SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P11507

- AT2A2_RAT

UniProt

P11507 - AT2A2_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 2

Gene
Atp2a2
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Isoform SERCA2A is involved in the regulation of the contraction/relaxation cycle By similarity.

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Enzyme regulationi

Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi304 – 3041Calcium 2; via carbonyl oxygen By similarity
Metal bindingi305 – 3051Calcium 2; via carbonyl oxygen By similarity
Metal bindingi307 – 3071Calcium 2; via carbonyl oxygen By similarity
Metal bindingi309 – 3091Calcium 2 By similarity
Active sitei351 – 35114-aspartylphosphate intermediate By similarity
Metal bindingi702 – 7021Magnesium By similarity
Metal bindingi706 – 7061Magnesium By similarity
Metal bindingi767 – 7671Calcium 1 By similarity
Metal bindingi770 – 7701Calcium 1 By similarity
Metal bindingi795 – 7951Calcium 2 By similarity
Metal bindingi798 – 7981Calcium 1 By similarity
Metal bindingi799 – 7991Calcium 1 By similarity
Metal bindingi799 – 7991Calcium 2 By similarity
Metal bindingi907 – 9071Calcium 1 By similarity

GO - Molecular functioni

  1. ATP binding Source: RGD
  2. calcium ion binding Source: RGD
  3. calcium-transporting ATPase activity Source: RGD
  4. lutropin-choriogonadotropic hormone receptor binding Source: RGD
  5. protein binding Source: UniProtKB

GO - Biological processi

  1. ATP catabolic process Source: RGD
  2. calcium ion transmembrane transport Source: GOC
  3. calcium ion transport Source: RGD
  4. regulation of muscle contraction Source: RGD
  5. response to peptide hormone Source: UniProtKB
  6. sarcoplasmic reticulum calcium ion transport Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (EC:3.6.3.8)
Short name:
SERCA2
Short name:
SR Ca(2+)-ATPase 2
Alternative name(s):
Calcium pump 2
Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform
Endoplasmic reticulum class 1/2 Ca(2+) ATPase
Gene namesi
Name:Atp2a2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi2174. Atp2a2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4848Cytoplasmic By similarityAdd
BLAST
Transmembranei49 – 6921Helical; Name=1; By similarityAdd
BLAST
Topological domaini70 – 8920Lumenal By similarityAdd
BLAST
Transmembranei90 – 11021Helical; Name=2; By similarityAdd
BLAST
Topological domaini111 – 253143Cytoplasmic By similarityAdd
BLAST
Transmembranei254 – 27320Helical; Name=3; By similarityAdd
BLAST
Topological domaini274 – 29522Lumenal By similarityAdd
BLAST
Transmembranei296 – 31318Helical; Name=4; By similarityAdd
BLAST
Topological domaini314 – 756443Cytoplasmic By similarityAdd
BLAST
Transmembranei757 – 77620Helical; Name=5; By similarityAdd
BLAST
Topological domaini777 – 78610Lumenal By similarity
Transmembranei787 – 80721Helical; Name=6; By similarityAdd
BLAST
Topological domaini808 – 82720Cytoplasmic By similarityAdd
BLAST
Transmembranei828 – 85023Helical; Name=7; By similarityAdd
BLAST
Topological domaini851 – 89646Lumenal By similarityAdd
BLAST
Transmembranei897 – 91620Helical; Name=8; By similarityAdd
BLAST
Topological domaini917 – 92913Cytoplasmic By similarityAdd
BLAST
Transmembranei930 – 94819Helical; Name=9; By similarityAdd
BLAST
Topological domaini949 – 96315Lumenal By similarityAdd
BLAST
Transmembranei964 – 98421Helical; Name=10; By similarityAdd
BLAST
Topological domaini985 – 104359Cytoplasmic By similarityAdd
BLAST

GO - Cellular componenti

  1. extrinsic component of cytoplasmic side of plasma membrane Source: RGD
  2. integral component of membrane Source: UniProtKB-KW
  3. perinuclear region of cytoplasm Source: RGD
  4. protein complex Source: RGD
  5. sarcoplasmic reticulum Source: RGD
  6. sarcoplasmic reticulum membrane Source: RGD
  7. vesicle membrane Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Sarcoplasmic reticulum

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10431043Sarcoplasmic/endoplasmic reticulum calcium ATPase 2PRO_0000046200Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki143 – 143Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) By similarity
Modified residuei294 – 2941Nitrated tyrosine2 Publications
Modified residuei295 – 2951Nitrated tyrosine2 Publications
Modified residuei663 – 6631Phosphoserine By similarity

Post-translational modificationi

Nitrated under oxidative stress. Nitration on the two tyrosine residues inhibits catalytic activity By similarity.

Keywords - PTMi

Isopeptide bond, Nitration, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiP11507.
PRIDEiP11507.

PTM databases

PhosphoSiteiP11507.

Expressioni

Tissue specificityi

Isoform 2 is highly expressed in heart and slow twitch skeletal muscle. Isoform 1 is widely expressed.

Gene expression databases

GenevestigatoriP11507.

Interactioni

Subunit structurei

Associated with phospholamban (PLN) By similarity. Isoform SERCA2B interacts with TRAM2 (via C-terminus). Interacts with HAX1 By similarity. Interacts with S100A8 and S100A9 By similarity.

Protein-protein interaction databases

BioGridi248313. 1 interaction.
IntActiP11507. 2 interactions.
MINTiMINT-4563897.

Structurei

3D structure databases

ProteinModelPortaliP11507.
SMRiP11507. Positions 1-992.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni370 – 40031Interacts with phospholamban 1 By similarityAdd
BLAST
Regioni575 – 59420Interacts with HAX1 By similarityAdd
BLAST
Regioni787 – 80721Interacts with phospholamban 2 By similarityAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0474.
HOGENOMiHOG000265621.
HOVERGENiHBG105648.
InParanoidiP11507.
KOiK05853.
PhylomeDBiP11507.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR005782. ATPase_P-typ_Ca-transp_IIA.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view]
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
PR00120. HATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P11507-1) [UniParc]FASTAAdd to Basket

Also known as: Atp2a2b, SERCA2b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MENAHTKTVE EVLGHFGVNE STGLSLEQVK KLKERWGSNE LPAEEGKTLL     50
ELVIEQFEDL LVRILLLAAC ISFVLAWFEE GEETITAFVE PFVILLILVA 100
NAIVGVWQER NAENAIEALK EYEPEMGKVY RQDRKSVQRI KAKDIVPGDI 150
VEIAVGDKVP ADIRLTSIKS TTLRVDQSIL TGESVSVIKH TDPVPDPRAV 200
NQDKKNMLFS GTNIAAGKAM GVVVATGVNT EIGKIRDEMV ATEQERTPLQ 250
QKLDEFGEQL SKVISLICIA VWIINIGHFN DPVHGGSWIR GAIYYFKIAV 300
ALAVAAIPEG LPAVITTCLA LGTRRMAKKN AIVRSLPSVE TLGCTSVICS 350
DKTGTLTTNQ MSVCRMFILD KVEGDTCSLN EFTITGSTYA PIGEVQKDDK 400
PVKCHQYDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE 450
KMNVFDTELK GLSKIERANA CNSVIKQLMK KEFTLEFSRD RKSMSVYCTP 500
NKPSRTSMSK MFVKGAPEGV IDRCTHIRVG STKVPMTPGV KQKIMSVIRE 550
WGSGSDTLRC LALATHDNPL RREEMHLEDS ANFIKYETNL TFVGCVGMLD 600
PPRIEVASSV KLCRQAGIRV IMITGDNKGT AVAICRRIGI FGQDEDVTSK 650
AFTGREFDEL SPSAQRDACL NARCFARVEP SHKSKIVEFL QSFDEITAMT 700
GDGVNDAPAL KKSEIGIAMG SGTAVAKTAS EMVLADDNFS TIVAAVEEGR 750
AIYNNMKQFI RYLISSNVGE VVCIFLTAAL GFPEALIPVQ LLWVNLVTDG 800
LPATALGFNP PDLDIMNKPP RNPKEPLISG WLFFRYLAIG CYVGAATVGA 850
AAWWFIAADG GPRVSFYQLS HFLQCKEDNP DFEGVDCAIF ESPYPMTMAL 900
SVLVTIEMCN ALNSLSENQS LLRMPPWENI WLVGSICLSM SLHFLILYVE 950
PLPLIFQITP LNLTQWLMVL KISLPVILMD ETLKFVARNY LEPGKECAQP 1000
ATKPSCSLSA CTDGISWPFV LLIMPLVVWV YSTDTNFSDM FWS 1043
Length:1,043
Mass (Da):114,768
Last modified:October 1, 1989 - v1
Checksum:i4B0B476BFD97F390
GO
Isoform 2 (identifier: P11507-2) [UniParc]FASTAAdd to Basket

Also known as: Atp2a2a, SERCA2a

The sequence of this isoform differs from the canonical sequence as follows:
     994-1043: GKECAQPATKPSCSLSACTDGISWPFVLLIMPLVVWVYSTDTNFSDMFWS → AILE

Show »
Length:997
Mass (Da):109,681
Checksum:i3A14A6B604E97002
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei994 – 104350GKECA…DMFWS → AILE in isoform 2. VSP_000362Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
J04022 mRNA. Translation: AAA40785.1.
J04024 mRNA. Translation: AAA40787.1.
J04023 mRNA. Translation: AAA40786.1.
X15635 mRNA. Translation: CAA33645.1.
PIRiA31982.
B31982.
RefSeqiNP_001103609.1. NM_001110139.2. [P11507-2]
NP_001104293.1. NM_001110823.2. [P11507-1]
UniGeneiRn.2305.

Genome annotation databases

GeneIDi29693.
KEGGirno:29693.
UCSCiRGD:2174. rat. [P11507-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
J04022 mRNA. Translation: AAA40785.1 .
J04024 mRNA. Translation: AAA40787.1 .
J04023 mRNA. Translation: AAA40786.1 .
X15635 mRNA. Translation: CAA33645.1 .
PIRi A31982.
B31982.
RefSeqi NP_001103609.1. NM_001110139.2. [P11507-2 ]
NP_001104293.1. NM_001110823.2. [P11507-1 ]
UniGenei Rn.2305.

3D structure databases

ProteinModelPortali P11507.
SMRi P11507. Positions 1-992.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 248313. 1 interaction.
IntActi P11507. 2 interactions.
MINTi MINT-4563897.

PTM databases

PhosphoSitei P11507.

Proteomic databases

PaxDbi P11507.
PRIDEi P11507.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 29693.
KEGGi rno:29693.
UCSCi RGD:2174. rat. [P11507-1 ]

Organism-specific databases

CTDi 488.
RGDi 2174. Atp2a2.

Phylogenomic databases

eggNOGi COG0474.
HOGENOMi HOG000265621.
HOVERGENi HBG105648.
InParanoidi P11507.
KOi K05853.
PhylomeDBi P11507.

Miscellaneous databases

NextBioi 610084.
PROi P11507.

Gene expression databases

Genevestigatori P11507.

Family and domain databases

Gene3Di 1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProi IPR005782. ATPase_P-typ_Ca-transp_IIA.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view ]
Pfami PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view ]
PRINTSi PR00119. CATATPASE.
PR00120. HATPASE.
SMARTi SM00831. Cation_ATPase_N. 1 hit.
[Graphical view ]
SUPFAMi SSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsi TIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "A novel Ca2+ pump expressed in brain, kidney, and stomach is encoded by an alternative transcript of the slow-twitch muscle sarcoplasmic reticulum Ca-ATPase gene. Identification of cDNAs encoding Ca2+ and other cation-transporting ATPases using an oligonucleotide probe derived from the ATP-binding site."
    Gunteski-Hamblin A.-M., Greeb J., Shull G.E.
    J. Biol. Chem. 263:15032-15040(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  2. "Characterization and expression of the rat heart sarcoplasmic reticulum Ca2+-ATPase mRNA."
    Lompre A.M., de la Bastie D., Boheler K.R., Schwartz K.
    FEBS Lett. 249:35-41(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Heart.
  3. "Protein modification during biological aging: selective tyrosine nitration of the SERCA2a isoform of the sarcoplasmic reticulum Ca2+-ATPase in skeletal muscle."
    Viner R.I., Ferrington D.A., Williams T.D., Bigelow D.J., Schoeneich C.
    Biochem. J. 340:657-669(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NITRATION AT TYR-294 AND TYR-295.
  4. "Detection of sequence-specific tyrosine nitration of manganese SOD and SERCA in cardiovascular disease and aging."
    Xu S., Ying J., Jiang B., Guo W., Adachi T., Sharov V., Lazar H., Menzoian J., Knyushko T.V., Bigelow D., Schoeneich C., Cohen R.A.
    Am. J. Physiol. 290:H2220-H2227(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NITRATION AT TYR-294 AND TYR-295.

Entry informationi

Entry nameiAT2A2_RAT
AccessioniPrimary (citable) accession number: P11507
Secondary accession number(s): P11508
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: October 1, 1989
Last modified: June 11, 2014
This is version 140 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi