Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 2

Gene

Atp2a2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Isoform SERCA2A is involved in the regulation of the contraction/relaxation cycle (By similarity).By similarity

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Enzyme regulationi

Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi304 – 3041Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi305 – 3051Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi307 – 3071Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi309 – 3091Calcium 2By similarity
Active sitei351 – 35114-aspartylphosphate intermediateBy similarity
Metal bindingi702 – 7021MagnesiumBy similarity
Metal bindingi706 – 7061MagnesiumBy similarity
Metal bindingi767 – 7671Calcium 1By similarity
Metal bindingi770 – 7701Calcium 1By similarity
Metal bindingi795 – 7951Calcium 2By similarity
Metal bindingi798 – 7981Calcium 1By similarity
Metal bindingi799 – 7991Calcium 1By similarity
Metal bindingi799 – 7991Calcium 2By similarity
Metal bindingi907 – 9071Calcium 1By similarity

GO - Molecular functioni

  • ATP binding Source: RGD
  • calcium ion binding Source: RGD
  • calcium-transporting ATPase activity Source: RGD
  • calcium-transporting ATPase activity involved in regulation of cardiac muscle cell membrane potential Source: BHF-UCL
  • lutropin-choriogonadotropic hormone receptor binding Source: RGD

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (EC:3.6.3.8)
Short name:
SERCA2
Short name:
SR Ca(2+)-ATPase 2
Alternative name(s):
Calcium pump 2
Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform
Endoplasmic reticulum class 1/2 Ca(2+) ATPase
Gene namesi
Name:Atp2a2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494 Componenti: Unplaced

Organism-specific databases

RGDi2174. Atp2a2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4848CytoplasmicBy similarityAdd
BLAST
Transmembranei49 – 6921Helical; Name=1By similarityAdd
BLAST
Topological domaini70 – 8920LumenalBy similarityAdd
BLAST
Transmembranei90 – 11021Helical; Name=2By similarityAdd
BLAST
Topological domaini111 – 253143CytoplasmicBy similarityAdd
BLAST
Transmembranei254 – 27320Helical; Name=3By similarityAdd
BLAST
Topological domaini274 – 29522LumenalBy similarityAdd
BLAST
Transmembranei296 – 31318Helical; Name=4By similarityAdd
BLAST
Topological domaini314 – 756443CytoplasmicBy similarityAdd
BLAST
Transmembranei757 – 77620Helical; Name=5By similarityAdd
BLAST
Topological domaini777 – 78610LumenalBy similarity
Transmembranei787 – 80721Helical; Name=6By similarityAdd
BLAST
Topological domaini808 – 82720CytoplasmicBy similarityAdd
BLAST
Transmembranei828 – 85023Helical; Name=7By similarityAdd
BLAST
Topological domaini851 – 89646LumenalBy similarityAdd
BLAST
Transmembranei897 – 91620Helical; Name=8By similarityAdd
BLAST
Topological domaini917 – 92913CytoplasmicBy similarityAdd
BLAST
Transmembranei930 – 94819Helical; Name=9By similarityAdd
BLAST
Topological domaini949 – 96315LumenalBy similarityAdd
BLAST
Transmembranei964 – 98421Helical; Name=10By similarityAdd
BLAST
Topological domaini985 – 104359CytoplasmicBy similarityAdd
BLAST

GO - Cellular componenti

  • calcium ion-transporting ATPase complex Source: Ensembl
  • extrinsic component of cytoplasmic side of plasma membrane Source: RGD
  • intercalated disc Source: Ensembl
  • longitudinal sarcoplasmic reticulum Source: Ensembl
  • perinuclear region of cytoplasm Source: RGD
  • protein complex Source: RGD
  • ribbon synapse Source: Ensembl
  • sarcoplasmic reticulum Source: RGD
  • sarcoplasmic reticulum membrane Source: RGD
  • vesicle membrane Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Sarcoplasmic reticulum

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10431043Sarcoplasmic/endoplasmic reticulum calcium ATPase 2PRO_0000046200Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki143 – 143Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei294 – 2941Nitrated tyrosine2 Publications
Modified residuei295 – 2951Nitrated tyrosine2 Publications
Modified residuei580 – 5801PhosphoserineBy similarity
Modified residuei663 – 6631PhosphoserineBy similarity

Post-translational modificationi

Nitrated under oxidative stress. Nitration on the two tyrosine residues inhibits catalytic activity (By similarity).By similarity

Keywords - PTMi

Isopeptide bond, Nitration, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiP11507.
PRIDEiP11507.

PTM databases

PhosphoSiteiP11507.

Expressioni

Tissue specificityi

Isoform 2 is highly expressed in heart and slow twitch skeletal muscle. Isoform 1 is widely expressed.

Gene expression databases

GenevisibleiP11507. RN.

Interactioni

Subunit structurei

Associated with phospholamban (PLN) (By similarity). Isoform SERCA2B interacts with TRAM2 (via C-terminus). Interacts with HAX1 (By similarity). Interacts with S100A8 and S100A9 (By similarity). Interacts with SLC35G1 and STIM1 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Tlr9Q9EQU34EBI-916319,EBI-9979528From a different organism.

Protein-protein interaction databases

BioGridi248313. 1 interaction.
IntActiP11507. 4 interactions.
MINTiMINT-4563897.
STRINGi10116.ENSRNOP00000024347.

Structurei

3D structure databases

ProteinModelPortaliP11507.
SMRiP11507. Positions 1-992.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni370 – 40031Interacts with phospholamban 1By similarityAdd
BLAST
Regioni575 – 59420Interacts with HAX1By similarityAdd
BLAST
Regioni787 – 80721Interacts with phospholamban 2By similarityAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0474.
GeneTreeiENSGT00800000124056.
HOGENOMiHOG000265621.
HOVERGENiHBG105648.
InParanoidiP11507.
KOiK05853.
PhylomeDBiP11507.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR005782. P-type_ATPase_IIA.
IPR001757. P_typ_ATPase.
IPR030327. SERCA2.
[Graphical view]
PANTHERiPTHR24093:SF234. PTHR24093:SF234. 1 hit.
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
PR00120. HATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P11507-1) [UniParc]FASTAAdd to basket

Also known as: Atp2a2b, SERCA2b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MENAHTKTVE EVLGHFGVNE STGLSLEQVK KLKERWGSNE LPAEEGKTLL
60 70 80 90 100
ELVIEQFEDL LVRILLLAAC ISFVLAWFEE GEETITAFVE PFVILLILVA
110 120 130 140 150
NAIVGVWQER NAENAIEALK EYEPEMGKVY RQDRKSVQRI KAKDIVPGDI
160 170 180 190 200
VEIAVGDKVP ADIRLTSIKS TTLRVDQSIL TGESVSVIKH TDPVPDPRAV
210 220 230 240 250
NQDKKNMLFS GTNIAAGKAM GVVVATGVNT EIGKIRDEMV ATEQERTPLQ
260 270 280 290 300
QKLDEFGEQL SKVISLICIA VWIINIGHFN DPVHGGSWIR GAIYYFKIAV
310 320 330 340 350
ALAVAAIPEG LPAVITTCLA LGTRRMAKKN AIVRSLPSVE TLGCTSVICS
360 370 380 390 400
DKTGTLTTNQ MSVCRMFILD KVEGDTCSLN EFTITGSTYA PIGEVQKDDK
410 420 430 440 450
PVKCHQYDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE
460 470 480 490 500
KMNVFDTELK GLSKIERANA CNSVIKQLMK KEFTLEFSRD RKSMSVYCTP
510 520 530 540 550
NKPSRTSMSK MFVKGAPEGV IDRCTHIRVG STKVPMTPGV KQKIMSVIRE
560 570 580 590 600
WGSGSDTLRC LALATHDNPL RREEMHLEDS ANFIKYETNL TFVGCVGMLD
610 620 630 640 650
PPRIEVASSV KLCRQAGIRV IMITGDNKGT AVAICRRIGI FGQDEDVTSK
660 670 680 690 700
AFTGREFDEL SPSAQRDACL NARCFARVEP SHKSKIVEFL QSFDEITAMT
710 720 730 740 750
GDGVNDAPAL KKSEIGIAMG SGTAVAKTAS EMVLADDNFS TIVAAVEEGR
760 770 780 790 800
AIYNNMKQFI RYLISSNVGE VVCIFLTAAL GFPEALIPVQ LLWVNLVTDG
810 820 830 840 850
LPATALGFNP PDLDIMNKPP RNPKEPLISG WLFFRYLAIG CYVGAATVGA
860 870 880 890 900
AAWWFIAADG GPRVSFYQLS HFLQCKEDNP DFEGVDCAIF ESPYPMTMAL
910 920 930 940 950
SVLVTIEMCN ALNSLSENQS LLRMPPWENI WLVGSICLSM SLHFLILYVE
960 970 980 990 1000
PLPLIFQITP LNLTQWLMVL KISLPVILMD ETLKFVARNY LEPGKECAQP
1010 1020 1030 1040
ATKPSCSLSA CTDGISWPFV LLIMPLVVWV YSTDTNFSDM FWS
Length:1,043
Mass (Da):114,768
Last modified:October 1, 1989 - v1
Checksum:i4B0B476BFD97F390
GO
Isoform 2 (identifier: P11507-2) [UniParc]FASTAAdd to basket

Also known as: Atp2a2a, SERCA2a

The sequence of this isoform differs from the canonical sequence as follows:
     994-1043: GKECAQPATKPSCSLSACTDGISWPFVLLIMPLVVWVYSTDTNFSDMFWS → AILE

Show »
Length:997
Mass (Da):109,681
Checksum:i3A14A6B604E97002
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei994 – 104350GKECA…DMFWS → AILE in isoform 2. 2 PublicationsVSP_000362Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04022 mRNA. Translation: AAA40785.1.
J04024 mRNA. Translation: AAA40787.1.
J04023 mRNA. Translation: AAA40786.1.
X15635 mRNA. Translation: CAA33645.1.
PIRiA31982.
B31982.
RefSeqiNP_001103609.1. NM_001110139.2. [P11507-2]
NP_001104293.1. NM_001110823.2. [P11507-1]
UniGeneiRn.2305.

Genome annotation databases

EnsembliENSRNOT00000001738; ENSRNOP00000001738; ENSRNOG00000001285. [P11507-2]
ENSRNOT00000024347; ENSRNOP00000024347; ENSRNOG00000001285. [P11507-1]
GeneIDi29693.
KEGGirno:29693.
UCSCiRGD:2174. rat. [P11507-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04022 mRNA. Translation: AAA40785.1.
J04024 mRNA. Translation: AAA40787.1.
J04023 mRNA. Translation: AAA40786.1.
X15635 mRNA. Translation: CAA33645.1.
PIRiA31982.
B31982.
RefSeqiNP_001103609.1. NM_001110139.2. [P11507-2]
NP_001104293.1. NM_001110823.2. [P11507-1]
UniGeneiRn.2305.

3D structure databases

ProteinModelPortaliP11507.
SMRiP11507. Positions 1-992.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi248313. 1 interaction.
IntActiP11507. 4 interactions.
MINTiMINT-4563897.
STRINGi10116.ENSRNOP00000024347.

PTM databases

PhosphoSiteiP11507.

Proteomic databases

PaxDbiP11507.
PRIDEiP11507.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000001738; ENSRNOP00000001738; ENSRNOG00000001285. [P11507-2]
ENSRNOT00000024347; ENSRNOP00000024347; ENSRNOG00000001285. [P11507-1]
GeneIDi29693.
KEGGirno:29693.
UCSCiRGD:2174. rat. [P11507-1]

Organism-specific databases

CTDi488.
RGDi2174. Atp2a2.

Phylogenomic databases

eggNOGiCOG0474.
GeneTreeiENSGT00800000124056.
HOGENOMiHOG000265621.
HOVERGENiHBG105648.
InParanoidiP11507.
KOiK05853.
PhylomeDBiP11507.

Miscellaneous databases

NextBioi610084.
PROiP11507.

Gene expression databases

GenevisibleiP11507. RN.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR005782. P-type_ATPase_IIA.
IPR001757. P_typ_ATPase.
IPR030327. SERCA2.
[Graphical view]
PANTHERiPTHR24093:SF234. PTHR24093:SF234. 1 hit.
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
PR00120. HATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "A novel Ca2+ pump expressed in brain, kidney, and stomach is encoded by an alternative transcript of the slow-twitch muscle sarcoplasmic reticulum Ca-ATPase gene. Identification of cDNAs encoding Ca2+ and other cation-transporting ATPases using an oligonucleotide probe derived from the ATP-binding site."
    Gunteski-Hamblin A.-M., Greeb J., Shull G.E.
    J. Biol. Chem. 263:15032-15040(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  2. "Characterization and expression of the rat heart sarcoplasmic reticulum Ca2+-ATPase mRNA."
    Lompre A.M., de la Bastie D., Boheler K.R., Schwartz K.
    FEBS Lett. 249:35-41(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Heart.
  3. "Protein modification during biological aging: selective tyrosine nitration of the SERCA2a isoform of the sarcoplasmic reticulum Ca2+-ATPase in skeletal muscle."
    Viner R.I., Ferrington D.A., Williams T.D., Bigelow D.J., Schoeneich C.
    Biochem. J. 340:657-669(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NITRATION AT TYR-294 AND TYR-295.
  4. "Detection of sequence-specific tyrosine nitration of manganese SOD and SERCA in cardiovascular disease and aging."
    Xu S., Ying J., Jiang B., Guo W., Adachi T., Sharov V., Lazar H., Menzoian J., Knyushko T.V., Bigelow D., Schoeneich C., Cohen R.A.
    Am. J. Physiol. 290:H2220-H2227(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NITRATION AT TYR-294 AND TYR-295.

Entry informationi

Entry nameiAT2A2_RAT
AccessioniPrimary (citable) accession number: P11507
Secondary accession number(s): P11508
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: October 1, 1989
Last modified: July 22, 2015
This is version 147 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.