Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vitamin D3 receptor

Gene

VDR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Nuclear hormone receptor. Transcription factor that mediates the action of vitamin D3 by controlling the expression of hormone sensitive genes. Recruited to promoters via its interaction with BAZ1B/WSTF which mediates the interaction with acetylated histones, an essential step for VDR-promoter association. Plays a central role in calcium homeostasis.4 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei143Vitamin D31
Binding sitei305Vitamin D31
Binding sitei397Vitamin D31

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi21 – 96Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
Zinc fingeri24 – 44NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri60 – 84NR C4-typePROSITE-ProRule annotationAdd BLAST25

GO - Molecular functioni

  • calcitriol binding Source: UniProtKB
  • calcitriol receptor activity Source: UniProtKB
  • DNA binding Source: MGI
  • lithocholic acid binding Source: UniProtKB
  • lithocholic acid receptor activity Source: UniProtKB
  • retinoid X receptor binding Source: BHF-UCL
  • sequence-specific DNA binding Source: InterPro
  • steroid hormone receptor activity Source: InterPro
  • zinc ion binding Source: InterPro

GO - Biological processi

  • bile acid signaling pathway Source: UniProtKB
  • calcium ion transport Source: Ensembl
  • cell morphogenesis Source: UniProtKB
  • cellular calcium ion homeostasis Source: Ensembl
  • decidualization Source: BHF-UCL
  • intestinal absorption Source: Ensembl
  • lactation Source: Ensembl
  • mammary gland branching involved in pregnancy Source: Ensembl
  • negative regulation of cell proliferation Source: BHF-UCL
  • negative regulation of keratinocyte proliferation Source: UniProtKB
  • negative regulation of transcription, DNA-templated Source: MGI
  • negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  • positive regulation of apoptotic process involved in mammary gland involution Source: Ensembl
  • positive regulation of gene expression Source: UniProtKB
  • positive regulation of keratinocyte differentiation Source: UniProtKB
  • positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • positive regulation of vitamin D 24-hydroxylase activity Source: BHF-UCL
  • regulation of calcidiol 1-monooxygenase activity Source: BHF-UCL
  • signal transduction Source: ProtInc
  • skeletal system development Source: Ensembl
  • transcription initiation from RNA polymerase II promoter Source: Reactome
  • vitamin D receptor signaling pathway Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000111424-MONOMER.
ReactomeiR-HSA-383280. Nuclear Receptor transcription pathway.
SignaLinkiP11473.
SIGNORiP11473.

Protein family/group databases

TCDBi9.B.208.1.1. the vitamin d3 receptor (vdr) family.

Chemistry databases

SwissLipidsiSLP:000001571.

Names & Taxonomyi

Protein namesi
Recommended name:
Vitamin D3 receptor
Short name:
VDR
Alternative name(s):
1,25-dihydroxyvitamin D3 receptor
Nuclear receptor subfamily 1 group I member 1
Gene namesi
Name:VDR
Synonyms:NR1I1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:12679. VDR.

Subcellular locationi

GO - Cellular componenti

  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • receptor complex Source: BHF-UCL
  • RNA polymerase II transcription factor complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Rickets vitamin D-dependent 2A (VDDR2A)10 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder of vitamin D metabolism resulting in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets.
See also OMIM:277440
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_00465633G → D in VDDR2A. 1 PublicationCorresponds to variant rs121909790dbSNPEnsembl.1
Natural variantiVAR_00465735H → Q in VDDR2A. 1 Publication1
Natural variantiVAR_00465845K → E in VDDR2A. 1 Publication1
Natural variantiVAR_00465946G → D in VDDR2A. 1 PublicationCorresponds to variant rs121909797dbSNPEnsembl.1
Natural variantiVAR_00466047F → I in VDDR2A. 1 Publication1
Natural variantiVAR_00466150R → Q in VDDR2A. 1 PublicationCorresponds to variant rs121909794dbSNPEnsembl.1
Natural variantiVAR_00466273R → Q in VDDR2A. 1 PublicationCorresponds to variant rs121909791dbSNPEnsembl.1
Natural variantiVAR_00466380R → Q in VDDR2A. 2 PublicationsCorresponds to variant rs121909793dbSNPEnsembl.1
Natural variantiVAR_004664274R → L in VDDR2A; decreases affinity for ligand by a factor of 1000. 1 PublicationCorresponds to variant rs121909796dbSNPEnsembl.1
Natural variantiVAR_004665305H → Q in VDDR2A. 1 PublicationCorresponds to variant rs121909798dbSNPEnsembl.1
Natural variantiVAR_004666314I → S in VDDR2A. 1 PublicationCorresponds to variant rs121909799dbSNPEnsembl.1
Natural variantiVAR_004667391R → C in VDDR2A. 1 PublicationCorresponds to variant rs121909800dbSNPEnsembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi61 – 62PF → AA: Promotes heterodimerization with RXRA; when associated with A-75. 1 Publication2
Mutagenesisi75H → A: Promotes heterodimerization with RXRA; when associated with A-61 and A-62. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi7421.
MalaCardsiVDR.
MIMi277440. phenotype.
607948. phenotype.
OpenTargetsiENSG00000111424.
Orphaneti93160. Hypocalcemic vitamin D-resistant rickets.
PharmGKBiPA37301.

Chemistry databases

ChEMBLiCHEMBL1977.
DrugBankiDB01436. Alfacalcidol.
DB00146. Calcidiol.
DB02300. Calcipotriol.
DB00136. Calcitriol.
DB00169. Cholecalciferol.
DB01070. Dihydrotachysterol.
DB06410. Doxercalciferol.
DB00153. Ergocalciferol.
DB00910. Paricalcitol.
GuidetoPHARMACOLOGYi605.

Polymorphism and mutation databases

BioMutaiVDR.
DMDMi137617.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000535421 – 427Vitamin D3 receptorAdd BLAST427

Proteomic databases

MaxQBiP11473.
PaxDbiP11473.
PeptideAtlasiP11473.
PRIDEiP11473.

PTM databases

iPTMnetiP11473.
PhosphoSitePlusiP11473.

Expressioni

Gene expression databases

BgeeiENSG00000111424.
CleanExiHS_VDR.
ExpressionAtlasiP11473. baseline and differential.
GenevisibleiP11473. HS.

Organism-specific databases

HPAiCAB004617.
HPA047740.

Interactioni

Subunit structurei

Homodimer in the absence of bound vitamin D3. Heterodimer with RXRA after vitamin D3 binding. Interacts with SMAD3. Interacts with MED1, NCOA1, NCOA2, NCOA3 and NCOA6 coactivators, leading to a strong increase of transcription of target genes. Interacts (in a ligand-dependent manner) with BAZ1B/WSTF. Interacts with SNW1. Interacts with IRX4, the interaction doesn't affect its transactivation activity.9 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
EP300Q094723EBI-286357,EBI-447295
Ncoa6Q9JLI42EBI-286357,EBI-286271From a different organism.
PTPN3P260454EBI-286357,EBI-1047946
SNW1Q135735EBI-286357,EBI-632715
TP53P046376EBI-286357,EBI-366083

GO - Molecular functioni

  • retinoid X receptor binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi113264. 92 interactors.
DIPiDIP-32624N.
IntActiP11473. 19 interactors.
MINTiMINT-236408.
STRINGi9606.ENSP00000447173.

Chemistry databases

BindingDBiP11473.

Structurei

Secondary structure

1427
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni25 – 27Combined sources3
Beta strandi33 – 35Combined sources3
Beta strandi38 – 40Combined sources3
Helixi42 – 53Combined sources12
Beta strandi61 – 64Combined sources4
Turni70 – 75Combined sources6
Helixi77 – 86Combined sources10
Helixi91 – 93Combined sources3
Helixi97 – 107Combined sources11
Beta strandi108 – 110Combined sources3
Turni111 – 113Combined sources3
Helixi115 – 119Combined sources5
Helixi126 – 142Combined sources17
Helixi150 – 152Combined sources3
Helixi217 – 223Combined sources7
Helixi227 – 247Combined sources21
Helixi251 – 253Combined sources3
Helixi256 – 274Combined sources19
Helixi275 – 277Combined sources3
Turni281 – 284Combined sources4
Beta strandi285 – 287Combined sources3
Helixi291 – 293Combined sources3
Helixi297 – 301Combined sources5
Turni302 – 304Combined sources3
Helixi307 – 321Combined sources15
Turni322 – 324Combined sources3
Helixi327 – 338Combined sources12
Beta strandi341 – 343Combined sources3
Helixi349 – 370Combined sources22
Turni373 – 378Combined sources6
Helixi379 – 404Combined sources26
Helixi410 – 413Combined sources4
Helixi416 – 422Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1DB1X-ray1.80A118-427[»]
1IE8X-ray1.52A118-427[»]
1IE9X-ray1.40A118-427[»]
1KB2X-ray2.70A/B16-125[»]
1KB4X-ray2.80A/B16-125[»]
1KB6X-ray2.70A/B16-125[»]
1S0ZX-ray2.50A118-427[»]
1S19X-ray2.10A118-427[»]
1TXIX-ray1.90A118-427[»]
1YNWX-ray3.00A16-125[»]
2HAMX-ray1.90A118-427[»]
2HARX-ray1.90A118-427[»]
2HASX-ray1.96A118-427[»]
2HB7X-ray1.80A118-427[»]
2HB8X-ray2.00A118-427[»]
3A2IX-ray3.27A118-427[»]
3A2JX-ray2.70A118-427[»]
3A3ZX-ray1.72X118-427[»]
3A40X-ray1.45X118-427[»]
3A78X-ray1.90A118-427[»]
3AUQX-ray2.64A118-427[»]
3AURX-ray2.21A118-427[»]
3AX8X-ray2.60A118-427[»]
3AZ1X-ray1.50A120-423[»]
3AZ2X-ray1.69A120-423[»]
3AZ3X-ray1.36A120-423[»]
3B0TX-ray1.30A120-423[»]
3CS4X-ray2.00A118-427[»]
3CS6X-ray1.80A118-427[»]
3KPZX-ray1.90A118-427[»]
3M7RX-ray1.80A120-423[»]
3OGTX-ray1.75A118-427[»]
3P8XX-ray1.70A118-164[»]
A217-427[»]
3TKCX-ray1.75A118-427[»]
3VHWX-ray2.43A118-427[»]
3W0AX-ray1.80A120-423[»]
3W0CX-ray1.90A120-423[»]
3W0YX-ray1.98A120-423[»]
3WGPX-ray2.00A120-423[»]
3WWRX-ray3.18A118-427[»]
3X31X-ray2.11A118-427[»]
3X36X-ray1.93A118-427[»]
4G2IX-ray1.80A118-427[»]
4ITEX-ray2.49A118-427[»]
4ITFX-ray2.84A118-427[»]
4PA2X-ray2.00A118-427[»]
DisProtiDP00184.
ProteinModelPortaliP11473.
SMRiP11473.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP11473.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni97 – 191HingeAdd BLAST95
Regioni192 – 427Ligand-bindingAdd BLAST236
Regioni227 – 237Vitamin D3 bindingAdd BLAST11
Regioni271 – 278Vitamin D3 binding8

Domaini

Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.

Sequence similaritiesi

Contains 1 nuclear receptor DNA-binding domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri24 – 44NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri60 – 84NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG3575. Eukaryota.
ENOG410XRZC. LUCA.
GeneTreeiENSGT00850000132242.
HOGENOMiHOG000220844.
HOVERGENiHBG108655.
InParanoidiP11473.
KOiK08539.
OMAiFCQFRPP.
OrthoDBiEOG091G05X3.
PhylomeDBiP11473.
TreeFamiTF316304.

Family and domain databases

Gene3Di1.10.565.10. 2 hits.
3.30.50.10. 1 hit.
InterProiIPR000536. Nucl_hrmn_rcpt_lig-bd.
IPR001723. Nuclear_hrmn_rcpt.
IPR000324. VitD_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR00398. STRDHORMONER.
PR00047. STROIDFINGER.
PR00350. VITAMINDR.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P11473-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAMAASTSL PDPGDFDRNV PRICGVCGDR ATGFHFNAMT CEGCKGFFRR
60 70 80 90 100
SMKRKALFTC PFNGDCRITK DNRRHCQACR LKRCVDIGMM KEFILTDEEV
110 120 130 140 150
QRKREMILKR KEEEALKDSL RPKLSEEQQR IIAILLDAHH KTYDPTYSDF
160 170 180 190 200
CQFRPPVRVN DGGGSHPSRP NSRHTPSFSG DSSSSCSDHC ITSSDMMDSS
210 220 230 240 250
SFSNLDLSEE DSDDPSVTLE LSQLSMLPHL ADLVSYSIQK VIGFAKMIPG
260 270 280 290 300
FRDLTSEDQI VLLKSSAIEV IMLRSNESFT MDDMSWTCGN QDYKYRVSDV
310 320 330 340 350
TKAGHSLELI EPLIKFQVGL KKLNLHEEEH VLLMAICIVS PDRPGVQDAA
360 370 380 390 400
LIEAIQDRLS NTLQTYIRCR HPPPGSHLLY AKMIQKLADL RSLNEEHSKQ
410 420
YRCLSFQPEC SMKLTPLVLE VFGNEIS
Length:427
Mass (Da):48,289
Last modified:October 1, 1989 - v1
Checksum:iF95F300D042C4CB7
GO
Isoform 2 (identifier: P11473-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEWRNKKRSDWLSMVLRTAGVEEAFGSEVSVRPHRRAPLGSTYLPPAPSGM

Note: No experimental confirmation available.
Show »
Length:477
Mass (Da):53,883
Checksum:i7E4B93646169F6A8
GO

Sequence cautioni

The sequence AAH60832 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAP88938 differs from that shown. Reason: Erroneous gene model prediction.Curated

Polymorphismi

Genetic variations in VDR may determine Mycobacterium tuberculosis susceptibility [MIMi:607948].1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_00465633G → D in VDDR2A. 1 PublicationCorresponds to variant rs121909790dbSNPEnsembl.1
Natural variantiVAR_00465735H → Q in VDDR2A. 1 Publication1
Natural variantiVAR_00465845K → E in VDDR2A. 1 Publication1
Natural variantiVAR_00465946G → D in VDDR2A. 1 PublicationCorresponds to variant rs121909797dbSNPEnsembl.1
Natural variantiVAR_00466047F → I in VDDR2A. 1 Publication1
Natural variantiVAR_00466150R → Q in VDDR2A. 1 PublicationCorresponds to variant rs121909794dbSNPEnsembl.1
Natural variantiVAR_00466273R → Q in VDDR2A. 1 PublicationCorresponds to variant rs121909791dbSNPEnsembl.1
Natural variantiVAR_00466380R → Q in VDDR2A. 2 PublicationsCorresponds to variant rs121909793dbSNPEnsembl.1
Natural variantiVAR_029309230L → V.1 PublicationCorresponds to variant rs11574090dbSNPEnsembl.1
Natural variantiVAR_004664274R → L in VDDR2A; decreases affinity for ligand by a factor of 1000. 1 PublicationCorresponds to variant rs121909796dbSNPEnsembl.1
Natural variantiVAR_004665305H → Q in VDDR2A. 1 PublicationCorresponds to variant rs121909798dbSNPEnsembl.1
Natural variantiVAR_004666314I → S in VDDR2A. 1 PublicationCorresponds to variant rs121909799dbSNPEnsembl.1
Natural variantiVAR_029310362T → I.1 PublicationCorresponds to variant rs11574115dbSNPEnsembl.1
Natural variantiVAR_004667391R → C in VDDR2A. 1 PublicationCorresponds to variant rs121909800dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0472181M → MEWRNKKRSDWLSMVLRTAG VEEAFGSEVSVRPHRRAPLG STYLPPAPSGM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J03258 mRNA. Translation: AAA61273.1.
X67482 mRNA. Translation: CAA47824.1.
AF026260 mRNA. Translation: AAB95155.1.
AB002168 Genomic DNA. Translation: BAA83389.1.
AY342401 Genomic DNA. Translation: AAP88938.1. Sequence problems.
AK312267 mRNA. Translation: BAG35198.1.
AC004466 Genomic DNA. No translation available.
AC121338 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW57960.1.
CH471111 Genomic DNA. Translation: EAW57961.1.
BC060832 mRNA. Translation: AAH60832.1. Different initiation.
M65208 mRNA. Translation: AAA61274.1.
AY827087 Genomic DNA. Translation: AAV85448.1.
CCDSiCCDS55820.1. [P11473-2]
CCDS8757.1. [P11473-1]
PIRiA28200.
RefSeqiNP_000367.1. NM_000376.2. [P11473-1]
NP_001017535.1. NM_001017535.1. [P11473-1]
NP_001017536.1. NM_001017536.1. [P11473-2]
XP_006719650.1. XM_006719587.3. [P11473-1]
XP_011537022.1. XM_011538720.2. [P11473-1]
UniGeneiHs.524368.

Genome annotation databases

EnsembliENST00000229022; ENSP00000229022; ENSG00000111424. [P11473-1]
ENST00000395324; ENSP00000378734; ENSG00000111424. [P11473-1]
ENST00000549336; ENSP00000449573; ENSG00000111424. [P11473-1]
ENST00000550325; ENSP00000447173; ENSG00000111424. [P11473-2]
GeneIDi7421.
KEGGihsa:7421.
UCSCiuc001rql.4. human. [P11473-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs
SHMPD

The Singapore human mutation and polymorphism database

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J03258 mRNA. Translation: AAA61273.1.
X67482 mRNA. Translation: CAA47824.1.
AF026260 mRNA. Translation: AAB95155.1.
AB002168 Genomic DNA. Translation: BAA83389.1.
AY342401 Genomic DNA. Translation: AAP88938.1. Sequence problems.
AK312267 mRNA. Translation: BAG35198.1.
AC004466 Genomic DNA. No translation available.
AC121338 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW57960.1.
CH471111 Genomic DNA. Translation: EAW57961.1.
BC060832 mRNA. Translation: AAH60832.1. Different initiation.
M65208 mRNA. Translation: AAA61274.1.
AY827087 Genomic DNA. Translation: AAV85448.1.
CCDSiCCDS55820.1. [P11473-2]
CCDS8757.1. [P11473-1]
PIRiA28200.
RefSeqiNP_000367.1. NM_000376.2. [P11473-1]
NP_001017535.1. NM_001017535.1. [P11473-1]
NP_001017536.1. NM_001017536.1. [P11473-2]
XP_006719650.1. XM_006719587.3. [P11473-1]
XP_011537022.1. XM_011538720.2. [P11473-1]
UniGeneiHs.524368.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1DB1X-ray1.80A118-427[»]
1IE8X-ray1.52A118-427[»]
1IE9X-ray1.40A118-427[»]
1KB2X-ray2.70A/B16-125[»]
1KB4X-ray2.80A/B16-125[»]
1KB6X-ray2.70A/B16-125[»]
1S0ZX-ray2.50A118-427[»]
1S19X-ray2.10A118-427[»]
1TXIX-ray1.90A118-427[»]
1YNWX-ray3.00A16-125[»]
2HAMX-ray1.90A118-427[»]
2HARX-ray1.90A118-427[»]
2HASX-ray1.96A118-427[»]
2HB7X-ray1.80A118-427[»]
2HB8X-ray2.00A118-427[»]
3A2IX-ray3.27A118-427[»]
3A2JX-ray2.70A118-427[»]
3A3ZX-ray1.72X118-427[»]
3A40X-ray1.45X118-427[»]
3A78X-ray1.90A118-427[»]
3AUQX-ray2.64A118-427[»]
3AURX-ray2.21A118-427[»]
3AX8X-ray2.60A118-427[»]
3AZ1X-ray1.50A120-423[»]
3AZ2X-ray1.69A120-423[»]
3AZ3X-ray1.36A120-423[»]
3B0TX-ray1.30A120-423[»]
3CS4X-ray2.00A118-427[»]
3CS6X-ray1.80A118-427[»]
3KPZX-ray1.90A118-427[»]
3M7RX-ray1.80A120-423[»]
3OGTX-ray1.75A118-427[»]
3P8XX-ray1.70A118-164[»]
A217-427[»]
3TKCX-ray1.75A118-427[»]
3VHWX-ray2.43A118-427[»]
3W0AX-ray1.80A120-423[»]
3W0CX-ray1.90A120-423[»]
3W0YX-ray1.98A120-423[»]
3WGPX-ray2.00A120-423[»]
3WWRX-ray3.18A118-427[»]
3X31X-ray2.11A118-427[»]
3X36X-ray1.93A118-427[»]
4G2IX-ray1.80A118-427[»]
4ITEX-ray2.49A118-427[»]
4ITFX-ray2.84A118-427[»]
4PA2X-ray2.00A118-427[»]
DisProtiDP00184.
ProteinModelPortaliP11473.
SMRiP11473.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113264. 92 interactors.
DIPiDIP-32624N.
IntActiP11473. 19 interactors.
MINTiMINT-236408.
STRINGi9606.ENSP00000447173.

Chemistry databases

BindingDBiP11473.
ChEMBLiCHEMBL1977.
DrugBankiDB01436. Alfacalcidol.
DB00146. Calcidiol.
DB02300. Calcipotriol.
DB00136. Calcitriol.
DB00169. Cholecalciferol.
DB01070. Dihydrotachysterol.
DB06410. Doxercalciferol.
DB00153. Ergocalciferol.
DB00910. Paricalcitol.
GuidetoPHARMACOLOGYi605.
SwissLipidsiSLP:000001571.

Protein family/group databases

TCDBi9.B.208.1.1. the vitamin d3 receptor (vdr) family.

PTM databases

iPTMnetiP11473.
PhosphoSitePlusiP11473.

Polymorphism and mutation databases

BioMutaiVDR.
DMDMi137617.

Proteomic databases

MaxQBiP11473.
PaxDbiP11473.
PeptideAtlasiP11473.
PRIDEiP11473.

Protocols and materials databases

DNASUi7421.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000229022; ENSP00000229022; ENSG00000111424. [P11473-1]
ENST00000395324; ENSP00000378734; ENSG00000111424. [P11473-1]
ENST00000549336; ENSP00000449573; ENSG00000111424. [P11473-1]
ENST00000550325; ENSP00000447173; ENSG00000111424. [P11473-2]
GeneIDi7421.
KEGGihsa:7421.
UCSCiuc001rql.4. human. [P11473-1]

Organism-specific databases

CTDi7421.
DisGeNETi7421.
GeneCardsiVDR.
HGNCiHGNC:12679. VDR.
HPAiCAB004617.
HPA047740.
MalaCardsiVDR.
MIMi277440. phenotype.
601769. gene.
607948. phenotype.
neXtProtiNX_P11473.
OpenTargetsiENSG00000111424.
Orphaneti93160. Hypocalcemic vitamin D-resistant rickets.
PharmGKBiPA37301.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3575. Eukaryota.
ENOG410XRZC. LUCA.
GeneTreeiENSGT00850000132242.
HOGENOMiHOG000220844.
HOVERGENiHBG108655.
InParanoidiP11473.
KOiK08539.
OMAiFCQFRPP.
OrthoDBiEOG091G05X3.
PhylomeDBiP11473.
TreeFamiTF316304.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000111424-MONOMER.
ReactomeiR-HSA-383280. Nuclear Receptor transcription pathway.
SignaLinkiP11473.
SIGNORiP11473.

Miscellaneous databases

ChiTaRSiVDR. human.
EvolutionaryTraceiP11473.
GeneWikiiCalcitriol_receptor.
GenomeRNAii7421.
PROiP11473.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000111424.
CleanExiHS_VDR.
ExpressionAtlasiP11473. baseline and differential.
GenevisibleiP11473. HS.

Family and domain databases

Gene3Di1.10.565.10. 2 hits.
3.30.50.10. 1 hit.
InterProiIPR000536. Nucl_hrmn_rcpt_lig-bd.
IPR001723. Nuclear_hrmn_rcpt.
IPR000324. VitD_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR00398. STRDHORMONER.
PR00047. STROIDFINGER.
PR00350. VITAMINDR.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiVDR_HUMAN
AccessioniPrimary (citable) accession number: P11473
Secondary accession number(s): B2R5Q1, G3V1V9, Q5PSV3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1989
Last sequence update: October 1, 1989
Last modified: November 2, 2016
This is version 204 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-4 is the initiator.Curated

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.