Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P11507

- AT2A2_RAT

UniProt

P11507 - AT2A2_RAT

Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 2

Gene

Atp2a2

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 141 (01 Oct 2014)
      Sequence version 1 (01 Oct 1989)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Isoform SERCA2A is involved in the regulation of the contraction/relaxation cycle By similarity.By similarity

    Catalytic activityi

    ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

    Enzyme regulationi

    Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi304 – 3041Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi305 – 3051Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi307 – 3071Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi309 – 3091Calcium 2By similarity
    Active sitei351 – 35114-aspartylphosphate intermediateBy similarity
    Metal bindingi702 – 7021MagnesiumBy similarity
    Metal bindingi706 – 7061MagnesiumBy similarity
    Metal bindingi767 – 7671Calcium 1By similarity
    Metal bindingi770 – 7701Calcium 1By similarity
    Metal bindingi795 – 7951Calcium 2By similarity
    Metal bindingi798 – 7981Calcium 1By similarity
    Metal bindingi799 – 7991Calcium 1By similarity
    Metal bindingi799 – 7991Calcium 2By similarity
    Metal bindingi907 – 9071Calcium 1By similarity

    GO - Molecular functioni

    1. ATP binding Source: RGD
    2. calcium ion binding Source: RGD
    3. calcium-transporting ATPase activity Source: RGD
    4. lutropin-choriogonadotropic hormone receptor binding Source: RGD
    5. protein binding Source: UniProtKB

    GO - Biological processi

    1. ATP catabolic process Source: RGD
    2. calcium ion transmembrane transport Source: GOC
    3. calcium ion transport Source: RGD
    4. regulation of muscle contraction Source: RGD
    5. response to peptide hormone Source: UniProtKB
    6. sarcoplasmic reticulum calcium ion transport Source: RGD

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Biological processi

    Calcium transport, Ion transport, Transport

    Keywords - Ligandi

    ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (EC:3.6.3.8)
    Short name:
    SERCA2
    Short name:
    SR Ca(2+)-ATPase 2
    Alternative name(s):
    Calcium pump 2
    Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform
    Endoplasmic reticulum class 1/2 Ca(2+) ATPase
    Gene namesi
    Name:Atp2a2
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi2174. Atp2a2.

    Subcellular locationi

    GO - Cellular componenti

    1. extrinsic component of cytoplasmic side of plasma membrane Source: RGD
    2. integral component of membrane Source: UniProtKB-KW
    3. perinuclear region of cytoplasm Source: RGD
    4. protein complex Source: RGD
    5. sarcoplasmic reticulum Source: RGD
    6. sarcoplasmic reticulum membrane Source: RGD
    7. vesicle membrane Source: RGD

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Sarcoplasmic reticulum

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10431043Sarcoplasmic/endoplasmic reticulum calcium ATPase 2PRO_0000046200Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Cross-linki143 – 143Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
    Modified residuei294 – 2941Nitrated tyrosine2 Publications
    Modified residuei295 – 2951Nitrated tyrosine2 Publications
    Modified residuei663 – 6631PhosphoserineBy similarity

    Post-translational modificationi

    Nitrated under oxidative stress. Nitration on the two tyrosine residues inhibits catalytic activity By similarity.By similarity

    Keywords - PTMi

    Isopeptide bond, Nitration, Phosphoprotein, Ubl conjugation

    Proteomic databases

    PaxDbiP11507.
    PRIDEiP11507.

    PTM databases

    PhosphoSiteiP11507.

    Expressioni

    Tissue specificityi

    Isoform 2 is highly expressed in heart and slow twitch skeletal muscle. Isoform 1 is widely expressed.

    Gene expression databases

    GenevestigatoriP11507.

    Interactioni

    Subunit structurei

    Associated with phospholamban (PLN) By similarity. Isoform SERCA2B interacts with TRAM2 (via C-terminus). Interacts with HAX1 By similarity. Interacts with S100A8 and S100A9 By similarity. Interacts with SLC35G1 and STIM1 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi248313. 1 interaction.
    IntActiP11507. 2 interactions.
    MINTiMINT-4563897.

    Structurei

    3D structure databases

    ProteinModelPortaliP11507.
    SMRiP11507. Positions 1-992.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 4848CytoplasmicBy similarityAdd
    BLAST
    Topological domaini70 – 8920LumenalBy similarityAdd
    BLAST
    Topological domaini111 – 253143CytoplasmicBy similarityAdd
    BLAST
    Topological domaini274 – 29522LumenalBy similarityAdd
    BLAST
    Topological domaini314 – 756443CytoplasmicBy similarityAdd
    BLAST
    Topological domaini777 – 78610LumenalBy similarity
    Topological domaini808 – 82720CytoplasmicBy similarityAdd
    BLAST
    Topological domaini851 – 89646LumenalBy similarityAdd
    BLAST
    Topological domaini917 – 92913CytoplasmicBy similarityAdd
    BLAST
    Topological domaini949 – 96315LumenalBy similarityAdd
    BLAST
    Topological domaini985 – 104359CytoplasmicBy similarityAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei49 – 6921Helical; Name=1By similarityAdd
    BLAST
    Transmembranei90 – 11021Helical; Name=2By similarityAdd
    BLAST
    Transmembranei254 – 27320Helical; Name=3By similarityAdd
    BLAST
    Transmembranei296 – 31318Helical; Name=4By similarityAdd
    BLAST
    Transmembranei757 – 77620Helical; Name=5By similarityAdd
    BLAST
    Transmembranei787 – 80721Helical; Name=6By similarityAdd
    BLAST
    Transmembranei828 – 85023Helical; Name=7By similarityAdd
    BLAST
    Transmembranei897 – 91620Helical; Name=8By similarityAdd
    BLAST
    Transmembranei930 – 94819Helical; Name=9By similarityAdd
    BLAST
    Transmembranei964 – 98421Helical; Name=10By similarityAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni370 – 40031Interacts with phospholamban 1By similarityAdd
    BLAST
    Regioni575 – 59420Interacts with HAX1By similarityAdd
    BLAST
    Regioni787 – 80721Interacts with phospholamban 2By similarityAdd
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0474.
    HOGENOMiHOG000265621.
    HOVERGENiHBG105648.
    InParanoidiP11507.
    KOiK05853.
    PhylomeDBiP11507.

    Family and domain databases

    Gene3Di1.20.1110.10. 2 hits.
    2.70.150.10. 2 hits.
    3.40.1110.10. 1 hit.
    InterProiIPR005782. ATPase_P-typ_Ca-transp_IIA.
    IPR006068. ATPase_P-typ_cation-transptr_C.
    IPR004014. ATPase_P-typ_cation-transptr_N.
    IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR023298. ATPase_P-typ_TM_dom.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view]
    PfamiPF00689. Cation_ATPase_C. 1 hit.
    PF00690. Cation_ATPase_N. 1 hit.
    PF00122. E1-E2_ATPase. 1 hit.
    PF00702. Hydrolase. 1 hit.
    [Graphical view]
    PRINTSiPR00119. CATATPASE.
    PR00120. HATPASE.
    SMARTiSM00831. Cation_ATPase_N. 1 hit.
    [Graphical view]
    SUPFAMiSSF56784. SSF56784. 1 hit.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
    TIGR01494. ATPase_P-type. 2 hits.
    PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P11507-1) [UniParc]FASTAAdd to Basket

    Also known as: Atp2a2b, SERCA2b

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MENAHTKTVE EVLGHFGVNE STGLSLEQVK KLKERWGSNE LPAEEGKTLL     50
    ELVIEQFEDL LVRILLLAAC ISFVLAWFEE GEETITAFVE PFVILLILVA 100
    NAIVGVWQER NAENAIEALK EYEPEMGKVY RQDRKSVQRI KAKDIVPGDI 150
    VEIAVGDKVP ADIRLTSIKS TTLRVDQSIL TGESVSVIKH TDPVPDPRAV 200
    NQDKKNMLFS GTNIAAGKAM GVVVATGVNT EIGKIRDEMV ATEQERTPLQ 250
    QKLDEFGEQL SKVISLICIA VWIINIGHFN DPVHGGSWIR GAIYYFKIAV 300
    ALAVAAIPEG LPAVITTCLA LGTRRMAKKN AIVRSLPSVE TLGCTSVICS 350
    DKTGTLTTNQ MSVCRMFILD KVEGDTCSLN EFTITGSTYA PIGEVQKDDK 400
    PVKCHQYDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE 450
    KMNVFDTELK GLSKIERANA CNSVIKQLMK KEFTLEFSRD RKSMSVYCTP 500
    NKPSRTSMSK MFVKGAPEGV IDRCTHIRVG STKVPMTPGV KQKIMSVIRE 550
    WGSGSDTLRC LALATHDNPL RREEMHLEDS ANFIKYETNL TFVGCVGMLD 600
    PPRIEVASSV KLCRQAGIRV IMITGDNKGT AVAICRRIGI FGQDEDVTSK 650
    AFTGREFDEL SPSAQRDACL NARCFARVEP SHKSKIVEFL QSFDEITAMT 700
    GDGVNDAPAL KKSEIGIAMG SGTAVAKTAS EMVLADDNFS TIVAAVEEGR 750
    AIYNNMKQFI RYLISSNVGE VVCIFLTAAL GFPEALIPVQ LLWVNLVTDG 800
    LPATALGFNP PDLDIMNKPP RNPKEPLISG WLFFRYLAIG CYVGAATVGA 850
    AAWWFIAADG GPRVSFYQLS HFLQCKEDNP DFEGVDCAIF ESPYPMTMAL 900
    SVLVTIEMCN ALNSLSENQS LLRMPPWENI WLVGSICLSM SLHFLILYVE 950
    PLPLIFQITP LNLTQWLMVL KISLPVILMD ETLKFVARNY LEPGKECAQP 1000
    ATKPSCSLSA CTDGISWPFV LLIMPLVVWV YSTDTNFSDM FWS 1043
    Length:1,043
    Mass (Da):114,768
    Last modified:October 1, 1989 - v1
    Checksum:i4B0B476BFD97F390
    GO
    Isoform 2 (identifier: P11507-2) [UniParc]FASTAAdd to Basket

    Also known as: Atp2a2a, SERCA2a

    The sequence of this isoform differs from the canonical sequence as follows:
         994-1043: GKECAQPATKPSCSLSACTDGISWPFVLLIMPLVVWVYSTDTNFSDMFWS → AILE

    Show »
    Length:997
    Mass (Da):109,681
    Checksum:i3A14A6B604E97002
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei994 – 104350GKECA…DMFWS → AILE in isoform 2. 2 PublicationsVSP_000362Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    J04022 mRNA. Translation: AAA40785.1.
    J04024 mRNA. Translation: AAA40787.1.
    J04023 mRNA. Translation: AAA40786.1.
    X15635 mRNA. Translation: CAA33645.1.
    PIRiA31982.
    B31982.
    RefSeqiNP_001103609.1. NM_001110139.2. [P11507-2]
    NP_001104293.1. NM_001110823.2. [P11507-1]
    UniGeneiRn.2305.

    Genome annotation databases

    GeneIDi29693.
    KEGGirno:29693.
    UCSCiRGD:2174. rat. [P11507-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    J04022 mRNA. Translation: AAA40785.1 .
    J04024 mRNA. Translation: AAA40787.1 .
    J04023 mRNA. Translation: AAA40786.1 .
    X15635 mRNA. Translation: CAA33645.1 .
    PIRi A31982.
    B31982.
    RefSeqi NP_001103609.1. NM_001110139.2. [P11507-2 ]
    NP_001104293.1. NM_001110823.2. [P11507-1 ]
    UniGenei Rn.2305.

    3D structure databases

    ProteinModelPortali P11507.
    SMRi P11507. Positions 1-992.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 248313. 1 interaction.
    IntActi P11507. 2 interactions.
    MINTi MINT-4563897.

    PTM databases

    PhosphoSitei P11507.

    Proteomic databases

    PaxDbi P11507.
    PRIDEi P11507.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 29693.
    KEGGi rno:29693.
    UCSCi RGD:2174. rat. [P11507-1 ]

    Organism-specific databases

    CTDi 488.
    RGDi 2174. Atp2a2.

    Phylogenomic databases

    eggNOGi COG0474.
    HOGENOMi HOG000265621.
    HOVERGENi HBG105648.
    InParanoidi P11507.
    KOi K05853.
    PhylomeDBi P11507.

    Miscellaneous databases

    NextBioi 610084.
    PROi P11507.

    Gene expression databases

    Genevestigatori P11507.

    Family and domain databases

    Gene3Di 1.20.1110.10. 2 hits.
    2.70.150.10. 2 hits.
    3.40.1110.10. 1 hit.
    InterProi IPR005782. ATPase_P-typ_Ca-transp_IIA.
    IPR006068. ATPase_P-typ_cation-transptr_C.
    IPR004014. ATPase_P-typ_cation-transptr_N.
    IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR023298. ATPase_P-typ_TM_dom.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view ]
    Pfami PF00689. Cation_ATPase_C. 1 hit.
    PF00690. Cation_ATPase_N. 1 hit.
    PF00122. E1-E2_ATPase. 1 hit.
    PF00702. Hydrolase. 1 hit.
    [Graphical view ]
    PRINTSi PR00119. CATATPASE.
    PR00120. HATPASE.
    SMARTi SM00831. Cation_ATPase_N. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56784. SSF56784. 1 hit.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsi TIGR01116. ATPase-IIA1_Ca. 1 hit.
    TIGR01494. ATPase_P-type. 2 hits.
    PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A novel Ca2+ pump expressed in brain, kidney, and stomach is encoded by an alternative transcript of the slow-twitch muscle sarcoplasmic reticulum Ca-ATPase gene. Identification of cDNAs encoding Ca2+ and other cation-transporting ATPases using an oligonucleotide probe derived from the ATP-binding site."
      Gunteski-Hamblin A.-M., Greeb J., Shull G.E.
      J. Biol. Chem. 263:15032-15040(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain.
    2. "Characterization and expression of the rat heart sarcoplasmic reticulum Ca2+-ATPase mRNA."
      Lompre A.M., de la Bastie D., Boheler K.R., Schwartz K.
      FEBS Lett. 249:35-41(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Heart.
    3. "Protein modification during biological aging: selective tyrosine nitration of the SERCA2a isoform of the sarcoplasmic reticulum Ca2+-ATPase in skeletal muscle."
      Viner R.I., Ferrington D.A., Williams T.D., Bigelow D.J., Schoeneich C.
      Biochem. J. 340:657-669(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NITRATION AT TYR-294 AND TYR-295.
    4. "Detection of sequence-specific tyrosine nitration of manganese SOD and SERCA in cardiovascular disease and aging."
      Xu S., Ying J., Jiang B., Guo W., Adachi T., Sharov V., Lazar H., Menzoian J., Knyushko T.V., Bigelow D., Schoeneich C., Cohen R.A.
      Am. J. Physiol. 290:H2220-H2227(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NITRATION AT TYR-294 AND TYR-295.

    Entry informationi

    Entry nameiAT2A2_RAT
    AccessioniPrimary (citable) accession number: P11507
    Secondary accession number(s): P11508
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1989
    Last sequence update: October 1, 1989
    Last modified: October 1, 2014
    This is version 141 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3