P11507 (AT2A2_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 129.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 Short name=SERCA2 Short name=SR Ca(2+)-ATPase 2 EC=3.6.3.8 Alternative name(s): Calcium pump 2 Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform Endoplasmic reticulum class 1/2 Ca(2+) ATPase | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 1043 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Isoform SERCA2A is involved in the regulation of the contraction/relaxation cycle By similarity. |
| Catalytic activity | ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2). |
| Enzyme regulation | Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN By similarity. |
| Subunit structure | Associated with phospholamban (PLN) By similarity. Isoform SERCA2B interacts with TRAM2 (via C-terminus). Interacts with HAX1 By similarity. Interacts with S100A8 and S100A9 By similarity. |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein. |
| Tissue specificity | Isoform SERCA2A is highly expressed in heart and slow twitch skeletal muscle. Isoform SERCA2B is widely expressed. |
| Post-translational modification | Nitrated under oxidative stress. Nitration on the two tyrosine residues inhibits catalytic activity By similarity. |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification] |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform SERCA2B (identifier: P11507-1) Also known as: ATP2A2B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SERCA2A (identifier: P11507-2) Also known as: ATP2A2A; The sequence of this isoform differs from the canonical sequence as follows: 994-1043: GKECAQPATKPSCSLSACTDGISWPFVLLIMPLVVWVYSTDTNFSDMFWS → AILE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1043 | 1043 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 | PRO_0000046200 | |||||
Regions | |||||||||
| Topological domain | 1 – 48 | 48 | Cytoplasmic By similarity | ||||||
| Transmembrane | 49 – 69 | 21 | Helical; Name=1; By similarity | ||||||
| Topological domain | 70 – 89 | 20 | Lumenal By similarity | ||||||
| Transmembrane | 90 – 110 | 21 | Helical; Name=2; By similarity | ||||||
| Topological domain | 111 – 253 | 143 | Cytoplasmic By similarity | ||||||
| Transmembrane | 254 – 273 | 20 | Helical; Name=3; By similarity | ||||||
| Topological domain | 274 – 295 | 22 | Lumenal By similarity | ||||||
| Transmembrane | 296 – 313 | 18 | Helical; Name=4; By similarity | ||||||
| Topological domain | 314 – 756 | 443 | Cytoplasmic By similarity | ||||||
| Transmembrane | 757 – 776 | 20 | Helical; Name=5; By similarity | ||||||
| Topological domain | 777 – 786 | 10 | Lumenal By similarity | ||||||
| Transmembrane | 787 – 807 | 21 | Helical; Name=6; By similarity | ||||||
| Topological domain | 808 – 827 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 828 – 850 | 23 | Helical; Name=7; By similarity | ||||||
| Topological domain | 851 – 896 | 46 | Lumenal By similarity | ||||||
| Transmembrane | 897 – 916 | 20 | Helical; Name=8; By similarity | ||||||
| Topological domain | 917 – 929 | 13 | Cytoplasmic By similarity | ||||||
| Transmembrane | 930 – 948 | 19 | Helical; Name=9; By similarity | ||||||
| Topological domain | 949 – 963 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 964 – 984 | 21 | Helical; Name=10; By similarity | ||||||
| Topological domain | 985 – 1043 | 59 | Cytoplasmic By similarity | ||||||
| Region | 370 – 400 | 31 | Interacts with phospholamban 1 By similarity | ||||||
| Region | 575 – 594 | 20 | Interacts with HAX1 By similarity | ||||||
| Region | 787 – 807 | 21 | Interacts with phospholamban 2 By similarity | ||||||
Sites | |||||||||
| Active site | 351 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 304 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 305 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 307 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 309 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 702 | 1 | Magnesium By similarity | ||||||
| Metal binding | 706 | 1 | Magnesium By similarity | ||||||
| Metal binding | 767 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 770 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 795 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 798 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 907 | 1 | Calcium 1 By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 294 | 1 | Nitrated tyrosine Ref.4 | ||||||
| Modified residue | 295 | 1 | Nitrated tyrosine Ref.4 | ||||||
| Modified residue | 537 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 663 | 1 | Phosphoserine By similarity | ||||||
| Cross-link | 143 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 994 – 1043 | 50 | GKECA…DMFWS → AILE in isoform SERCA2A. | VSP_000362 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "A novel Ca2+ pump expressed in brain, kidney, and stomach is encoded by an alternative transcript of the slow-twitch muscle sarcoplasmic reticulum Ca-ATPase gene. Identification of cDNAs encoding Ca2+ and other cation-transporting ATPases using an oligonucleotide probe derived from the ATP-binding site." Gunteski-Hamblin A.-M., Greeb J., Shull G.E. J. Biol. Chem. 263:15032-15040(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA2A AND SERCA2B). Tissue: Brain. |
| [2] | "Characterization and expression of the rat heart sarcoplasmic reticulum Ca2+-ATPase mRNA." Lompre A.M., de la Bastie D., Boheler K.R., Schwartz K. FEBS Lett. 249:35-41(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SERCA2A). Tissue: Heart. |
| [3] | "Protein modification during biological aging: selective tyrosine nitration of the SERCA2a isoform of the sarcoplasmic reticulum Ca2+-ATPase in skeletal muscle." Viner R.I., Ferrington D.A., Williams T.D., Bigelow D.J., Schoeneich C. Biochem. J. 340:657-669(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NITRATION. |
| [4] | "Detection of sequence-specific tyrosine nitration of manganese SOD and SERCA in cardiovascular disease and aging." Xu S., Ying J., Jiang B., Guo W., Adachi T., Sharov V., Lazar H., Menzoian J., Knyushko T.V., Bigelow D., Schoeneich C., Cohen R.A. Am. J. Physiol. 290:H2220-H2227(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NITRATION AT TYR-294 AND TYR-295. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | J04022 mRNA. Translation: AAA40785.1. J04024 mRNA. Translation: AAA40787.1. J04023 mRNA. Translation: AAA40786.1. X15635 mRNA. Translation: CAA33645.1. |
| IPI | IPI00190020. IPI00231369. |
| PIR | A31982. B31982. |
| RefSeq | NP_001103609.1. NM_001110139.2. NP_001104293.1. NM_001110823.2. |
| UniGene | Rn.2305. |
3D structure databases | |
| ProteinModelPortal | P11507. |
| SMR | P11507. Positions 1-992. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P11507. 2 interactions. |
PTM databases | |
| PhosphoSite | P11507. |
Proteomic databases | |
| PaxDb | P11507. |
| PRIDE | P11507. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 29693. |
| KEGG | rno:29693. |
| UCSC | RGD:2174. rat. |
Organism-specific databases | |
| CTD | 488. |
| RGD | 2174. Atp2a2. |
Phylogenomic databases | |
| eggNOG | COG0474. |
| HOGENOM | HOG000265621. |
| HOVERGEN | HBG105648. |
| InParanoid | P11507. |
| KO | K05853. |
Gene expression databases | |
| ArrayExpress | P11507. |
| Genevestigator | P11507. |
| GermOnline | ENSRNOG00000001285. Rattus norvegicus. |
Family and domain databases | |
| Gene3D | 1.20.1110.10. 2 hits. 2.70.150.10. 2 hits. 3.40.1110.10. 1 hit. |
| InterPro | IPR005782. ATPase_P-typ_Ca-transp_IIA. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR023299. ATPase_P-typ_cyto_domN. IPR018303. ATPase_P-typ_P_site. IPR023298. ATPase_P-typ_TM_dom. IPR008250. ATPase_P-typ_transduc_dom_A. IPR001757. Cation_transp_P_typ_ATPase. IPR023214. HAD-like_dom. [Graphical view] |
| PANTHER | PTHR24093. PTHR24093. 1 hit. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. PR00120. HATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| SUPFAM | SSF81660. ATPase_cation_domN. 1 hit. SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR01116. ATPase-IIA1_Ca. 1 hit. TIGR01494. ATPase_P-type. 2 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 610084. |
Entry information
| Entry name | AT2A2_RAT | ||||||||
| Accession | Primary (citable) accession number: P11507 Secondary accession number(s): P11508 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
