Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Plasma membrane calcium-transporting ATPase 2

Gene

Atp2b2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei499 – 49914-aspartylphosphate intermediate
Metal bindingi820 – 8201MagnesiumBy similarity
Metal bindingi824 – 8241MagnesiumBy similarity

GO - Molecular functioni

  1. acetylcholine receptor binding Source: RGD
  2. ATP binding Source: RGD
  3. calcium ion binding Source: UniProtKB
  4. calcium-transporting ATPase activity Source: RGD
  5. calmodulin binding Source: UniProtKB
  6. glutamate receptor binding Source: RGD
  7. metal ion binding Source: UniProtKB-KW
  8. PDZ domain binding Source: RGD
  9. protein C-terminus binding Source: UniProtKB

GO - Biological processi

  1. brain development Source: RGD
  2. calcium ion export Source: RGD
  3. calcium ion transmembrane transport Source: GOC
  4. neural retina development Source: RGD
  5. neuron differentiation Source: UniProtKB
  6. sensory perception of sound Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Calmodulin-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi3.6.3.8. 5301.

Names & Taxonomyi

Protein namesi
Recommended name:
Plasma membrane calcium-transporting ATPase 2 (EC:3.6.3.8)
Short name:
PMCA2
Alternative name(s):
Plasma membrane calcium ATPase isoform 2
Plasma membrane calcium pump isoform 2
Gene namesi
Name:Atp2b2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494 Componenti: Unplaced

Organism-specific databases

RGDi2176. Atp2b2.

Subcellular locationi

Cell junctionsynapse By similarity. Cell membrane Sequence Analysis; Multi-pass membrane protein Sequence Analysis

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini2 – 9493CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei95 – 11521HelicalSequence AnalysisAdd
BLAST
Topological domaini116 – 15237ExtracellularSequence AnalysisAdd
BLAST
Transmembranei153 – 17321HelicalSequence AnalysisAdd
BLAST
Topological domaini174 – 390217CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei391 – 41020HelicalSequence AnalysisAdd
BLAST
Topological domaini411 – 44333ExtracellularSequence AnalysisAdd
BLAST
Transmembranei444 – 46118HelicalSequence AnalysisAdd
BLAST
Topological domaini462 – 875414CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei876 – 89520HelicalSequence AnalysisAdd
BLAST
Topological domaini896 – 90510ExtracellularSequence Analysis
Transmembranei906 – 92621HelicalSequence AnalysisAdd
BLAST
Topological domaini927 – 94620CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei947 – 96923HelicalSequence AnalysisAdd
BLAST
Topological domaini970 – 98718ExtracellularSequence AnalysisAdd
BLAST
Transmembranei988 – 100922HelicalSequence AnalysisAdd
BLAST
Topological domaini1010 – 102819CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei1029 – 105022HelicalSequence AnalysisAdd
BLAST
Topological domaini1051 – 106010ExtracellularSequence Analysis
Transmembranei1061 – 108222HelicalSequence AnalysisAdd
BLAST
Topological domaini1083 – 1243161CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. apical plasma membrane Source: RGD
  2. cell junction Source: UniProtKB-KW
  3. cytoplasm Source: UniProtKB
  4. dendrite Source: RGD
  5. integral component of membrane Source: UniProtKB-KW
  6. membrane raft Source: RGD
  7. neuronal cell body Source: RGD
  8. neuronal cell body membrane Source: RGD
  9. plasma membrane Source: UniProtKB
  10. synapse Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 12431242Plasma membrane calcium-transporting ATPase 2PRO_0000046216Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylglycineBy similarity
Modified residuei364 – 3641PhosphoserineBy similarity
Modified residuei1139 – 11391Phosphothreonine; by PKCBy similarity
Modified residuei1178 – 11781PhosphoserineBy similarity
Modified residuei1188 – 11881PhosphothreonineBy similarity
Modified residuei1201 – 12011Phosphoserine; by PKABy similarity
Modified residuei1205 – 12051PhosphoserineBy similarity
Modified residuei1211 – 12111PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiP11506.
PRIDEiP11506.

PTM databases

PhosphoSiteiP11506.

Miscellaneous databases

PMAP-CutDBP11506.

Expressioni

Tissue specificityi

Isoforms containing segment B are found in brain, uterus, liver and kidney and in low levels in other tissues. Isoforms containing segment W are found in kidney, uterus, and pancreas. Isoforms containing segment Y are found in pancreas and in low levels in brain and heart. Isoforms containing segment Z are found in brain and heart and isoforms containing segment X are found in low levels in brain. Isoforms containing segment A are found in low levels in heart and small intestine while isoforms containing segment C are found in testis and in low levels in other tissues.

Gene expression databases

GenevestigatoriP11506.

Interactioni

Subunit structurei

Interacts with PDZD11.By similarity

Protein-protein interaction databases

BioGridi246403. 1 interaction.
IntActiP11506. 1 interaction.
MINTiMINT-471009.
STRINGi10116.ENSRNOP00000060489.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1123 – 114018Calmodulin-binding subdomain ABy similarityAdd
BLAST
Regioni1141 – 115010Calmodulin-binding subdomain BBy similarity

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi294 – 2974Poly-Glu

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0474.
HOGENOMiHOG000265623.
HOVERGENiHBG061286.
InParanoidiP11506.
KOiK05850.
PhylomeDBiP11506.

Family and domain databases

Gene3Di1.20.1110.10. 1 hit.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR030322. ATP2B2.
IPR022141. ATP_Ca_trans_C.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR006408. P-type_ATPase_IIB.
IPR001757. P_typ_ATPase.
[Graphical view]
PANTHERiPTHR24093:SF247. PTHR24093:SF247. 1 hit.
PfamiPF12424. ATP_Ca_trans_C. 1 hit.
PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 2 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01517. ATPase-IIB_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (14)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 14 isoformsi produced by alternative splicing. AlignAdd to basket

Note: There is a combination of two alternatively spliced domains at N-terminal site A (W, X, Y and Z) and at C-terminal site C (A, B and C). So far the splice sites have only been studied independently. Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: P11506-13) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGDMTNSDFY SKNQRNESSH GGEFGCSMEE LRSLMELRGT EAVVKIKETY
60 70 80 90 100
GDTESICRRL KTSPVEGLPG TAPDLEKRKQ IFGQNFIPPK KPKTFLQLVW
110 120 130 140 150
EALQDVTLII LEIAAIISLG LSFYHPPGES NEGCATAQGG AEDEGEAEAG
160 170 180 190 200
WIEGAAILLS VICVVLVTAF NDWSKEKQFR GLQSRIEQEQ KFTVVRAGQV
210 220 230 240 250
VQIPVAEIVV GDIAQIKYGD LLPADGLFIQ GNDLKIDESS LTGESDQVRK
260 270 280 290 300
SVDKDPMLLS GTHVMEGSGR MVVTAVGVNS QTGIIFTLLG AGGEEEEKKD
310 320 330 340 350
KKGVKKGDGL QLPAADGAAP ANAAGSANAS LVNGKMQDGS ADSSQSKAKQ
360 370 380 390 400
QDGAAAMEMQ PLKSAEGGDA DDKKKANMHK KEKSVLQGKL TKLAVQIGKA
410 420 430 440 450
GLVMSAITVI ILVLYFTVDT FVVNKKPWLT ECTPVYVQYF VKFFIIGVTV
460 470 480 490 500
LVVAVPEGLP LAVTISLAYS VKKMMKDNNL VRHLDACETM GNATAICSDK
510 520 530 540 550
TGTLTTNRMT VVQAYVGDVH YKEIPDPSSI NAKTLELLVN AIAINSAYTT
560 570 580 590 600
KILPPEKEGA LPRQVGNKTE CGLLGFVLDL RQDYEPVRSQ MPEEKLYKVY
610 620 630 640 650
TFNSVRKSMS TVIKMPDESF RMYSKGASEI VLKKCCKILS GAGEPRVFRP
660 670 680 690 700
RDRDEMVKKV IEPMACDGLR TICVAYRDFP SSPEPDWDNE NDILNELTCI
710 720 730 740 750
CVVGIEDPVR PEVPEAIRKC QRAGITVRMV TGDNINTARA IAIKCGIIHP
760 770 780 790 800
GEDFLCLEGK EFNRRIRNEK GEIEQERIDK IWPKLRVLAR SSPTDKHTLV
810 820 830 840 850
KGIIDSTHTE QRQVVAVTGD GTNDGPALKK ADVGFAMGIA GTDVAKEASD
860 870 880 890 900
IILTDDNFSS IVKAVMWGRN VYDSISKFLQ FQLTVNVVAV IVAFTGACIT
910 920 930 940 950
QDSPLKAVQM LWVNLIMDTF ASLALATEPP TETLLLRKPY GRNKPLISRT
960 970 980 990 1000
MMKNILGHAV YQLTLIFTLL FVGEKMFQID SGRNAPLHSP PSEHYTIIFN
1010 1020 1030 1040 1050
TFVMMQLFNE INARKIHGER NVFDGIFRNP IFCTIVLGTF AIQIVIVQFG
1060 1070 1080 1090 1100
GKPFSCSPLQ LDQWMWCIFI GLGELVWGQV IATIPTSRLK FLKEAGRLTQ
1110 1120 1130 1140 1150
KEEIPEEELN EDVEEIDHAE RELRRGQILW FRGLNRIQTQ IRVVKAFRSS
1160 1170 1180 1190 1200
LYEGLEKPES RTSIHNFMAH PEFRIEDSQP HIPLIDDTDL EEDAALKQNS
1210 1220 1230 1240
SPPSSLNKNN SAIDSGINLT TDTSKSATSS SPGSPIHSLE TSL
Length:1,243
Mass (Da):136,811
Last modified:June 1, 2001 - v2
Checksum:i1DC324836BFD5D59
GO
Isoform WB (identifier: P11506-1) [UniParc]FASTAAdd to basket

Also known as: AIIICI

The sequence of this isoform differs from the canonical sequence as follows:
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.

Show »
Length:1,257
Mass (Da):138,245
Checksum:iFA4413080598ABF8
GO
Isoform WA (identifier: P11506-2) [UniParc]FASTAAdd to basket

Also known as: AIIICII

The sequence of this isoform differs from the canonical sequence as follows:
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

Show »
Length:1,199
Mass (Da):131,552
Checksum:i702E8C5EE0D003B4
GO
Isoform XA (identifier: P11506-3) [UniParc]FASTAAdd to basket

Also known as: AIICII

The sequence of this isoform differs from the canonical sequence as follows:
     303-333: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

Show »
Length:1,168
Mass (Da):128,764
Checksum:i6AB32E12491365BB
GO
Isoform YA (identifier: P11506-4) [UniParc]FASTAAdd to basket

Also known as: AIIICII

The sequence of this isoform differs from the canonical sequence as follows:
     334-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

Show »
Length:1,185
Mass (Da):130,145
Checksum:i5D4B80A8A5627C1E
GO
Isoform ZA (identifier: P11506-5) [UniParc]FASTAAdd to basket

Also known as: AICII

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...SLPPAAAGQG

Show »
Length:1,154
Mass (Da):127,357
Checksum:i22BF0F734827E168
GO
Isoform XB (identifier: P11506-6) [UniParc]FASTAAdd to basket

Also known as: AIICI

The sequence of this isoform differs from the canonical sequence as follows:
     303-333: Missing.
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.

Show »
Length:1,226
Mass (Da):135,457
Checksum:iC1C8678C84C5A81D
GO
Isoform YB (identifier: P11506-7) [UniParc]FASTAAdd to basket

Also known as: AIIICI

The sequence of this isoform differs from the canonical sequence as follows:
     334-347: Missing.
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.

Show »
Length:1,243
Mass (Da):136,837
Checksum:iCD227EBA699DEE58
GO
Isoform ZB (identifier: P11506-8) [UniParc]FASTAAdd to basket

Also known as: AICI

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.
     1141-1141: I → IEVVNTFKSGASFQGALRRQSSVTSQSQDVASLSSPSRVSLSNALSSPTSLPPAAAGI
     1201-1243: Missing.

Show »
Length:1,212
Mass (Da):134,049
Checksum:iD1FFFEB5C78AE637
GO
Isoform WC (identifier: P11506-9) [UniParc]FASTAAdd to basket

Also known as: AIIICIII

The sequence of this isoform differs from the canonical sequence as follows:
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

Show »
Length:1,205
Mass (Da):132,296
Checksum:i894D6AD40637CF29
GO
Isoform XC (identifier: P11506-10) [UniParc]FASTAAdd to basket

Also known as: AIICIII

The sequence of this isoform differs from the canonical sequence as follows:
     303-333: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

Show »
Length:1,174
Mass (Da):129,508
Checksum:i644AC852899E45B4
GO
Isoform YC (identifier: P11506-11) [UniParc]FASTAAdd to basket

Also known as: AIIICIII

The sequence of this isoform differs from the canonical sequence as follows:
     334-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

Show »
Length:1,191
Mass (Da):130,889
Checksum:i8291A1522E47024C
GO
Isoform ZC (identifier: P11506-12) [UniParc]FASTAAdd to basket

Also known as: AICIII

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.
     1141-1243: IRVVKAFRSS...SPIHSLETSL → IEVVNTFKSG...AGHPRREGVP

Show »
Length:1,160
Mass (Da):128,101
Checksum:i53A179C997F3DDB8
GO
Isoform 2 (identifier: P11506-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     303-347: Missing.

Show »
Length:1,198
Mass (Da):132,616
Checksum:i0362C0738CFA439F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei303 – 34745Missing in isoform 2, isoform ZA, isoform ZB and isoform ZC. 1 PublicationVSP_000388Add
BLAST
Alternative sequencei303 – 33331Missing in isoform XA, isoform XB and isoform XC. CuratedVSP_000387Add
BLAST
Alternative sequencei334 – 34714Missing in isoform YA, isoform YB and isoform YC. CuratedVSP_000389Add
BLAST
Alternative sequencei1141 – 1243103IRVVK…LETSL → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVANLSSPSRVS LSNALSSPTSLPPAAAGQG in isoform WA, isoform XA, isoform YA and isoform ZA. CuratedVSP_000390Add
BLAST
Alternative sequencei1141 – 1243103IRVVK…LETSL → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVANLSSPSRVS LSNALSSPTSLPPAAAGHPR REGVP in isoform WC, isoform XC, isoform YC and isoform ZC. CuratedVSP_000391Add
BLAST
Alternative sequencei1141 – 11411I → IEVVNTFKSGASFQGALRRQ SSVTSQSQDVASLSSPSRVS LSNALSSPTSLPPAAAGI in isoform WB, isoform XB, isoform YB and isoform ZB. CuratedVSP_038681
Alternative sequencei1201 – 124343Missing in isoform WB, isoform XB, isoform YB and isoform ZB. CuratedVSP_038682Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J03754 mRNA. Translation: AAA74219.1.
AH005430 Genomic DNA. Translation: AAB60703.1.
PIRiB28065.
RefSeqiNP_036640.1. NM_012508.5. [P11506-14]
UniGeneiRn.90982.

Genome annotation databases

GeneIDi24215.
KEGGirno:24215.
UCSCiRGD:2176. rat. [P11506-13]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J03754 mRNA. Translation: AAA74219.1.
AH005430 Genomic DNA. Translation: AAB60703.1.
PIRiB28065.
RefSeqiNP_036640.1. NM_012508.5. [P11506-14]
UniGeneiRn.90982.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi246403. 1 interaction.
IntActiP11506. 1 interaction.
MINTiMINT-471009.
STRINGi10116.ENSRNOP00000060489.

PTM databases

PhosphoSiteiP11506.

Proteomic databases

PaxDbiP11506.
PRIDEiP11506.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi24215.
KEGGirno:24215.
UCSCiRGD:2176. rat. [P11506-13]

Organism-specific databases

CTDi491.
RGDi2176. Atp2b2.

Phylogenomic databases

eggNOGiCOG0474.
HOGENOMiHOG000265623.
HOVERGENiHBG061286.
InParanoidiP11506.
KOiK05850.
PhylomeDBiP11506.

Enzyme and pathway databases

BRENDAi3.6.3.8. 5301.

Miscellaneous databases

NextBioi602633.
PMAP-CutDBP11506.
PROiP11506.

Gene expression databases

GenevestigatoriP11506.

Family and domain databases

Gene3Di1.20.1110.10. 1 hit.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR030322. ATP2B2.
IPR022141. ATP_Ca_trans_C.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR006408. P-type_ATPase_IIB.
IPR001757. P_typ_ATPase.
[Graphical view]
PANTHERiPTHR24093:SF247. PTHR24093:SF247. 1 hit.
PfamiPF12424. ATP_Ca_trans_C. 1 hit.
PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 2 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01517. ATPase-IIB_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Molecular cloning of two isoforms of the plasma membrane Ca2+-transporting ATPase from rat brain. Structural and functional domains exhibit similarity to Na+,K+- and other cation transport ATPases."
    Shull G.E., Greeb J.
    J. Biol. Chem. 263:8646-8657(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: Sprague-Dawley.
    Tissue: Brain.
  2. "New Ca2+ pump isoforms generated by alternative splicing of rPMCA2 mRNA."
    Adamo H.P., Penniston J.T.
    Biochem. J. 283:355-359(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1083-1243 (ISOFORMS WB/XB/YB/ZB), ALTERNATIVE SPLICING.
  3. "Alternative splicing of exons encoding the calmodulin-binding domains and C termini of plasma membrane Ca(2+)-ATPase isoforms 1, 2, 3, and 4."
    Keeton T.P., Burk S.E., Shull G.E.
    J. Biol. Chem. 268:2740-2748(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1083-1243 (ISOFORMS WB/XB/YB/ZB), ALTERNATIVE SPLICING.
    Strain: Sprague-Dawley.

Entry informationi

Entry nameiAT2B2_RAT
AccessioniPrimary (citable) accession number: P11506
Secondary accession number(s): Q63443
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: June 1, 2001
Last modified: April 1, 2015
This is version 148 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.