Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P11506

- AT2B2_RAT

UniProt

P11506 - AT2B2_RAT

Protein

Plasma membrane calcium-transporting ATPase 2

Gene

Atp2b2

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 144 (01 Oct 2014)
      Sequence version 2 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.

    Catalytic activityi

    ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei499 – 49914-aspartylphosphate intermediate
    Metal bindingi820 – 8201MagnesiumBy similarity
    Metal bindingi824 – 8241MagnesiumBy similarity

    GO - Molecular functioni

    1. acetylcholine receptor binding Source: RGD
    2. ATP binding Source: RGD
    3. calcium ion binding Source: UniProtKB
    4. calcium-transporting ATPase activity Source: RGD
    5. calmodulin binding Source: UniProtKB
    6. glutamate receptor binding Source: RGD
    7. metal ion binding Source: UniProtKB-KW
    8. PDZ domain binding Source: RGD
    9. protein C-terminus binding Source: UniProtKB

    GO - Biological processi

    1. brain development Source: RGD
    2. calcium ion export Source: RGD
    3. calcium ion transmembrane transport Source: GOC
    4. neural retina development Source: RGD
    5. neuron differentiation Source: UniProtKB
    6. sensory perception of sound Source: UniProtKB

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Biological processi

    Calcium transport, Ion transport, Transport

    Keywords - Ligandi

    ATP-binding, Calcium, Calmodulin-binding, Magnesium, Metal-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Plasma membrane calcium-transporting ATPase 2 (EC:3.6.3.8)
    Short name:
    PMCA2
    Alternative name(s):
    Plasma membrane calcium ATPase isoform 2
    Plasma membrane calcium pump isoform 2
    Gene namesi
    Name:Atp2b2
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi2176. Atp2b2.

    Subcellular locationi

    GO - Cellular componenti

    1. apical plasma membrane Source: RGD
    2. cytoplasm Source: UniProtKB
    3. dendrite Source: RGD
    4. integral component of membrane Source: UniProtKB-KW
    5. membrane raft Source: RGD
    6. neuronal cell body Source: RGD
    7. neuronal cell body membrane Source: RGD
    8. plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12431243Plasma membrane calcium-transporting ATPase 2PRO_0000046216Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1139 – 11391Phosphothreonine; by PKCBy similarity
    Modified residuei1201 – 12011Phosphoserine; by PKABy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiP11506.
    PRIDEiP11506.

    PTM databases

    PhosphoSiteiP11506.

    Miscellaneous databases

    PMAP-CutDBP11506.

    Expressioni

    Tissue specificityi

    Isoforms containing segment B are found in brain, uterus, liver and kidney and in low levels in other tissues. Isoforms containing segment W are found in kidney, uterus, and pancreas. Isoforms containing segment Y are found in pancreas and in low levels in brain and heart. Isoforms containing segment Z are found in brain and heart and isoforms containing segment X are found in low levels in brain. Isoforms containing segment A are found in low levels in heart and small intestine while isoforms containing segment C are found in testis and in low levels in other tissues.

    Gene expression databases

    GenevestigatoriP11506.

    Interactioni

    Subunit structurei

    Interacts with PDZD11.By similarity

    Protein-protein interaction databases

    BioGridi246403. 1 interaction.
    IntActiP11506. 1 interaction.
    MINTiMINT-471009.
    STRINGi10116.ENSRNOP00000060489.

    Structurei

    3D structure databases

    ProteinModelPortaliP11506.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 9494CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini116 – 15237ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini174 – 390217CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini411 – 44333ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini462 – 875414CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini896 – 90510ExtracellularSequence Analysis
    Topological domaini927 – 94620CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini970 – 98718ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1010 – 102819CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini1051 – 106010ExtracellularSequence Analysis
    Topological domaini1083 – 1243161CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei95 – 11521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei153 – 17321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei391 – 41020HelicalSequence AnalysisAdd
    BLAST
    Transmembranei444 – 46118HelicalSequence AnalysisAdd
    BLAST
    Transmembranei876 – 89520HelicalSequence AnalysisAdd
    BLAST
    Transmembranei906 – 92621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei947 – 96923HelicalSequence AnalysisAdd
    BLAST
    Transmembranei988 – 100922HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1029 – 105022HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1061 – 108222HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1123 – 114018Calmodulin-binding subdomain ABy similarityAdd
    BLAST
    Regioni1141 – 115010Calmodulin-binding subdomain BBy similarity

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi294 – 2974Poly-Glu

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0474.
    HOGENOMiHOG000265623.
    HOVERGENiHBG061286.
    KOiK05850.
    PhylomeDBiP11506.

    Family and domain databases

    Gene3Di1.20.1110.10. 1 hit.
    2.70.150.10. 2 hits.
    3.40.1110.10. 1 hit.
    InterProiIPR022141. ATP_Ca_trans_C.
    IPR006408. ATPase_P-typ_Ca-transp_plasma.
    IPR006068. ATPase_P-typ_cation-transptr_C.
    IPR004014. ATPase_P-typ_cation-transptr_N.
    IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR023298. ATPase_P-typ_TM_dom.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view]
    PfamiPF12424. ATP_Ca_trans_C. 1 hit.
    PF00689. Cation_ATPase_C. 1 hit.
    PF00690. Cation_ATPase_N. 1 hit.
    PF00122. E1-E2_ATPase. 1 hit.
    PF00702. Hydrolase. 1 hit.
    [Graphical view]
    PRINTSiPR00119. CATATPASE.
    SMARTiSM00831. Cation_ATPase_N. 1 hit.
    [Graphical view]
    SUPFAMiSSF56784. SSF56784. 2 hits.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsiTIGR01517. ATPase-IIB_Ca. 1 hit.
    TIGR01494. ATPase_P-type. 3 hits.
    PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view]

    Sequences (14)i

    Sequence statusi: Complete.

    This entry describes 14 isoformsi produced by alternative splicing. Align

    Note: There is a combination of two alternatively spliced domains at N-terminal site A (W, X, Y and Z) and at C-terminal site C (A, B and C). So far the splice sites have only been studied independently. Experimental confirmation may be lacking for some isoforms.

    Isoform 1 (identifier: P11506-13) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGDMTNSDFY SKNQRNESSH GGEFGCSMEE LRSLMELRGT EAVVKIKETY     50
    GDTESICRRL KTSPVEGLPG TAPDLEKRKQ IFGQNFIPPK KPKTFLQLVW 100
    EALQDVTLII LEIAAIISLG LSFYHPPGES NEGCATAQGG AEDEGEAEAG 150
    WIEGAAILLS VICVVLVTAF NDWSKEKQFR GLQSRIEQEQ KFTVVRAGQV 200
    VQIPVAEIVV GDIAQIKYGD LLPADGLFIQ GNDLKIDESS LTGESDQVRK 250
    SVDKDPMLLS GTHVMEGSGR MVVTAVGVNS QTGIIFTLLG AGGEEEEKKD 300
    KKGVKKGDGL QLPAADGAAP ANAAGSANAS LVNGKMQDGS ADSSQSKAKQ 350
    QDGAAAMEMQ PLKSAEGGDA DDKKKANMHK KEKSVLQGKL TKLAVQIGKA 400
    GLVMSAITVI ILVLYFTVDT FVVNKKPWLT ECTPVYVQYF VKFFIIGVTV 450
    LVVAVPEGLP LAVTISLAYS VKKMMKDNNL VRHLDACETM GNATAICSDK 500
    TGTLTTNRMT VVQAYVGDVH YKEIPDPSSI NAKTLELLVN AIAINSAYTT 550
    KILPPEKEGA LPRQVGNKTE CGLLGFVLDL RQDYEPVRSQ MPEEKLYKVY 600
    TFNSVRKSMS TVIKMPDESF RMYSKGASEI VLKKCCKILS GAGEPRVFRP 650
    RDRDEMVKKV IEPMACDGLR TICVAYRDFP SSPEPDWDNE NDILNELTCI 700
    CVVGIEDPVR PEVPEAIRKC QRAGITVRMV TGDNINTARA IAIKCGIIHP 750
    GEDFLCLEGK EFNRRIRNEK GEIEQERIDK IWPKLRVLAR SSPTDKHTLV 800
    KGIIDSTHTE QRQVVAVTGD GTNDGPALKK ADVGFAMGIA GTDVAKEASD 850
    IILTDDNFSS IVKAVMWGRN VYDSISKFLQ FQLTVNVVAV IVAFTGACIT 900
    QDSPLKAVQM LWVNLIMDTF ASLALATEPP TETLLLRKPY GRNKPLISRT 950
    MMKNILGHAV YQLTLIFTLL FVGEKMFQID SGRNAPLHSP PSEHYTIIFN 1000
    TFVMMQLFNE INARKIHGER NVFDGIFRNP IFCTIVLGTF AIQIVIVQFG 1050
    GKPFSCSPLQ LDQWMWCIFI GLGELVWGQV IATIPTSRLK FLKEAGRLTQ 1100
    KEEIPEEELN EDVEEIDHAE RELRRGQILW FRGLNRIQTQ IRVVKAFRSS 1150
    LYEGLEKPES RTSIHNFMAH PEFRIEDSQP HIPLIDDTDL EEDAALKQNS 1200
    SPPSSLNKNN SAIDSGINLT TDTSKSATSS SPGSPIHSLE TSL 1243
    Length:1,243
    Mass (Da):136,811
    Last modified:June 1, 2001 - v2
    Checksum:i1DC324836BFD5D59
    GO
    Isoform WB (identifier: P11506-1) [UniParc]FASTAAdd to Basket

    Also known as: AIIICI

    The sequence of this isoform differs from the canonical sequence as follows:
         1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
         1201-1243: Missing.

    Show »
    Length:1,257
    Mass (Da):138,245
    Checksum:iFA4413080598ABF8
    GO
    Isoform WA (identifier: P11506-2) [UniParc]FASTAAdd to Basket

    Also known as: AIIICII

    The sequence of this isoform differs from the canonical sequence as follows:
         1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

    Show »
    Length:1,199
    Mass (Da):131,552
    Checksum:i702E8C5EE0D003B4
    GO
    Isoform XA (identifier: P11506-3) [UniParc]FASTAAdd to Basket

    Also known as: AIICII

    The sequence of this isoform differs from the canonical sequence as follows:
         303-333: Missing.
         1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

    Show »
    Length:1,168
    Mass (Da):128,764
    Checksum:i6AB32E12491365BB
    GO
    Isoform YA (identifier: P11506-4) [UniParc]FASTAAdd to Basket

    Also known as: AIIICII

    The sequence of this isoform differs from the canonical sequence as follows:
         334-347: Missing.
         1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

    Show »
    Length:1,185
    Mass (Da):130,145
    Checksum:i5D4B80A8A5627C1E
    GO
    Isoform ZA (identifier: P11506-5) [UniParc]FASTAAdd to Basket

    Also known as: AICII

    The sequence of this isoform differs from the canonical sequence as follows:
         303-347: Missing.
         1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

    Show »
    Length:1,154
    Mass (Da):127,357
    Checksum:i22BF0F734827E168
    GO
    Isoform XB (identifier: P11506-6) [UniParc]FASTAAdd to Basket

    Also known as: AIICI

    The sequence of this isoform differs from the canonical sequence as follows:
         303-333: Missing.
         1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
         1201-1243: Missing.

    Show »
    Length:1,226
    Mass (Da):135,457
    Checksum:iC1C8678C84C5A81D
    GO
    Isoform YB (identifier: P11506-7) [UniParc]FASTAAdd to Basket

    Also known as: AIIICI

    The sequence of this isoform differs from the canonical sequence as follows:
         334-347: Missing.
         1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
         1201-1243: Missing.

    Show »
    Length:1,243
    Mass (Da):136,837
    Checksum:iCD227EBA699DEE58
    GO
    Isoform ZB (identifier: P11506-8) [UniParc]FASTAAdd to Basket

    Also known as: AICI

    The sequence of this isoform differs from the canonical sequence as follows:
         303-347: Missing.
         1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
         1201-1243: Missing.

    Show »
    Length:1,212
    Mass (Da):134,049
    Checksum:iD1FFFEB5C78AE637
    GO
    Isoform WC (identifier: P11506-9) [UniParc]FASTAAdd to Basket

    Also known as: AIIICIII

    The sequence of this isoform differs from the canonical sequence as follows:
         1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

    Show »
    Length:1,205
    Mass (Da):132,296
    Checksum:i894D6AD40637CF29
    GO
    Isoform XC (identifier: P11506-10) [UniParc]FASTAAdd to Basket

    Also known as: AIICIII

    The sequence of this isoform differs from the canonical sequence as follows:
         303-333: Missing.
         1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

    Show »
    Length:1,174
    Mass (Da):129,508
    Checksum:i644AC852899E45B4
    GO
    Isoform YC (identifier: P11506-11) [UniParc]FASTAAdd to Basket

    Also known as: AIIICIII

    The sequence of this isoform differs from the canonical sequence as follows:
         334-347: Missing.
         1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

    Show »
    Length:1,191
    Mass (Da):130,889
    Checksum:i8291A1522E47024C
    GO
    Isoform ZC (identifier: P11506-12) [UniParc]FASTAAdd to Basket

    Also known as: AICIII

    The sequence of this isoform differs from the canonical sequence as follows:
         303-347: Missing.
         1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

    Show »
    Length:1,160
    Mass (Da):128,101
    Checksum:i53A179C997F3DDB8
    GO
    Isoform 2 (identifier: P11506-14) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         303-347: Missing.

    Show »
    Length:1,198
    Mass (Da):132,616
    Checksum:i0362C0738CFA439F
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei303 – 34745Missing in isoform 2, isoform ZA, isoform ZB and isoform ZC. 1 PublicationVSP_000388Add
    BLAST
    Alternative sequencei303 – 33331Missing in isoform XA, isoform XB and isoform XC. CuratedVSP_000387Add
    BLAST
    Alternative sequencei334 – 34714Missing in isoform YA, isoform YB and isoform YC. CuratedVSP_000389Add
    BLAST
    Alternative sequencei1141 – 1243103IRVVK…LETSL → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVANLSSPSRVS LSNALSSPTSLPPAAAGQG in isoform WA, isoform XA, isoform YA and isoform ZA. CuratedVSP_000390Add
    BLAST
    Alternative sequencei1141 – 1243103IRVVK…LETSL → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVANLSSPSRVS LSNALSSPTSLPPAAAGHPR REGVP in isoform WC, isoform XC, isoform YC and isoform ZC. CuratedVSP_000391Add
    BLAST
    Alternative sequencei1141 – 11411I → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVASLSSPSRVS LSNALSSPTSLPPAAAGI in isoform WB, isoform XB, isoform YB and isoform ZB. CuratedVSP_038681
    Alternative sequencei1201 – 124343Missing in isoform WB, isoform XB, isoform YB and isoform ZB. CuratedVSP_038682Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    J03754 mRNA. Translation: AAA74219.1.
    AH005430 Genomic DNA. Translation: AAB60703.1.
    PIRiB28065.
    RefSeqiNP_036640.1. NM_012508.5. [P11506-14]
    UniGeneiRn.90982.

    Genome annotation databases

    GeneIDi24215.
    KEGGirno:24215.
    UCSCiRGD:2176. rat. [P11506-13]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    J03754 mRNA. Translation: AAA74219.1 .
    AH005430 Genomic DNA. Translation: AAB60703.1 .
    PIRi B28065.
    RefSeqi NP_036640.1. NM_012508.5. [P11506-14 ]
    UniGenei Rn.90982.

    3D structure databases

    ProteinModelPortali P11506.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 246403. 1 interaction.
    IntActi P11506. 1 interaction.
    MINTi MINT-471009.
    STRINGi 10116.ENSRNOP00000060489.

    PTM databases

    PhosphoSitei P11506.

    Proteomic databases

    PaxDbi P11506.
    PRIDEi P11506.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 24215.
    KEGGi rno:24215.
    UCSCi RGD:2176. rat. [P11506-13 ]

    Organism-specific databases

    CTDi 491.
    RGDi 2176. Atp2b2.

    Phylogenomic databases

    eggNOGi COG0474.
    HOGENOMi HOG000265623.
    HOVERGENi HBG061286.
    KOi K05850.
    PhylomeDBi P11506.

    Miscellaneous databases

    NextBioi 602633.
    PMAP-CutDB P11506.
    PROi P11506.

    Gene expression databases

    Genevestigatori P11506.

    Family and domain databases

    Gene3Di 1.20.1110.10. 1 hit.
    2.70.150.10. 2 hits.
    3.40.1110.10. 1 hit.
    InterProi IPR022141. ATP_Ca_trans_C.
    IPR006408. ATPase_P-typ_Ca-transp_plasma.
    IPR006068. ATPase_P-typ_cation-transptr_C.
    IPR004014. ATPase_P-typ_cation-transptr_N.
    IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR023298. ATPase_P-typ_TM_dom.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view ]
    Pfami PF12424. ATP_Ca_trans_C. 1 hit.
    PF00689. Cation_ATPase_C. 1 hit.
    PF00690. Cation_ATPase_N. 1 hit.
    PF00122. E1-E2_ATPase. 1 hit.
    PF00702. Hydrolase. 1 hit.
    [Graphical view ]
    PRINTSi PR00119. CATATPASE.
    SMARTi SM00831. Cation_ATPase_N. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56784. SSF56784. 2 hits.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsi TIGR01517. ATPase-IIB_Ca. 1 hit.
    TIGR01494. ATPase_P-type. 3 hits.
    PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of two isoforms of the plasma membrane Ca2+-transporting ATPase from rat brain. Structural and functional domains exhibit similarity to Na+,K+- and other cation transport ATPases."
      Shull G.E., Greeb J.
      J. Biol. Chem. 263:8646-8657(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Strain: Sprague-Dawley.
      Tissue: Brain.
    2. "New Ca2+ pump isoforms generated by alternative splicing of rPMCA2 mRNA."
      Adamo H.P., Penniston J.T.
      Biochem. J. 283:355-359(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1083-1243 (ISOFORMS WB/XB/YB/ZB), ALTERNATIVE SPLICING.
    3. "Alternative splicing of exons encoding the calmodulin-binding domains and C termini of plasma membrane Ca(2+)-ATPase isoforms 1, 2, 3, and 4."
      Keeton T.P., Burk S.E., Shull G.E.
      J. Biol. Chem. 268:2740-2748(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1083-1243 (ISOFORMS WB/XB/YB/ZB), ALTERNATIVE SPLICING.
      Strain: Sprague-Dawley.

    Entry informationi

    Entry nameiAT2B2_RAT
    AccessioniPrimary (citable) accession number: P11506
    Secondary accession number(s): Q63443
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1989
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 144 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3