Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P11506 (AT2B2_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 143. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Plasma membrane calcium-transporting ATPase 2

Short name=PMCA2
EC=3.6.3.8
Alternative name(s):
Plasma membrane calcium ATPase isoform 2
Plasma membrane calcium pump isoform 2
Gene names
Name:Atp2b2
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length1243 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.

Catalytic activity

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Subunit structure

Interacts with PDZD11 By similarity.

Subcellular location

Cell membrane; Multi-pass membrane protein.

Tissue specificity

Isoforms containing segment B are found in brain, uterus, liver and kidney and in low levels in other tissues. Isoforms containing segment W are found in kidney, uterus, and pancreas. Isoforms containing segment Y are found in pancreas and in low levels in brain and heart. Isoforms containing segment Z are found in brain and heart and isoforms containing segment X are found in low levels in brain. Isoforms containing segment A are found in low levels in heart and small intestine while isoforms containing segment C are found in testis and in low levels in other tissues.

Sequence similarities

Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIB subfamily. [View classification]

Ontologies

Keywords
   Biological processCalcium transport
Ion transport
Transport
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   LigandATP-binding
Calcium
Calmodulin-binding
Magnesium
Metal-binding
Nucleotide-binding
   Molecular functionHydrolase
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processbrain development

Inferred from expression pattern PubMed 1328526. Source: RGD

calcium ion export

Inferred from mutant phenotype PubMed 22593058. Source: RGD

calcium ion transmembrane transport

Inferred from sequence or structural similarity. Source: GOC

neural retina development

Inferred from expression pattern PubMed 16079002. Source: RGD

neuron differentiation

Inferred from sequence or structural similarity. Source: UniProtKB

sensory perception of sound

Inferred from sequence or structural similarity. Source: UniProtKB

   Cellular_componentapical plasma membrane

Inferred from direct assay PubMed 16763047PubMed 16803870. Source: RGD

cytoplasm

Inferred from sequence or structural similarity. Source: UniProtKB

dendrite

Inferred from direct assay PubMed 16554037. Source: RGD

integral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

membrane raft

Inferred from direct assay PubMed 17596212. Source: RGD

neuronal cell body

Inferred from direct assay PubMed 16554037. Source: RGD

neuronal cell body membrane

Inferred from direct assay PubMed 17596212. Source: RGD

plasma membrane

Inferred from sequence or structural similarity. Source: UniProtKB

   Molecular_functionATP binding

Inferred from direct assay Ref.1. Source: RGD

PDZ domain binding

Inferred from physical interaction PubMed 16554037. Source: RGD

acetylcholine receptor binding

Inferred from direct assay PubMed 22593058. Source: RGD

calcium ion binding

Inferred from sequence or structural similarity. Source: UniProtKB

calcium-transporting ATPase activity

Inferred from direct assay Ref.1. Source: RGD

calmodulin binding

Inferred from sequence or structural similarity. Source: UniProtKB

glutamate receptor binding

Inferred from physical interaction PubMed 19406213. Source: RGD

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

protein C-terminus binding

Inferred from sequence or structural similarity. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 14 isoforms produced by alternative splicing. [Align] [Select]

Note: There is a combination of two alternatively spliced domains at N-terminal site A (W, X, Y and Z) and at C-terminal site C (A, B and C). So far the splice sites have only been studied independently. Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: P11506-13)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform WB (identifier: P11506-1)

Also known as: AIIICI;

The sequence of this isoform differs from the canonical sequence as follows:
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.
Isoform WA (identifier: P11506-2)

Also known as: AIIICII;

The sequence of this isoform differs from the canonical sequence as follows:
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG
Isoform XA (identifier: P11506-3)

Also known as: AIICII;

The sequence of this isoform differs from the canonical sequence as follows:
     303-333: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG
Isoform YA (identifier: P11506-4)

Also known as: AIIICII;

The sequence of this isoform differs from the canonical sequence as follows:
     334-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG
Isoform ZA (identifier: P11506-5)

Also known as: AICII;

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG
Isoform XB (identifier: P11506-6)

Also known as: AIICI;

The sequence of this isoform differs from the canonical sequence as follows:
     303-333: Missing.
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.
Isoform YB (identifier: P11506-7)

Also known as: AIIICI;

The sequence of this isoform differs from the canonical sequence as follows:
     334-347: Missing.
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.
Isoform ZB (identifier: P11506-8)

Also known as: AICI;

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.
Isoform WC (identifier: P11506-9)

Also known as: AIIICIII;

The sequence of this isoform differs from the canonical sequence as follows:
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP
Isoform XC (identifier: P11506-10)

Also known as: AIICIII;

The sequence of this isoform differs from the canonical sequence as follows:
     303-333: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP
Isoform YC (identifier: P11506-11)

Also known as: AIIICIII;

The sequence of this isoform differs from the canonical sequence as follows:
     334-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP
Isoform ZC (identifier: P11506-12)

Also known as: AICIII;

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP
Isoform 2 (identifier: P11506-14)

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 12431243Plasma membrane calcium-transporting ATPase 2
PRO_0000046216

Regions

Topological domain1 – 9494Cytoplasmic Potential
Transmembrane95 – 11521Helical; Potential
Topological domain116 – 15237Extracellular Potential
Transmembrane153 – 17321Helical; Potential
Topological domain174 – 390217Cytoplasmic Potential
Transmembrane391 – 41020Helical; Potential
Topological domain411 – 44333Extracellular Potential
Transmembrane444 – 46118Helical; Potential
Topological domain462 – 875414Cytoplasmic Potential
Transmembrane876 – 89520Helical; Potential
Topological domain896 – 90510Extracellular Potential
Transmembrane906 – 92621Helical; Potential
Topological domain927 – 94620Cytoplasmic Potential
Transmembrane947 – 96923Helical; Potential
Topological domain970 – 98718Extracellular Potential
Transmembrane988 – 100922Helical; Potential
Topological domain1010 – 102819Cytoplasmic Potential
Transmembrane1029 – 105022Helical; Potential
Topological domain1051 – 106010Extracellular Potential
Transmembrane1061 – 108222Helical; Potential
Topological domain1083 – 1243161Cytoplasmic Potential
Region1123 – 114018Calmodulin-binding subdomain A By similarity
Region1141 – 115010Calmodulin-binding subdomain B By similarity
Compositional bias294 – 2974Poly-Glu

Sites

Active site49914-aspartylphosphate intermediate
Metal binding8201Magnesium By similarity
Metal binding8241Magnesium By similarity

Amino acid modifications

Modified residue11391Phosphothreonine; by PKC By similarity
Modified residue12011Phosphoserine; by PKA By similarity

Natural variations

Alternative sequence303 – 34745Missing in isoform 2, isoform ZA, isoform ZB and isoform ZC.
VSP_000388
Alternative sequence303 – 33331Missing in isoform XA, isoform XB and isoform XC.
VSP_000387
Alternative sequence334 – 34714Missing in isoform YA, isoform YB and isoform YC.
VSP_000389
Alternative sequence1141 – 1243103IRVVK…LETSL → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVANLSSPSRVS LSNALSSPTSLPPAAAGQG in isoform WA, isoform XA, isoform YA and isoform ZA.
VSP_000390
Alternative sequence1141 – 1243103IRVVK…LETSL → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVANLSSPSRVS LSNALSSPTSLPPAAAGHPR REGVP in isoform WC, isoform XC, isoform YC and isoform ZC.
VSP_000391
Alternative sequence11411I → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVASLSSPSRVS LSNALSSPTSLPPAAAGI in isoform WB, isoform XB, isoform YB and isoform ZB.
VSP_038681
Alternative sequence1201 – 124343Missing in isoform WB, isoform XB, isoform YB and isoform ZB.
VSP_038682

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 2.
Checksum: 1DC324836BFD5D59

FASTA1,243136,811
        10         20         30         40         50         60 
MGDMTNSDFY SKNQRNESSH GGEFGCSMEE LRSLMELRGT EAVVKIKETY GDTESICRRL 

        70         80         90        100        110        120 
KTSPVEGLPG TAPDLEKRKQ IFGQNFIPPK KPKTFLQLVW EALQDVTLII LEIAAIISLG 

       130        140        150        160        170        180 
LSFYHPPGES NEGCATAQGG AEDEGEAEAG WIEGAAILLS VICVVLVTAF NDWSKEKQFR 

       190        200        210        220        230        240 
GLQSRIEQEQ KFTVVRAGQV VQIPVAEIVV GDIAQIKYGD LLPADGLFIQ GNDLKIDESS 

       250        260        270        280        290        300 
LTGESDQVRK SVDKDPMLLS GTHVMEGSGR MVVTAVGVNS QTGIIFTLLG AGGEEEEKKD 

       310        320        330        340        350        360 
KKGVKKGDGL QLPAADGAAP ANAAGSANAS LVNGKMQDGS ADSSQSKAKQ QDGAAAMEMQ 

       370        380        390        400        410        420 
PLKSAEGGDA DDKKKANMHK KEKSVLQGKL TKLAVQIGKA GLVMSAITVI ILVLYFTVDT 

       430        440        450        460        470        480 
FVVNKKPWLT ECTPVYVQYF VKFFIIGVTV LVVAVPEGLP LAVTISLAYS VKKMMKDNNL 

       490        500        510        520        530        540 
VRHLDACETM GNATAICSDK TGTLTTNRMT VVQAYVGDVH YKEIPDPSSI NAKTLELLVN 

       550        560        570        580        590        600 
AIAINSAYTT KILPPEKEGA LPRQVGNKTE CGLLGFVLDL RQDYEPVRSQ MPEEKLYKVY 

       610        620        630        640        650        660 
TFNSVRKSMS TVIKMPDESF RMYSKGASEI VLKKCCKILS GAGEPRVFRP RDRDEMVKKV 

       670        680        690        700        710        720 
IEPMACDGLR TICVAYRDFP SSPEPDWDNE NDILNELTCI CVVGIEDPVR PEVPEAIRKC 

       730        740        750        760        770        780 
QRAGITVRMV TGDNINTARA IAIKCGIIHP GEDFLCLEGK EFNRRIRNEK GEIEQERIDK 

       790        800        810        820        830        840 
IWPKLRVLAR SSPTDKHTLV KGIIDSTHTE QRQVVAVTGD GTNDGPALKK ADVGFAMGIA 

       850        860        870        880        890        900 
GTDVAKEASD IILTDDNFSS IVKAVMWGRN VYDSISKFLQ FQLTVNVVAV IVAFTGACIT 

       910        920        930        940        950        960 
QDSPLKAVQM LWVNLIMDTF ASLALATEPP TETLLLRKPY GRNKPLISRT MMKNILGHAV 

       970        980        990       1000       1010       1020 
YQLTLIFTLL FVGEKMFQID SGRNAPLHSP PSEHYTIIFN TFVMMQLFNE INARKIHGER 

      1030       1040       1050       1060       1070       1080 
NVFDGIFRNP IFCTIVLGTF AIQIVIVQFG GKPFSCSPLQ LDQWMWCIFI GLGELVWGQV 

      1090       1100       1110       1120       1130       1140 
IATIPTSRLK FLKEAGRLTQ KEEIPEEELN EDVEEIDHAE RELRRGQILW FRGLNRIQTQ 

      1150       1160       1170       1180       1190       1200 
IRVVKAFRSS LYEGLEKPES RTSIHNFMAH PEFRIEDSQP HIPLIDDTDL EEDAALKQNS 

      1210       1220       1230       1240 
SPPSSLNKNN SAIDSGINLT TDTSKSATSS SPGSPIHSLE TSL 

« Hide

Isoform WB (AIIICI) [UniParc].

Checksum: FA4413080598ABF8
Show »

FASTA1,257138,245
Isoform WA (AIIICII) [UniParc].

Checksum: 702E8C5EE0D003B4
Show »

FASTA1,199131,552
Isoform XA (AIICII) [UniParc].

Checksum: 6AB32E12491365BB
Show »

FASTA1,168128,764
Isoform YA (AIIICII) [UniParc].

Checksum: 5D4B80A8A5627C1E
Show »

FASTA1,185130,145
Isoform ZA (AICII) [UniParc].

Checksum: 22BF0F734827E168
Show »

FASTA1,154127,357
Isoform XB (AIICI) [UniParc].

Checksum: C1C8678C84C5A81D
Show »

FASTA1,226135,457
Isoform YB (AIIICI) [UniParc].

Checksum: CD227EBA699DEE58
Show »

FASTA1,243136,837
Isoform ZB (AICI) [UniParc].

Checksum: D1FFFEB5C78AE637
Show »

FASTA1,212134,049
Isoform WC (AIIICIII) [UniParc].

Checksum: 894D6AD40637CF29
Show »

FASTA1,205132,296
Isoform XC (AIICIII) [UniParc].

Checksum: 644AC852899E45B4
Show »

FASTA1,174129,508
Isoform YC (AIIICIII) [UniParc].

Checksum: 8291A1522E47024C
Show »

FASTA1,191130,889
Isoform ZC (AICIII) [UniParc].

Checksum: 53A179C997F3DDB8
Show »

FASTA1,160128,101
Isoform 2 [UniParc].

Checksum: 0362C0738CFA439F
Show »

FASTA1,198132,616

References

[1]"Molecular cloning of two isoforms of the plasma membrane Ca2+-transporting ATPase from rat brain. Structural and functional domains exhibit similarity to Na+,K+- and other cation transport ATPases."
Shull G.E., Greeb J.
J. Biol. Chem. 263:8646-8657(1988) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Strain: Sprague-Dawley.
Tissue: Brain.
[2]"New Ca2+ pump isoforms generated by alternative splicing of rPMCA2 mRNA."
Adamo H.P., Penniston J.T.
Biochem. J. 283:355-359(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1083-1243 (ISOFORMS WB/XB/YB/ZB), ALTERNATIVE SPLICING.
[3]"Alternative splicing of exons encoding the calmodulin-binding domains and C termini of plasma membrane Ca(2+)-ATPase isoforms 1, 2, 3, and 4."
Keeton T.P., Burk S.E., Shull G.E.
J. Biol. Chem. 268:2740-2748(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1083-1243 (ISOFORMS WB/XB/YB/ZB), ALTERNATIVE SPLICING.
Strain: Sprague-Dawley.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
J03754 mRNA. Translation: AAA74219.1.
AH005430 Genomic DNA. Translation: AAB60703.1.
PIRB28065.
RefSeqNP_036640.1. NM_012508.5. [P11506-14]
UniGeneRn.90982.

3D structure databases

ProteinModelPortalP11506.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid246403. 1 interaction.
IntActP11506. 1 interaction.
MINTMINT-471009.
STRING10116.ENSRNOP00000060489.

PTM databases

PhosphoSiteP11506.

Proteomic databases

PaxDbP11506.
PRIDEP11506.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID24215.
KEGGrno:24215.
UCSCRGD:2176. rat. [P11506-13]

Organism-specific databases

CTD491.
RGD2176. Atp2b2.

Phylogenomic databases

eggNOGCOG0474.
HOGENOMHOG000265623.
HOVERGENHBG061286.
KOK05850.
PhylomeDBP11506.

Gene expression databases

GenevestigatorP11506.

Family and domain databases

Gene3D1.20.1110.10. 1 hit.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProIPR022141. ATP_Ca_trans_C.
IPR006408. ATPase_P-typ_Ca-transp_plasma.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view]
PfamPF12424. ATP_Ca_trans_C. 1 hit.
PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSPR00119. CATATPASE.
SMARTSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMSSF56784. SSF56784. 2 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsTIGR01517. ATPase-IIB_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio602633.
PMAP-CutDBP11506.
PROP11506.

Entry information

Entry nameAT2B2_RAT
AccessionPrimary (citable) accession number: P11506
Secondary accession number(s): Q63443
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: June 1, 2001
Last modified: May 14, 2014
This is version 143 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families