P11388 (TOP2A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 156.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DNA topoisomerase 2-alpha EC=5.99.1.3 Alternative name(s): DNA topoisomerase II, alpha isozyme | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1531 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Control of topological states of DNA by transient breakage and subsequent rejoining of DNA strands. Topoisomerase II makes double-strand breaks. |
| Catalytic activity | ATP-dependent breakage, passage and rejoining of double-stranded DNA. |
| Enzyme regulation | Specifically inhibited by the intercalating agent amsacrine. |
| Subunit structure | Homodimer. Interacts with COPS5. Ref.15 |
| Subcellular location | Cytoplasm. Nucleus › nucleoplasm. Note: Generally located in the nucleoplasm. |
| Post-translational modification | Phosphorylation has no effect on catalytic activity. However, phosphorylation at Ser-1106 by CSNK1D/CK1 promotes DNA cleavable complex formation. |
| Miscellaneous | Eukaryotic topoisomerase I and II can relax both negative and positive supercoils, whereas prokaryotic enzymes relax only negative supercoils. |
| Sequence similarities | Belongs to the type II topoisomerase family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CTNNB1 | P35222 | 5 | EBI-539628,EBI-491549 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P11388-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P11388-2) The sequence of this isoform differs from the canonical sequence as follows: 401-401: A → AHLYSRFLIDPFFPNMIPNMIFSFSKA | ||||||
| Isoform 3 (identifier: P11388-3) The sequence of this isoform differs from the canonical sequence as follows: 321-321: K → KSSKYWSSRKSKQHILLNFFVLFKFINDAFFGICPFK | ||||||
| Isoform 4 (identifier: P11388-4) The sequence of this isoform differs from the canonical sequence as follows: 355-355: Q → QRELCNGAIL...SQSSGITDVK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1531 | 1531 | DNA topoisomerase 2-alpha | PRO_0000145363 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 148 – 150 | 3 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 161 – 168 | 8 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 1018 – 1028 | 11 | Nuclear export signal | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 805 | 1 | O-(5'-phospho-DNA)-tyrosine intermediate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 91 | 1 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 120 | 1 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 378 | 1 | ATP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.10 Ref.26 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4 | 1 | Phosphoserine Ref.16 Ref.21 Ref.24 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 29 | 1 | Phosphoserine Ref.16 Ref.21 Ref.24 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1106 | 1 | Phosphoserine; by CK1 Ref.11 Ref.13 Ref.16 Ref.18 Ref.20 Ref.21 Ref.25 Ref.26 Ref.27 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1213 | 1 | Phosphoserine Ref.13 Ref.16 Ref.17 Ref.18 Ref.21 Ref.23 Ref.24 Ref.25 Ref.28 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1244 | 1 | Phosphothreonine Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1247 | 1 | Phosphoserine Ref.13 Ref.16 Ref.18 Ref.19 Ref.20 Ref.21 Ref.24 Ref.25 Ref.26 Ref.28 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1295 | 1 | Phosphoserine Ref.18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1297 | 1 | Phosphoserine Ref.18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1302 | 1 | Phosphoserine Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1332 | 1 | Phosphoserine Ref.16 Ref.24 Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1337 | 1 | Phosphoserine Ref.16 Ref.24 Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1343 | 1 | Phosphothreonine; by PLK3 Ref.16 Ref.22 Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1351 | 1 | Phosphoserine Ref.16 Ref.18 Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1354 | 1 | Phosphoserine Ref.13 Ref.16 Ref.18 Ref.21 Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1374 | 1 | Phosphoserine Ref.16 Ref.17 Ref.20 Ref.25 Ref.28 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1377 | 1 | Phosphoserine Ref.13 Ref.16 Ref.17 Ref.20 Ref.21 Ref.24 Ref.25 Ref.28 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1387 | 1 | Phosphoserine Ref.18 Ref.28 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1392 | 1 | Phosphoserine Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1393 | 1 | Phosphoserine Ref.18 Ref.21 Ref.23 Ref.25 Ref.28 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1449 | 1 | Phosphoserine Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1469 | 1 | Phosphoserine; by CK2 Ref.12 Ref.13 Ref.16 Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1470 | 1 | Phosphothreonine Ref.16 Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1471 | 1 | Phosphoserine Ref.16 Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1474 | 1 | Phosphoserine Ref.13 Ref.16 Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1476 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1491 | 1 | Phosphoserine Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1495 | 1 | Phosphoserine Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1504 | 1 | Phosphoserine Ref.23 Ref.25 Ref.28 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1525 | 1 | Phosphoserine Ref.16 Ref.17 Ref.18 Ref.21 Ref.25 Ref.28 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 321 | 1 | K → KSSKYWSSRKSKQHILLNFF VLFKFINDAFFGICPFK in isoform 3. | VSP_006529 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 355 | 1 | Q → QRELCNGAILAHCNLRLMGS SDSPASASRVAGIAGGCHHT QLIFVFLVETGFHHVGQAGL ERLTSGDPPASASQSSGITD VK in isoform 4. | VSP_006530 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 401 | 1 | A → AHLYSRFLIDPFFPNMIPNM IFSFSKA in isoform 2. | VSP_006531 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 450 | 1 | R → Q in teniposide (VM-26) resistant cells. Ref.32 | VAR_007532 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 487 | 1 | R → K in amsacrine resistant cells. Ref.31 | VAR_007533 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1324 | 1 | T → K. Corresponds to variant rs28969502 [ dbSNP | Ensembl ]. | VAR_029245 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1386 | 1 | G → D. Corresponds to variant rs34300454 [ dbSNP | Ensembl ]. | VAR_052594 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1515 | 1 | A → S. Corresponds to variant rs11540720 [ dbSNP | Ensembl ]. | VAR_052595 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 1469 | 1 | S → A: Abolishes binding to the antibody MPM2. Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 152 | 1 | D → H in CAA09762. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 180 | 1 | E → Q in CAA09762. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 327 | 1 | D → H in CAA09762. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1022 | 1 | F → L in CAA09762. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1274 | 1 | T → S in CAA09762. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1295 | 1 | S → P in AAA61209. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 30 – 33 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 34 – 36 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 39 – 45 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 48 – 51 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 57 – 65 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 66 – 68 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 69 – 77 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 79 – 98 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 104 – 110 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 111 – 114 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 115 – 123 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 128 – 130 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 131 – 134 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 137 – 143 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 144 – 149 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 153 – 155 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 166 – 172 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 174 – 183 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 184 – 187 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 188 – 195 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 196 – 199 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 205 – 208 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 214 – 221 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 223 – 226 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 233 – 249 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 250 – 252 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 254 – 257 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 267 – 275 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 281 – 285 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 289 – 294 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 297 – 303 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 305 – 307 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 309 – 314 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 324 – 341 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 353 – 357 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 360 – 366 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 373 – 375 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 385 – 387 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 388 – 390 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 396 – 402 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 407 – 410 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 412 – 415 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 419 – 421 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and sequencing of cDNA encoding human DNA topoisomerase II and localization of the gene to chromosome region 17q21-22." Tsai-Pflugfelder M., Liu L.F., Liu A.A., Tewey K.M., Whang-Peng J., Knutsen T., Huebner K., Croce C.M., Wang J.C. Proc. Natl. Acad. Sci. U.S.A. 85:7177-7181(1988) [PubMed: 2845399] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Use of yeast in the study of anticancer drugs targeting DNA topoisomerases: expression of a functional recombinant human DNA topoisomerase II alpha in yeast." Wasserman R.A., Austin C.A., Fisher L.M., Wang J.C. Cancer Res. 53:3591-3596(1993) [PubMed: 8393377] [Abstract] Cited for: SEQUENCE REVISION TO 109-114. |
| [3] | "Structural organization of the human TOP2A and TOP2B genes." Lang A.J., Mirski S.E., Cummings H.J., Yu Q., Gerlach J.H., Cole S.P. Gene 221:255-266(1998) [PubMed: 9795238] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [4] | "Molecular cloning and characterization of the human topoisomerase IIalpha and IIbeta genes: evidence for isoform evolution through gene duplication." Sng J.H., Heaton V.J., Bell M., Mani P., Austin C.A., Fisher L.M. Biochim. Biophys. Acta 1444:395-406(1999) [PubMed: 10095062] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [5] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed: 16625196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [8] | "Two differentially spliced forms of topoisomerase II alpha and beta mRNAs are conserved between birds and humans." Petruti-Mot A.S., Earnshaw W.C. Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-500 (ISOFORMS 2; 3 AND 4). |
| [9] | Neri S., Govoni M., Perrotta L., Pozzi S., Pession A. Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-21 AND 48-72. |
| [10] | Bienvenut W.V., Lilla S., von Kriegsheim A., Lempens A., Kolch W. Submitted (DEC-2008) to UniProtKB Cited for: PROTEIN SEQUENCE OF 1-17; 74-96; 124-131; 169-184; 243-251; 277-287; 325-336; 387-397; 467-478; 481-487; 500-519; 569-579; 702-713; 805-815; 828-835; 864-877; 937-958; 1021-1026 AND 1185-1196, ACETYLATION AT MET-1, MASS SPECTROMETRY. Tissue: Ovarian carcinoma. |
| [11] | Bienvenut W.V., Waridel P., Quadroni M. Submitted (MAR-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 135-157; 228-241; 307-321; 325-336; 387-397; 401-416; 467-478; 536-550; 569-579; 640-655; 702-713; 805-815; 1011-1020; 1097-1114; 1169-1184; 1239-1259 AND 1374-1411, PHOSPHORYLATION AT SER-1106, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Mitotic phosphorylation of DNA topoisomerase II alpha by protein kinase CK2 creates the MPM-2 phosphoepitope on Ser-1469." Escargueil A.E., Plisov S.Y., Filhol O., Cochet C., Larsen A.K. J. Biol. Chem. 275:34710-34718(2000) [PubMed: 10942766] [Abstract] Cited for: PHOSPHORYLATION AT SER-1469, MUTAGENESIS OF SER-1469. |
| [13] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1106; SER-1213; SER-1247; SER-1354; SER-1377; SER-1469 AND SER-1474, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Identification of functional nuclear export sequences in human topoisomerase IIalpha and beta." Mirski S.E., Bielawski J.C., Cole S.P. Biochem. Biophys. Res. Commun. 306:905-911(2003) [PubMed: 12821127] [Abstract] Cited for: NUCLEAR EXPORT SIGNAL. |
| [15] | "Interaction between glucose-regulated destruction domain of DNA topoisomerase IIalpha and MPN domain of Jab1/CSN5." Yun J., Tomida A., Andoh T., Tsuruo T. J. Biol. Chem. 279:31296-31303(2004) [PubMed: 15126503] [Abstract] Cited for: INTERACTION WITH COPS5. |
| [16] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4; SER-29; SER-1106; SER-1213; SER-1247; SER-1332; SER-1337; THR-1343; SER-1351; SER-1354; SER-1374; SER-1377; SER-1469; THR-1470; SER-1471; SER-1474 AND SER-1525, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [17] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1213; SER-1374; SER-1377 AND SER-1525, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "Phosphoproteome analysis of the human mitotic spindle." Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R. Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006) [PubMed: 16565220] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1106; SER-1213; SER-1247; SER-1295; SER-1297; SER-1351; SER-1354; SER-1387; SER-1393 AND SER-1525, MASS SPECTROMETRY. Tissue: Cervix adenocarcinoma. |
| [19] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1247, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [20] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1106; SER-1247; SER-1374 AND SER-1377, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [21] | "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis." Wang B., Malik R., Nigg E.A., Korner R. Anal. Chem. 80:9526-9533(2008) [PubMed: 19007248] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT MET-1; SER-4; SER-29; SER-1106; SER-1213; SER-1247; SER-1302; SER-1354; SER-1377; SER-1393 AND SER-1525, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [22] | "Plk3 phosphorylates topoisomerase IIalpha at Thr(1342), a site that is not recognized by Plk1." Iida M., Matsuda M., Komatani H. Biochem. J. 411:27-32(2008) [PubMed: 18062778] [Abstract] Cited for: PHOSPHORYLATION AT THR-1343. |
| [23] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1213; SER-1393 AND SER-1504, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [24] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4; SER-29; SER-1213; SER-1247; SER-1332; SER-1337 AND SER-1377, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [25] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1106; SER-1213; THR-1244; SER-1247; SER-1332; SER-1337; THR-1343; SER-1351; SER-1354; SER-1374; SER-1377; SER-1392; SER-1393; SER-1449; SER-1469; THR-1470; SER-1471; SER-1474; SER-1491; SER-1495; SER-1504 AND SER-1525, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [26] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1106 AND SER-1247, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [27] | "Casein kinase I delta/epsilon phosphorylates topoisomerase IIalpha at serine-1106 and modulates DNA cleavage activity." Grozav A.G., Chikamori K., Kozuki T., Grabowski D.R., Bukowski R.M., Willard B., Kinter M., Andersen A.H., Ganapathi R., Ganapathi M.K. Nucleic Acids Res. 37:382-392(2009) [PubMed: 19043076] [Abstract] Cited for: PHOSPHORYLATION AT SER-1106 BY CSNK1D/CK1. |
| [28] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1213; SER-1247; SER-1374; SER-1377; SER-1387; SER-1393; SER-1504 AND SER-1525, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [29] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [30] | "Nucleotide-dependent domain movement in the ATPase domain of a human type IIA DNA topoisomerase." Wei H., Ruthenburg A.J., Bechis S.K., Verdine G.L. J. Biol. Chem. 280:37041-37047(2005) [PubMed: 16100112] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.51 ANGSTROMS) OF 29-428 IN COMPLEX WITH ADP, X-RAY CRYSTALLOGRAPHY (1.87 ANGSTROMS) OF 29-428 IN COMPLEX WITH AMPPNP. |
| [31] | "Identification of a point mutation in the topoisomerase II gene from a human leukemia cell line containing an amsacrine-resistant form of topoisomerase II." Hinds M., Deisseroth K., Mayes J., Altschuler E., Jansen R., Ledley F.D., Zwelling L.A. Cancer Res. 51:4729-4731(1991) [PubMed: 1651812] [Abstract] Cited for: VARIANT AMSACRINE-RESISTANT LYS-487. |
| [32] | "Expression of a mutant DNA topoisomerase II in CCRF-CEM human leukemic cells selected for resistance to teniposide." Bugg B.Y., Danks M.K., Beck W.T., Suttle D.P. Proc. Natl. Acad. Sci. U.S.A. 88:7654-7658(1991) [PubMed: 1652758] [Abstract] Cited for: VARIANT TENIPOSIDE-RESISTANT GLN-450. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | J04088 mRNA. Translation: AAA61209.1. AF071747 AF071746 Genomic DNA. Translation: AAC77388.1.AJ011741 AJ011758 Genomic DNA. Translation: CAA09762.1.AC080112 Genomic DNA. No translation available. AF285157 mRNA. Translation: AAG13403.1. AF285158 mRNA. Translation: AAG13404.1. CH471152 Genomic DNA. Translation: EAW60663.1. BC140791 mRNA. Translation: AAI40792.1. AF285159 mRNA. Translation: AAG13405.1. AF069522 Genomic DNA. Translation: AAC23518.1. AF064590 Genomic DNA. Translation: AAC16736.1. | ||||||||||||||||||||||||
| IPI | IPI00414101. IPI00478232. IPI00879004. IPI01011132. | ||||||||||||||||||||||||
| PIR | A40493. | ||||||||||||||||||||||||
| RefSeq | NP_001058.2. NM_001067.3. | ||||||||||||||||||||||||
| UniGene | Hs.156346. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | P11388. | ||||||||||||||||||||||||
| SMR | P11388. Positions 29-405, 436-1188. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-33887N. | ||||||||||||||||||||||||
| IntAct | P11388. 14 interactions. | ||||||||||||||||||||||||
| MINT | MINT-98770. | ||||||||||||||||||||||||
| STRING | P11388. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | P11388. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 13959709. | ||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||
| UCD-2DPAGE | P11388. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PRIDE | P11388. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000423485; ENSP00000411532; ENSG00000131747. | ||||||||||||||||||||||||
| GeneID | 7153. | ||||||||||||||||||||||||
| KEGG | hsa:7153. | ||||||||||||||||||||||||
| UCSC | uc002huq.1. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 7153. | ||||||||||||||||||||||||
| GeneCards | GC17M038544. | ||||||||||||||||||||||||
| H-InvDB | HIX0013797. | ||||||||||||||||||||||||
| HGNC | HGNC:11989. TOP2A. | ||||||||||||||||||||||||
| HPA | CAB002448. HPA006458. HPA026773. | ||||||||||||||||||||||||
| MIM | 126430. gene. | ||||||||||||||||||||||||
| neXtProt | NX_P11388. | ||||||||||||||||||||||||
| PharmGKB | PA354. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| GeneTree | ENSGT00390000016222. | ||||||||||||||||||||||||
| HOVERGEN | HBG052998. | ||||||||||||||||||||||||
| OrthoDB | EOG4KWJS0. | ||||||||||||||||||||||||
| PhylomeDB | P11388. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| BRENDA | 5.99.1.3. 2681. | ||||||||||||||||||||||||
| Reactome | REACT_152. Cell Cycle, Mitotic. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | P11388. | ||||||||||||||||||||||||
| Bgee | P11388. | ||||||||||||||||||||||||
| CleanEx | HS_TOP2A. | ||||||||||||||||||||||||
| Genevestigator | P11388. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR003594. ATPase-like_ATP-bd. IPR012542. DTHCT. IPR020568. Ribosomal_S5_D2-typ_fold. IPR014721. Ribosomal_S5_D2-typ_fold_subgr. IPR001241. Topo_IIA. IPR002205. Topo_IIA_A/C. IPR013758. Topo_IIA_A/C_ab. IPR013757. Topo_IIA_A_a. IPR013759. Topo_IIA_B/N_ab. IPR013506. Topo_IIA_bsu_dom2. IPR013760. Topo_IIA_cen. IPR018522. TopoIIA_CS. [Graphical view] | ||||||||||||||||||||||||
| Gene3D | G3DSA:3.30.565.10. ATP_bd_ATPase. 1 hit. G3DSA:3.30.230.10. Ribosomal_S5_D2-type_fold. 1 hit. G3DSA:3.90.199.10. Topo_IIA_A/C_ab. 2 hits. G3DSA:1.10.268.10. Topo_IIA_A_a. 1 hit. G3DSA:3.40.50.670. Topo_IIA_B/N_ab. 1 hit. | ||||||||||||||||||||||||
| KO | K03164. | ||||||||||||||||||||||||
| Pfam | PF00204. DNA_gyraseB. 1 hit. PF00521. DNA_topoisoIV. 1 hit. PF08070. DTHCT. 1 hit. PF02518. HATPase_c. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PRINTS | PR00418. TPI2FAMILY. | ||||||||||||||||||||||||
| SMART | SM00387. HATPase_c. 1 hit. SM00433. TOP2c. 1 hit. SM00434. TOP4c. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF55874. ATP_bd_ATPase. 1 hit. SSF54211. Ribosomal_S5_D2-typ_fold. 1 hit. SSF56719. Topo_IIA_cen. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS00177. TOPOISOMERASE_II. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| DrugBank | DB00276. Amsacrine. DB00537. Ciprofloxacin. DB00380. Dexrazoxane. DB00997. Doxorubicin. DB00467. Enoxacin. DB00445. Epirubicin. DB00773. Etoposide. DB04576. Fleroxacin. DB01044. Gatifloxacin. DB01177. Idarubicin. DB01137. Levofloxacin. DB00978. Lomefloxacin. DB04967. Lucanthone. DB01204. Mitoxantrone. DB00218. Moxifloxacin. DB01059. Norfloxacin. DB01165. Ofloxacin. DB00487. Pefloxacin. DB01179. Podofilox. DB01208. Sparfloxacin. DB00444. Teniposide. DB00685. Trovafloxacin. DB00385. Valrubicin. | ||||||||||||||||||||||||
| NextBio | 27992. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | TOP2A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P11388 Secondary accession number(s): B2RTS1 Q9UQP9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with