SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P11506

- AT2B2_RAT

UniProt

P11506 - AT2B2_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Plasma membrane calcium-transporting ATPase 2

Gene
Atp2b2
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei499 – 49914-aspartylphosphate intermediate
Metal bindingi820 – 8201Magnesium By similarity
Metal bindingi824 – 8241Magnesium By similarity

GO - Molecular functioni

  1. acetylcholine receptor binding Source: RGD
  2. ATP binding Source: RGD
  3. calcium ion binding Source: UniProtKB
  4. calcium-transporting ATPase activity Source: RGD
  5. calmodulin binding Source: UniProtKB
  6. glutamate receptor binding Source: RGD
  7. metal ion binding Source: UniProtKB-KW
  8. PDZ domain binding Source: RGD
  9. protein C-terminus binding Source: UniProtKB

GO - Biological processi

  1. brain development Source: RGD
  2. calcium ion export Source: RGD
  3. calcium ion transmembrane transport Source: GOC
  4. neural retina development Source: RGD
  5. neuron differentiation Source: UniProtKB
  6. sensory perception of sound Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Calmodulin-binding, Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Plasma membrane calcium-transporting ATPase 2 (EC:3.6.3.8)
Short name:
PMCA2
Alternative name(s):
Plasma membrane calcium ATPase isoform 2
Plasma membrane calcium pump isoform 2
Gene namesi
Name:Atp2b2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi2176. Atp2b2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 9494Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei95 – 11521Helical; Reviewed predictionAdd
BLAST
Topological domaini116 – 15237Extracellular Reviewed predictionAdd
BLAST
Transmembranei153 – 17321Helical; Reviewed predictionAdd
BLAST
Topological domaini174 – 390217Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei391 – 41020Helical; Reviewed predictionAdd
BLAST
Topological domaini411 – 44333Extracellular Reviewed predictionAdd
BLAST
Transmembranei444 – 46118Helical; Reviewed predictionAdd
BLAST
Topological domaini462 – 875414Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei876 – 89520Helical; Reviewed predictionAdd
BLAST
Topological domaini896 – 90510Extracellular Reviewed prediction
Transmembranei906 – 92621Helical; Reviewed predictionAdd
BLAST
Topological domaini927 – 94620Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei947 – 96923Helical; Reviewed predictionAdd
BLAST
Topological domaini970 – 98718Extracellular Reviewed predictionAdd
BLAST
Transmembranei988 – 100922Helical; Reviewed predictionAdd
BLAST
Topological domaini1010 – 102819Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei1029 – 105022Helical; Reviewed predictionAdd
BLAST
Topological domaini1051 – 106010Extracellular Reviewed prediction
Transmembranei1061 – 108222Helical; Reviewed predictionAdd
BLAST
Topological domaini1083 – 1243161Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. apical plasma membrane Source: RGD
  2. cytoplasm Source: UniProtKB
  3. dendrite Source: RGD
  4. integral component of membrane Source: UniProtKB-KW
  5. membrane raft Source: RGD
  6. neuronal cell body Source: RGD
  7. neuronal cell body membrane Source: RGD
  8. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12431243Plasma membrane calcium-transporting ATPase 2PRO_0000046216Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1139 – 11391Phosphothreonine; by PKC By similarity
Modified residuei1201 – 12011Phosphoserine; by PKA By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP11506.
PRIDEiP11506.

PTM databases

PhosphoSiteiP11506.

Miscellaneous databases

PMAP-CutDBP11506.

Expressioni

Tissue specificityi

Isoforms containing segment B are found in brain, uterus, liver and kidney and in low levels in other tissues. Isoforms containing segment W are found in kidney, uterus, and pancreas. Isoforms containing segment Y are found in pancreas and in low levels in brain and heart. Isoforms containing segment Z are found in brain and heart and isoforms containing segment X are found in low levels in brain. Isoforms containing segment A are found in low levels in heart and small intestine while isoforms containing segment C are found in testis and in low levels in other tissues.

Gene expression databases

GenevestigatoriP11506.

Interactioni

Subunit structurei

Interacts with PDZD11 By similarity.

Protein-protein interaction databases

BioGridi246403. 1 interaction.
IntActiP11506. 1 interaction.
MINTiMINT-471009.
STRINGi10116.ENSRNOP00000060489.

Structurei

3D structure databases

ProteinModelPortaliP11506.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1123 – 114018Calmodulin-binding subdomain A By similarityAdd
BLAST
Regioni1141 – 115010Calmodulin-binding subdomain B By similarity

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi294 – 2974Poly-Glu

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0474.
HOGENOMiHOG000265623.
HOVERGENiHBG061286.
KOiK05850.
PhylomeDBiP11506.

Family and domain databases

Gene3Di1.20.1110.10. 1 hit.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR022141. ATP_Ca_trans_C.
IPR006408. ATPase_P-typ_Ca-transp_plasma.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view]
PfamiPF12424. ATP_Ca_trans_C. 1 hit.
PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 2 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01517. ATPase-IIB_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (14)i

Sequence statusi: Complete.

This entry describes 14 isoformsi produced by alternative splicing. Align

Note: There is a combination of two alternatively spliced domains at N-terminal site A (W, X, Y and Z) and at C-terminal site C (A, B and C). So far the splice sites have only been studied independently. Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: P11506-13) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGDMTNSDFY SKNQRNESSH GGEFGCSMEE LRSLMELRGT EAVVKIKETY     50
GDTESICRRL KTSPVEGLPG TAPDLEKRKQ IFGQNFIPPK KPKTFLQLVW 100
EALQDVTLII LEIAAIISLG LSFYHPPGES NEGCATAQGG AEDEGEAEAG 150
WIEGAAILLS VICVVLVTAF NDWSKEKQFR GLQSRIEQEQ KFTVVRAGQV 200
VQIPVAEIVV GDIAQIKYGD LLPADGLFIQ GNDLKIDESS LTGESDQVRK 250
SVDKDPMLLS GTHVMEGSGR MVVTAVGVNS QTGIIFTLLG AGGEEEEKKD 300
KKGVKKGDGL QLPAADGAAP ANAAGSANAS LVNGKMQDGS ADSSQSKAKQ 350
QDGAAAMEMQ PLKSAEGGDA DDKKKANMHK KEKSVLQGKL TKLAVQIGKA 400
GLVMSAITVI ILVLYFTVDT FVVNKKPWLT ECTPVYVQYF VKFFIIGVTV 450
LVVAVPEGLP LAVTISLAYS VKKMMKDNNL VRHLDACETM GNATAICSDK 500
TGTLTTNRMT VVQAYVGDVH YKEIPDPSSI NAKTLELLVN AIAINSAYTT 550
KILPPEKEGA LPRQVGNKTE CGLLGFVLDL RQDYEPVRSQ MPEEKLYKVY 600
TFNSVRKSMS TVIKMPDESF RMYSKGASEI VLKKCCKILS GAGEPRVFRP 650
RDRDEMVKKV IEPMACDGLR TICVAYRDFP SSPEPDWDNE NDILNELTCI 700
CVVGIEDPVR PEVPEAIRKC QRAGITVRMV TGDNINTARA IAIKCGIIHP 750
GEDFLCLEGK EFNRRIRNEK GEIEQERIDK IWPKLRVLAR SSPTDKHTLV 800
KGIIDSTHTE QRQVVAVTGD GTNDGPALKK ADVGFAMGIA GTDVAKEASD 850
IILTDDNFSS IVKAVMWGRN VYDSISKFLQ FQLTVNVVAV IVAFTGACIT 900
QDSPLKAVQM LWVNLIMDTF ASLALATEPP TETLLLRKPY GRNKPLISRT 950
MMKNILGHAV YQLTLIFTLL FVGEKMFQID SGRNAPLHSP PSEHYTIIFN 1000
TFVMMQLFNE INARKIHGER NVFDGIFRNP IFCTIVLGTF AIQIVIVQFG 1050
GKPFSCSPLQ LDQWMWCIFI GLGELVWGQV IATIPTSRLK FLKEAGRLTQ 1100
KEEIPEEELN EDVEEIDHAE RELRRGQILW FRGLNRIQTQ IRVVKAFRSS 1150
LYEGLEKPES RTSIHNFMAH PEFRIEDSQP HIPLIDDTDL EEDAALKQNS 1200
SPPSSLNKNN SAIDSGINLT TDTSKSATSS SPGSPIHSLE TSL 1243
Length:1,243
Mass (Da):136,811
Last modified:June 1, 2001 - v2
Checksum:i1DC324836BFD5D59
GO
Isoform WB (identifier: P11506-1) [UniParc]FASTAAdd to Basket

Also known as: AIIICI

The sequence of this isoform differs from the canonical sequence as follows:
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.

Show »
Length:1,257
Mass (Da):138,245
Checksum:iFA4413080598ABF8
GO
Isoform WA (identifier: P11506-2) [UniParc]FASTAAdd to Basket

Also known as: AIIICII

The sequence of this isoform differs from the canonical sequence as follows:
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

Show »
Length:1,199
Mass (Da):131,552
Checksum:i702E8C5EE0D003B4
GO
Isoform XA (identifier: P11506-3) [UniParc]FASTAAdd to Basket

Also known as: AIICII

The sequence of this isoform differs from the canonical sequence as follows:
     303-333: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

Show »
Length:1,168
Mass (Da):128,764
Checksum:i6AB32E12491365BB
GO
Isoform YA (identifier: P11506-4) [UniParc]FASTAAdd to Basket

Also known as: AIIICII

The sequence of this isoform differs from the canonical sequence as follows:
     334-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

Show »
Length:1,185
Mass (Da):130,145
Checksum:i5D4B80A8A5627C1E
GO
Isoform ZA (identifier: P11506-5) [UniParc]FASTAAdd to Basket

Also known as: AICII

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

Show »
Length:1,154
Mass (Da):127,357
Checksum:i22BF0F734827E168
GO
Isoform XB (identifier: P11506-6) [UniParc]FASTAAdd to Basket

Also known as: AIICI

The sequence of this isoform differs from the canonical sequence as follows:
     303-333: Missing.
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.

Show »
Length:1,226
Mass (Da):135,457
Checksum:iC1C8678C84C5A81D
GO
Isoform YB (identifier: P11506-7) [UniParc]FASTAAdd to Basket

Also known as: AIIICI

The sequence of this isoform differs from the canonical sequence as follows:
     334-347: Missing.
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.

Show »
Length:1,243
Mass (Da):136,837
Checksum:iCD227EBA699DEE58
GO
Isoform ZB (identifier: P11506-8) [UniParc]FASTAAdd to Basket

Also known as: AICI

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.

Show »
Length:1,212
Mass (Da):134,049
Checksum:iD1FFFEB5C78AE637
GO
Isoform WC (identifier: P11506-9) [UniParc]FASTAAdd to Basket

Also known as: AIIICIII

The sequence of this isoform differs from the canonical sequence as follows:
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

Show »
Length:1,205
Mass (Da):132,296
Checksum:i894D6AD40637CF29
GO
Isoform XC (identifier: P11506-10) [UniParc]FASTAAdd to Basket

Also known as: AIICIII

The sequence of this isoform differs from the canonical sequence as follows:
     303-333: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

Show »
Length:1,174
Mass (Da):129,508
Checksum:i644AC852899E45B4
GO
Isoform YC (identifier: P11506-11) [UniParc]FASTAAdd to Basket

Also known as: AIIICIII

The sequence of this isoform differs from the canonical sequence as follows:
     334-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

Show »
Length:1,191
Mass (Da):130,889
Checksum:i8291A1522E47024C
GO
Isoform ZC (identifier: P11506-12) [UniParc]FASTAAdd to Basket

Also known as: AICIII

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

Show »
Length:1,160
Mass (Da):128,101
Checksum:i53A179C997F3DDB8
GO
Isoform 2 (identifier: P11506-14) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.

Show »
Length:1,198
Mass (Da):132,616
Checksum:i0362C0738CFA439F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei303 – 34745Missing in isoform 2, isoform ZA, isoform ZB and isoform ZC. VSP_000388Add
BLAST
Alternative sequencei303 – 33331Missing in isoform XA, isoform XB and isoform XC. VSP_000387Add
BLAST
Alternative sequencei334 – 34714Missing in isoform YA, isoform YB and isoform YC. VSP_000389Add
BLAST
Alternative sequencei1141 – 1243103IRVVK…LETSL → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVANLSSPSRVS LSNALSSPTSLPPAAAGQG in isoform WA, isoform XA, isoform YA and isoform ZA. VSP_000390Add
BLAST
Alternative sequencei1141 – 1243103IRVVK…LETSL → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVANLSSPSRVS LSNALSSPTSLPPAAAGHPR REGVP in isoform WC, isoform XC, isoform YC and isoform ZC. VSP_000391Add
BLAST
Alternative sequencei1141 – 11411I → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVASLSSPSRVS LSNALSSPTSLPPAAAGI in isoform WB, isoform XB, isoform YB and isoform ZB. VSP_038681
Alternative sequencei1201 – 124343Missing in isoform WB, isoform XB, isoform YB and isoform ZB. VSP_038682Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
J03754 mRNA. Translation: AAA74219.1.
AH005430 Genomic DNA. Translation: AAB60703.1.
PIRiB28065.
RefSeqiNP_036640.1. NM_012508.5. [P11506-14]
UniGeneiRn.90982.

Genome annotation databases

GeneIDi24215.
KEGGirno:24215.
UCSCiRGD:2176. rat. [P11506-13]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
J03754 mRNA. Translation: AAA74219.1 .
AH005430 Genomic DNA. Translation: AAB60703.1 .
PIRi B28065.
RefSeqi NP_036640.1. NM_012508.5. [P11506-14 ]
UniGenei Rn.90982.

3D structure databases

ProteinModelPortali P11506.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 246403. 1 interaction.
IntActi P11506. 1 interaction.
MINTi MINT-471009.
STRINGi 10116.ENSRNOP00000060489.

PTM databases

PhosphoSitei P11506.

Proteomic databases

PaxDbi P11506.
PRIDEi P11506.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 24215.
KEGGi rno:24215.
UCSCi RGD:2176. rat. [P11506-13 ]

Organism-specific databases

CTDi 491.
RGDi 2176. Atp2b2.

Phylogenomic databases

eggNOGi COG0474.
HOGENOMi HOG000265623.
HOVERGENi HBG061286.
KOi K05850.
PhylomeDBi P11506.

Miscellaneous databases

NextBioi 602633.
PMAP-CutDB P11506.
PROi P11506.

Gene expression databases

Genevestigatori P11506.

Family and domain databases

Gene3Di 1.20.1110.10. 1 hit.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProi IPR022141. ATP_Ca_trans_C.
IPR006408. ATPase_P-typ_Ca-transp_plasma.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view ]
Pfami PF12424. ATP_Ca_trans_C. 1 hit.
PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view ]
PRINTSi PR00119. CATATPASE.
SMARTi SM00831. Cation_ATPase_N. 1 hit.
[Graphical view ]
SUPFAMi SSF56784. SSF56784. 2 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsi TIGR01517. ATPase-IIB_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Molecular cloning of two isoforms of the plasma membrane Ca2+-transporting ATPase from rat brain. Structural and functional domains exhibit similarity to Na+,K+- and other cation transport ATPases."
    Shull G.E., Greeb J.
    J. Biol. Chem. 263:8646-8657(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: Sprague-Dawley.
    Tissue: Brain.
  2. "New Ca2+ pump isoforms generated by alternative splicing of rPMCA2 mRNA."
    Adamo H.P., Penniston J.T.
    Biochem. J. 283:355-359(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1083-1243 (ISOFORMS WB/XB/YB/ZB), ALTERNATIVE SPLICING.
  3. "Alternative splicing of exons encoding the calmodulin-binding domains and C termini of plasma membrane Ca(2+)-ATPase isoforms 1, 2, 3, and 4."
    Keeton T.P., Burk S.E., Shull G.E.
    J. Biol. Chem. 268:2740-2748(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1083-1243 (ISOFORMS WB/XB/YB/ZB), ALTERNATIVE SPLICING.
    Strain: Sprague-Dawley.

Entry informationi

Entry nameiAT2B2_RAT
AccessioniPrimary (citable) accession number: P11506
Secondary accession number(s): Q63443
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: June 1, 2001
Last modified: May 14, 2014
This is version 143 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi