHIRVG STKVPMTPGV KQKIMSVIRE
560 570 580 590 600
WGSGSDTLRC LALATHDNPL RREEMHLEDS ANFIKYETNL TFVGCVGMLD
610 620 630 640 650
PPRIEVASSV KLCRQAGIRV IMITGDNKGT AVAICRRIGI FGQDEDVTSK
660 670 680 690 700
AFTGREFDEL SPSAQRDACL NARCFARVEP SHKSKIVEFL QSFDEITAMT
710 720 730 740 750
GDGVNDAPAL KKSEIGIAMG SGTAVAKTAS EMVLADDNFS TIVAAVEEGR
760 770 780 790 800
AIYNNMKQFI RYLISSNVGE VVCIFLTAAL GFPEALIPVQ LLWVNLVTDG
810 820 830 840 850
LPATALGFNP PDLDIMNKPP RNPKEPLISG WLFFRYLAIG CYVGAATVGA
860 870 880 890 900
AAWWFIAADG GPRVSFYQLS HFLQCKEDNP DFEGVDCAIF ESPYPMTMAL
910 920 930 940 950
SVLVTIEMCN ALNSLSENQS LLRMPPWENI WLVGSICLSM SLHFLILYVE
960 970 980 990 1000
PLPLIFQITP LNLTQWLMVL KISLPVILMD ETLKFVARNY LEPGKECAQP
1010 1020 1030 1040
ATKPSCSLSA CTDGISWPFV LLIMPLVVWV YSTDTNFSDM FWS
Length:1,043
Mass (Da):114,768
Last modified:October 1, 1989 - v1
Checksum:i4B0B476BFD97F390
GO
Isoform 2 (identifier: P11507-2) [UniParc]FASTAAdd to Basket

Also known as: Atp2a2a, SERCA2a

The sequence of this isoform differs from the canonical sequence as follows:
     994-1043: GKECAQPATKPSCSLSACTDGISWPFVLLIMPLVVWVYSTDTNFSDMFWS → AILE

Show »
Length:997
Mass (Da):109,681
Checksum:i3A14A6B604E97002
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei994 – 104350GKECA…DMFWS → AILE in isoform 2. 2 PublicationsVSP_000362Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
J04022 mRNA. Translation: AAA40785.1.
J04024 mRNA. Translation: AAA40787.1.
J04023 mRNA. Translation: AAA40786.1.
X15635 mRNA. Translation: CAA33645.1.
PIRiA31982.
B31982.
RefSeqiNP_001103609.1. NM_001110139.2. [P11507-2]
NP_001104293.1. NM_001110823.2. [P11507-1]
UniGeneiRn.2305.

Genome annotation databases

GeneIDi29693.
KEGGirno:29693.
UCSCiRGD:2174. rat. [P11507-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
J04022 mRNA. Translation: AAA40785.1 .
J04024 mRNA. Translation: AAA40787.1 .
J04023 mRNA. Translation: AAA40786.1 .
X15635 mRNA. Translation: CAA33645.1 .
PIRi A31982.
B31982.
RefSeqi NP_001103609.1. NM_001110139.2. [P11507-2 ]
NP_001104293.1. NM_001110823.2. [P11507-1 ]
UniGenei Rn.2305.

3D structure databases

ProteinModelPortali P11507.
SMRi P11507. Positions 1-992.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 248313. 1 interaction.
IntActi P11507. 2 interactions.
MINTi MINT-4563897.

PTM databases

PhosphoSitei P11507.

Proteomic databases

PaxDbi P11507.
PRIDEi P11507.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 29693.
KEGGi rno:29693.
UCSCi RGD:2174. rat. [P11507-1 ]

Organism-specific databases

CTDi 488.
RGDi 2174. Atp2a2.

Phylogenomic databases

eggNOGi COG0474.
HOGENOMi HOG000265621.
HOVERGENi HBG105648.
InParanoidi P11507.
KOi K05853.
PhylomeDBi P11507.

Miscellaneous databases

NextBioi 610084.
PROi P11507.

Gene expression databases

Genevestigatori P11507.

Family and domain databases

Gene3Di 1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProi IPR005782. ATPase_P-typ_Ca-transp_IIA.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view ]
Pfami PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view ]
PRINTSi PR00119. CATATPASE.
PR00120. HATPASE.
SMARTi SM00831. Cation_ATPase_N. 1 hit.
[Graphical view ]
SUPFAMi SSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsi TIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "A novel Ca2+ pump expressed in brain, kidney, and stomach is encoded by an alternative transcript of the slow-twitch muscle sarcoplasmic reticulum Ca-ATPase gene. Identification of cDNAs encoding Ca2+ and other cation-transporting ATPases using an oligonucleotide probe derived from the ATP-binding site."
    Gunteski-Hamblin A.-M., Greeb J., Shull G.E.
    J. Biol. Chem. 263:15032-15040(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  2. "Characterization and expression of the rat heart sarcoplasmic reticulum Ca2+-ATPase mRNA."
    Lompre A.M., de la Bastie D., Boheler K.R., Schwartz K.
    FEBS Lett. 249:35-41(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Heart.
  3. "Protein modification during biological aging: selective tyrosine nitration of the SERCA2a isoform of the sarcoplasmic reticulum Ca2+-ATPase in skeletal muscle."
    Viner R.I., Ferrington D.A., Williams T.D., Bigelow D.J., Schoeneich C.
    Biochem. J. 340:657-669(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NITRATION AT TYR-294 AND TYR-295.
  4. "Detection of sequence-specific tyrosine nitration of manganese SOD and SERCA in cardiovascular disease and aging."
    Xu S., Ying J., Jiang B., Guo W., Adachi T., Sharov V., Lazar H., Menzoian J., Knyushko T.V., Bigelow D., Schoeneich C., Cohen R.A.
    Am. J. Physiol. 290:H2220-H2227(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NITRATION AT TYR-294 AND TYR-295.

Entry informationi

Entry nameiAT2A2_RAT
AccessioniPrimary (citable) accession number: P11507
Secondary accession number(s): P11508
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: October 1, 1989
Last modified: October 29, 2014
This is version 142 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3