P11362 (FGFR1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 170.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fibroblast growth factor receptor 1 Short name=FGFR-1 EC=2.7.10.1 Alternative name(s): Basic fibroblast growth factor receptor 1 Short name=BFGFR Short name=bFGF-R-1 Fms-like tyrosine kinase 2 Short name=FLT-2 N-sam Proto-oncogene c-Fgr CD_antigen=CD331 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 822 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. Required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Phosphorylates PLCG1, FRS2, GAB1 and SHB. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol-1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Promotes phosphorylation of SHC1, STAT1 and PTPN11/SHP2. In the nucleus, enhances RPS6KA1 and CREB1 activity and contributes to the regulation of transcription. FGFR1 signaling is down-regulated by IL17RD/SEF, and by FGFR1 ubiquitination, internalization and degradation. Ref.10 Ref.22 Ref.23 Ref.25 Ref.26 Ref.31 Ref.32 Ref.34 Ref.37 Ref.42 Ref.43 Ref.44 Ref.46 Ref.47 Ref.49 Ref.56 Ref.59 Ref.60 |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. Ref.22 Ref.25 Ref.34 Ref.44 Ref.47 Ref.59 Ref.60 |
| Enzyme regulation | Present in an inactive conformation in the absence of bound ligand. Ligand binding leads to dimerization and activation by sequential autophosphorylation on tyrosine residues. Inhibited by ARQ 069; this compound maintains the kinase in an inactive conformation and inhibits autophosphorylation. Inhibited by PD173074. Ref.25 Ref.44 Ref.47 Ref.61 |
| Subunit structure | Monomer. Homodimer after ligand binding. Interacts predominantly with FGF1 and FGF2, but can also interact with FGF3, FGF4, FGF5, FGF6, FGF8, FGF10, FGF19, FGF21, FGF22 and FGF23 (in vitro). Ligand specificity is determined by tissue-specific expression of isoforms, and differences in the third Ig-like domain are crucial for ligand specificity. Affinity for fibroblast growth factors (FGFs) is increased by heparan sulfate glycosaminoglycans that function as coreceptors. Likewise, KLB increases the affinity for FGF19, FGF21 and FGF23. Interacts (phosphorylated on Tyr-766) with PLCG1 (via SH2 domains). Interacts with FRS2. Interacts (via C-terminus) with NEDD4 (via WW3 domain). Interacts with KL By similarity. Interacts with SHB (via SH2 domain) and GRB10. Interacts with KAL1; this interaction does not interfere with FGF2-binding to FGFR1, but prevents binding of heparin-bound FGF2. Interacts with SOX2 and SOX3 By similarity. Ref.2 Ref.5 Ref.21 Ref.22 Ref.26 Ref.27 Ref.29 Ref.32 Ref.34 Ref.37 Ref.42 Ref.45 Ref.48 Ref.49 Ref.59 Ref.60 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein. Nucleus. Cytoplasm › cytosol. Cytoplasmic vesicle. Note: After ligand binding, both receptor and ligand are rapidly internalized. Can translocate to the nucleus after internalization, or by translocation from the endoplasmic reticulum or Golgi apparatus to the cytosol, and from there to the nucleus. Ref.24 Ref.34 Ref.38 Ref.44 Ref.46 Ref.49 |
| Tissue specificity | Detected in astrocytoma, neuroblastoma and adrenal cortex cell lines. Some isoforms are detected in foreskin fibroblast cell lines, however isoform 17, isoform 18 and isoform 19 are not detected in these cells. Ref.19 |
| Domain | The second and third Ig-like domains directly interact with fibroblast growth factors (FGF) and heparan sulfate proteoglycans. Isoforms lacking the first Ig-like domain have higher affinity for fibroblast growth factors (FGF) and heparan sulfate proteoglycans than isoforms with all three Ig-like domains. |
| Post-translational modification | Autophosphorylated. Binding of FGF family members together with heparan sulfate proteoglycan or heparin promotes receptor dimerization and autophosphorylation on tyrosine residues. Autophosphorylation occurs in trans between the two FGFR molecules present in the dimer and proceeds in a highly ordered manner. Initial autophosphorylation at Tyr-653 increases the kinase activity by a factor of 50 to 100. After this, Tyr-583 becomes phosphorylated, followed by phosphorylation of Tyr-463, Tyr-766, Tyr-583 and Tyr-585. In a third stage, Tyr-654 is autophosphorylated, resulting in a further tenfold increase of kinase activity. Phosphotyrosine residues provide docking sites for interacting proteins and so are crucial for FGFR1 function and its regulation. Ref.22 Ref.25 Ref.27 Ref.31 Ref.32 Ref.39 Ref.41 Ref.43 Ref.47 Ref.59 Ubiquitinated. FGFR1 is rapidly ubiquitinated by NEDD4 after autophosphorylation, leading to internalization and lysosomal degradation. CBL is recruited to activated FGFR1 via FRS2 and GRB2, and mediates ubiquitination and subsequent degradation of FGFR1. Ref.44 Ref.49 N-glycosylated in the endoplasmic reticulum. The N-glycan chains undergo further maturation to an Endo H-resistant form in the Golgi apparatus. Ref.35 Ref.38 Ref.43 |
| Involvement in disease | Defects in FGFR1 are a cause of Pfeiffer syndrome (PS) [MIM:101600]; also known as acrocephalosyndactyly type V (ACS5). PS is characterized by craniosynostosis (premature fusion of the skull sutures) with deviation and enlargement of the thumbs and great toes, brachymesophalangy, with phalangeal ankylosis and a varying degree of soft tissue syndactyly. Ref.10 Ref.62 Defects in FGFR1 are a cause of idiopathic hypogonadotropic hypogonadism (IHH) [MIM:146110]. IHH is defined as a deficiency of the pituitary secretion of follicle-stimulating hormone and luteinizing hormone, which results in the impairment of pubertal maturation and of reproductive function. Ref.10 Ref.70 Ref.73 Defects in FGFR1 are the cause of Kallmann syndrome type 2 (KAL2) [MIM:147950]; also known as hypogonadotropic hypogonadism and anosmia. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin-releasing hormone-synthesizing neurons. In some cases, midline cranial anomalies (cleft lip/palate and imperfect fusion) are present and anosmia may be absent or inconspicuous. Ref.10 Ref.64 Ref.65 Ref.67 Ref.68 Ref.70 Ref.71 Ref.72 Ref.74 Defects in FGFR1 are the cause of osteoglophonic dysplasia (OGD) [MIM:166250]; also known as osteoglophonic dwarfism. OGD is characterized by craniosynostosis, prominent supraorbital ridge, and depressed nasal bridge, as well as by rhizomelic dwarfism and nonossifying bone lesions. Inheritance is autosomal dominant. Ref.10 Ref.66 Ref.69 Defects in FGFR1 are the cause of trigonocephaly non-syndromic (TRICEPH) [MIM:190440]; also known as metopic craniosynostosis. The term trigonocephaly describes the typical keel-shaped deformation of the forehead resulting from premature fusion of the frontal suture. Trigonocephaly may occur also as a part of a syndrome. Ref.10 Ref.63 Note=A chromosomal aberration involving FGFR1 may be a cause of stem cell leukemia lymphoma syndrome (SCLL). Translocation t(8;13)(p11;q12) with ZMYM2. SCLL usually presents as lymphoblastic lymphoma in association with a myeloproliferative disorder, often accompanied by pronounced peripheral eosinophilia and/or prominent eosinophilic infiltrates in the affected bone marrow. Ref.10 Note=A chromosomal aberration involving FGFR1 may be a cause of stem cell myeloproliferative disorder (MPD). Translocation t(6;8)(q27;p11) with FGFR1OP. Insertion ins(12;8)(p11;p11p22) with FGFR1OP2. MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma. In general it progresses to acute myeloid leukemia. The fusion proteins FGFR1OP2-FGFR1, FGFR1OP-FGFR1 or FGFR1-FGFR1OP may exhibit constitutive kinase activity and be responsible for the transforming activity. Note=A chromosomal aberration involving FGFR1 may be a cause of stem cell myeloproliferative disorder (MPD). Translocation t(8;9)(p12;q33) with CEP110. MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma. In general it progresses to acute myeloid leukemia. The fusion protein CEP110-FGFR1 is found in the cytoplasm, exhibits constitutive kinase activity and may be responsible for the transforming activity. |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily. Contains 3 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 protein kinase domain. |
| Sequence caution | The sequence BAD92156.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CDH1 | P12830 | 2 | EBI-1028277,EBI-727477 | |
| FGF2 | P09038 | 2 | EBI-1028277,EBI-977447 | |
| Plcg1 | P10686 | 4 | EBI-1028277,EBI-520788 | From a different organism. |
Alternative products
| This entry describes 21 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P11362-1) Also known as: Alpha A1; IV; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P11362-8) Also known as: Alpha A2; The sequence of this isoform differs from the canonical sequence as follows: 619-662: CIHRDLAARN...YYKKTTNGRL → VWNLKAPLVH...RTGHSPHRLL 663-822: Missing. | ||||||
| Isoform 3 (identifier: P11362-17) Also known as: Alpha A3; The sequence of this isoform differs from the canonical sequence as follows: 32-61: QPWGAPVEVESFLVHPGDLLQLRCRLRDDV → CPDLQEAKSCSASFHSITPLPFGLGTRLSD 62-822: Missing. | ||||||
| Isoform 4 (identifier: P11362-2) Also known as: Alpha B1; The sequence of this isoform differs from the canonical sequence as follows: 428-429: Missing. | ||||||
| Isoform 5 (identifier: P11362-9) Also known as: Alpha B2; The sequence of this isoform differs from the canonical sequence as follows: 428-429: Missing. 619-662: CIHRDLAARN...YYKKTTNGRL → VWNLKAPLVH...RTGHSPHRLL 663-822: Missing. | ||||||
| Isoform 6 (identifier: P11362-3) Also known as: Beta A1; II; H2; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. | ||||||
| Isoform 7 (identifier: P11362-10) Also known as: Beta A2; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. 619-662: CIHRDLAARN...YYKKTTNGRL → VWNLKAPLVH...RTGHSPHRLL 663-822: Missing. | ||||||
| Isoform 8 (identifier: P11362-4) Also known as: Beta B1; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. 428-429: Missing. | ||||||
| Isoform 9 (identifier: P11362-11) Also known as: Beta B2; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. 428-429: Missing. 619-662: CIHRDLAARN...YYKKTTNGRL → VWNLKAPLVH...RTGHSPHRLL 663-822: Missing. | ||||||
| Isoform 10 (identifier: P11362-5) Also known as: Gamma A1; The sequence of this isoform differs from the canonical sequence as follows: 1-160: Missing. | ||||||
| Isoform 11 (identifier: P11362-12) Also known as: Gamma A2; The sequence of this isoform differs from the canonical sequence as follows: 1-160: Missing. 619-662: CIHRDLAARN...YYKKTTNGRL → VWNLKAPLVH...RTGHSPHRLL 663-822: Missing. | ||||||
| Isoform 12 (identifier: P11362-6) Also known as: Gamma B1; The sequence of this isoform differs from the canonical sequence as follows: 1-160: Missing. 428-429: Missing. | ||||||
| Isoform 13 (identifier: P11362-13) Also known as: Gamma B2; The sequence of this isoform differs from the canonical sequence as follows: 1-160: Missing. 428-429: Missing. 619-662: CIHRDLAARN...YYKKTTNGRL → VWNLKAPLVH...RTGHSPHRLL 663-822: Missing. | ||||||
| Isoform 14 (identifier: P11362-7) Also known as: A; III; The sequence of this isoform differs from the canonical sequence as follows: 148-149: Missing. | ||||||
| Isoform 15 (identifier: P11362-14) Also known as: I; H3; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. 148-149: Missing. | ||||||
| Isoform 16 (identifier: P11362-15) Also known as: V; The sequence of this isoform differs from the canonical sequence as follows: 120-150: DALPSSEDDDDDDDSSSEEKETDNTKPNRMP → ACPDLQEAKWCSASFHSITPLPFGLGTRLSD 151-822: Missing. | ||||||
| Isoform 17 (identifier: P11362-16) Also known as: H4; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. 313-391: TAGVNTTDKE...TGAFLISCMV → VIMAPVFVGQ...RAAGMGGAGL 392-822: Missing. | ||||||
| Isoform 18 (identifier: P11362-18) Also known as: H5; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. 148-149: Missing. 313-391: TAGVNTTDKE...TGAFLISCMV → VIMAPVFVGQ...RAAGMGGAGL 392-822: Missing. | ||||||
| Isoform 19 (identifier: P11362-19) The sequence of this isoform differs from the canonical sequence as follows: 119-119: S → SVPI 148-149: Missing. 313-360: TAGVNTTDKE...HHSAWLTVLE → HSGINSSDAE...QSAWLTVTRP | ||||||
| Isoform 20 (identifier: P11362-20) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MWSWKCLLFWAVLVTATLCTARPSPTLPEQ → MAAVTRDFGEMLLHSGRVLPAE 427-428: Missing. | ||||||
| Isoform 21 (identifier: P11362-21) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MEARVSLKRRIELTVEYPWRCGALSPTSNCRTGM 148-149: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | Ref.16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 22 – 822 | 801 | Fibroblast growth factor receptor 1 | PRO_0000016780 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 22 – 376 | 355 | Extracellular Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 377 – 397 | 21 | Helical; Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 398 – 822 | 425 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 25 – 119 | 95 | Ig-like C2-type 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 158 – 246 | 89 | Ig-like C2-type 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 255 – 357 | 103 | Ig-like C2-type 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 478 – 767 | 290 | Protein kinase | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 484 – 490 | 7 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 562 – 564 | 3 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 160 – 177 | 18 | Heparin-binding | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 623 | 1 | Proton acceptor Ref.47 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 514 | 1 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 568 | 1 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 627 | 1 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 641 | 1 | ATP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 428 – 429 | 2 | Breakpoint for translocation to form CEP110-FGFR1 OR FGFR1-CEP110 fusion proteins | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 428 – 429 | 2 | Breakpoint for translocation to form FGFR1OP-FGFR1 or FGFR1-FGFR1OP fusion proteins | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 428 – 429 | 2 | Breakpoint for translocation to form FGFR1OP2-FGFR1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 766 | 1 | Mediates interaction with PLCG1 and SHB | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 463 | 1 | Phosphotyrosine; by autocatalysis Ref.25 Ref.39 Ref.47 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 583 | 1 | Phosphotyrosine; by autocatalysis Ref.25 Ref.39 Ref.47 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 585 | 1 | Phosphotyrosine; by autocatalysis Ref.25 Ref.39 Ref.47 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 653 | 1 | Phosphotyrosine; by autocatalysis Ref.25 Ref.39 Ref.41 Ref.47 Ref.59 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 654 | 1 | Phosphotyrosine; by autocatalysis Ref.25 Ref.39 Ref.47 Ref.59 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 730 | 1 | Phosphotyrosine; by autocatalysis Ref.25 Ref.47 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 766 | 1 | Phosphotyrosine; by autocatalysis Ref.59 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 77 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 117 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 227 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 240 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 264 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 296 | 1 | N-linked (GlcNAc...) Ref.35 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 317 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 330 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 55 ↔ 101 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 178 ↔ 230 | Ref.56 Ref.57 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 277 ↔ 341 | Ref.56 Ref.57 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 160 | 160 | Missing in isoform 10, isoform 11, isoform 12 and isoform 13. | VSP_002957 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 30 | 30 | MWSWK…TLPEQ → MAAVTRDFGEMLLHSGRVLP AE in isoform 20. | VSP_041916 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MEARVSLKRRIELTVEYPWR CGALSPTSNCRTGM in isoform 21. | VSP_041917 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 31 – 119 | 89 | Missing in isoform 6, isoform 7, isoform 8, isoform 9, isoform 15, isoform 17 and isoform 18. | VSP_002958 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 32 – 61 | 30 | QPWGA…LRDDV → CPDLQEAKSCSASFHSITPL PFGLGTRLSD in isoform 3. | VSP_009836 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 62 – 822 | 761 | Missing in isoform 3. | VSP_009837 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 119 | 1 | S → SVPI in isoform 19. | VSP_038470 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 120 – 150 | 31 | DALPS…PNRMP → ACPDLQEAKWCSASFHSITP LPFGLGTRLSD in isoform 16. | VSP_009838 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 148 – 149 | 2 | Missing in isoform 14, isoform 15, isoform 18, isoform 19 and isoform 21. | VSP_002959 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 151 – 822 | 672 | Missing in isoform 16. | VSP_009839 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 313 – 391 | 79 | TAGVN…ISCMV → VIMAPVFVGQSTGKETTVSG AQVPVGRLSCPRMGSFLTLQ AHTLHLSRDLATSPRTSNRG HKVEVSWEQRAAGMGGAGL in isoform 17 and isoform 18. | VSP_009840 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 313 – 360 | 48 | TAGVN…LTVLE → HSGINSSDAEVLTLFNVTEA QSGEYVCKVSNYIGEANQSA WLTVTRP in isoform 19. | VSP_038471 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 392 – 822 | 431 | Missing in isoform 17 and isoform 18. | VSP_009841 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 427 – 428 | 2 | Missing in isoform 20. | VSP_041918 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 428 – 429 | 2 | Missing in isoform 4, isoform 5, isoform 8, isoform 9, isoform 12 and isoform 13. | VSP_002960 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 619 – 662 | 44 | CIHRD…TNGRL → VWNLKAPLVHTPRPGSQECP GDRGQCDEDSRLWPRTGHSP HRLL in isoform 2, isoform 5, isoform 7, isoform 9, isoform 11 and isoform 13. | VSP_009842 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 663 – 822 | 160 | Missing in isoform 2, isoform 5, isoform 7, isoform 9, isoform 11 and isoform 13. | VSP_009843 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 22 | 1 | R → S. Ref.13 Corresponds to variant rs17175750 [ dbSNP | Ensembl ]. | VAR_019290 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 48 | 1 | G → S in IHH. Ref.70 | VAR_030968 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 77 | 1 | N → K. Ref.74 | VAR_030969 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 78 | 1 | R → C in KAL2. Ref.71 | VAR_030970 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 97 | 1 | G → D in KAL2. Ref.64 | VAR_017885 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 99 | 1 | Y → C in KAL2. Ref.64 | VAR_017886 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 101 | 1 | C → F in KAL2. Ref.74 | VAR_030971 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 102 | 1 | V → I in KAL2. Ref.67 Ref.71 Corresponds to variant rs55642501 [ dbSNP | Ensembl ]. | VAR_030972 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 125 | 1 | S → L in a breast infiltrating ductal carcinoma sample; somatic mutation. Ref.75 | VAR_042201 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 129 | 1 | D → A in KAL2. Ref.67 | VAR_030973 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 167 | 1 | A → S in KAL2; with cleft palate, corpus callosum agenesis, unilateral deafness and fusion of fourth and fifth metacarpal bones. Ref.64 | VAR_017887 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 178 | 1 | C → S in KAL2; with severe ear anomalies. Ref.72 | VAR_030974 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 213 | 1 | W → G. Ref.15 Corresponds to variant rs17851623 [ dbSNP | Ensembl ]. | VAR_030975 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 224 | 1 | D → H in KAL2. Ref.71 | VAR_030976 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 237 | 1 | G → D in KAL2. Ref.71 | VAR_030977 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 237 | 1 | G → S in IHH/KAL2; also found in a family member with isolated anosmia; may impair proper folding. Ref.73 | VAR_030978 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 245 | 1 | L → P in KAL2. Ref.70 | VAR_030979 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 250 | 1 | R → W in KAL2. Ref.70 Ref.74 | VAR_030980 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 252 | 1 | P → R in PS; seems to be a gain of function. Ref.62 | VAR_004111 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 252 | 1 | P → T in a lung bronchoalveolar carcinoma sample; somatic mutation. Ref.75 | VAR_042202 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 254 | 1 | R → Q in KAL2. Ref.71 | VAR_030981 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 270 | 1 | G → D in KAL2. Ref.74 | VAR_030982 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 273 | 1 | V → M in KAL2. Ref.67 Ref.71 | VAR_030983 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 274 | 1 | E → G in KAL2; also found in a family member with isolated anosmia. Ref.71 | VAR_030984 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 277 | 1 | C → Y in KAL2. Ref.64 | VAR_017888 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 283 | 1 | P → R in KAL2. Ref.74 | VAR_030985 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 300 | 1 | I → T in TRICEPH. Ref.63 | VAR_030986 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 330 | 1 | N → I in OGD. Ref.66 Ref.69 | VAR_030987 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 332 | 1 | S → C in KAL2. Ref.74 | VAR_030988 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 339 | 1 | Y → C in KAL2. Ref.71 | VAR_030989 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 343 | 1 | A → V in KAL2. Ref.70 | VAR_030990 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 346 | 1 | S → C in KAL2; also found in a family member with isolated anosmia. Ref.71 | VAR_030991 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 366 | 1 | P → L in IHH/KAL2. Ref.70 | VAR_030992 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 374 | 1 | Y → C in OGD; elevated basal activity and increased FGF2-mediated activity. Ref.66 | VAR_030993 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 381 | 1 | C → R in OGD. Ref.66 Ref.69 | VAR_030994 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 520 | 1 | A → T in KAL2. Ref.67 | VAR_030995 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 538 | 1 | I → V in KAL2. Ref.71 | VAR_030996 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 607 | 1 | V → M in KAL2; with bimanual synkinesis. Ref.64 | VAR_017889 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 621 | 1 | H → R in KAL2. Ref.74 | VAR_030997 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 622 | 1 | R → G in KAL2; with severe ear anomalies. Ref.72 | VAR_030998 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 622 | 1 | R → Q in KAL2. Ref.72 | VAR_030999 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 664 | 1 | V → L in a lung large cell carcinoma sample; somatic mutation. Ref.75 | VAR_042203 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 666 | 1 | W → R in KAL2; with cleft palate. Ref.64 | VAR_017890 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 685 | 1 | S → F in KAL2. Ref.74 | VAR_031000 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 687 | 1 | G → R in KAL2. Ref.68 | VAR_031001 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 693 | 1 | I → F in KAL2. Ref.74 | VAR_031002 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 703 | 1 | G → R in KAL2. Ref.71 | VAR_031003 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 703 | 1 | G → S in KAL2. Ref.71 | VAR_031004 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 719 | 1 | M → R in KAL2. Ref.64 | VAR_017891 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 722 | 1 | P → H in IHH; associated with K-724; also found in a family member with isolated anosmia; reduced tyrosine kinase activity. Ref.73 | VAR_031005 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 722 | 1 | P → S in KAL2. Ref.70 | VAR_031006 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 724 | 1 | N → K in IHH; associated with H-722; also found in a family member with isolated anosmia; reduced tyrosine kinase activity. Ref.73 | VAR_031007 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 745 | 1 | P → S in KAL2. Ref.65 Ref.68 | VAR_031008 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 769 | 1 | L → V. Ref.71 Corresponds to variant rs2956723 [ dbSNP | Ensembl ]. | VAR_031009 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 772 | 1 | P → S in KAL2; with cleft palate, unilateral absence of nasal cartilage, iris coloboma. Ref.64 Ref.74 Corresponds to variant rs56234888 [ dbSNP | Ensembl ]. | VAR_017892 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 795 | 1 | V → I in KAL2; also found in a family member with isolated anosmia. Ref.70 | VAR_031010 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 818 | 1 | G → R. Ref.13 Corresponds to variant rs17182456 [ dbSNP | Ensembl ]. | VAR_019291 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 822 | 1 | R → C. Ref.13 Ref.74 Corresponds to variant rs17182463 [ dbSNP | Ensembl ]. | VAR_019292 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 514 | 1 | K → A: Loss of kinase activity. Ref.34 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 546 | 1 | N → K: Strongly increased speed of the first autophosphorylation, and loss of the normal sequential order of autophosphorylation. Ref.47 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 577 | 1 | R → E: Strongly reduced autophosphorylation in response to FGF signaling. No effect on in vitro kinase activity. Ref.60 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 609 | 1 | R → V: Abolishes interaction with PLCG1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 623 | 1 | D → A: Loss of kinase activity. Ref.47 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 653 | 1 | Y → F: No effect on kinase activity. Loss of autophosphorylation and kinase activity; when associated with F-654. Ref.25 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 654 | 1 | Y → F: Reduced kinase activity. Loss of autophosphorylation and kinase activity; when associated with F-653. Ref.25 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 755 | 1 | D → V: Abolishes interaction with PLCG1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 766 | 1 | Y → F: Abolishes interaction with PLCG1 and SHB. Decreases phosphorylation of FRS2, activation of RAS and MAP kinase signaling and stimulation of cell proliferation. Ref.22 Ref.23 Ref.24 Ref.32 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 24 | 1 | S → C in AAA35958. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 24 | 1 | S → C in AAA35959. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 192 | 1 | K → E in AAA35837. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 194 | 1 | G → S in AAA35835. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 196 | 1 | E → G no nucleotide entry Ref.16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 223 | 1 | S → F in BAD96438. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 308 | 1 | V → A in AAA35958. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 308 | 1 | V → A in AAA35959. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 364 | 1 | E → Q in CAA68679. Ref.18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 469 | 1 | P → L in AAA75007. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 482 | 1 | K → R in BAD96438. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 576 | 1 | R → W in BAD96438. Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 817 | 1 | G → R in CAA36101. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 151 – 156 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 158 – 161 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 165 – 169 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 174 – 177 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 180 – 184 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 187 – 192 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 199 – 201 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 207 – 209 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 210 – 213 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 214 – 219 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 222 – 224 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 226 – 234 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 237 – 248 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 265 – 267 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 273 – 276 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 286 – 293 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 295 – 297 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 306 – 313 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 320 – 323 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 325 – 328 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 333 – 335 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 337 – 344 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 349 – 358 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 469 – 471 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 475 – 477 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 478 – 483 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 492 – 498 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 508 – 514 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 522 – 538 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 547 – 551 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 553 – 556 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 558 – 561 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 569 – 574 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 597 – 616 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 626 – 628 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 629 – 631 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 637 – 639 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 648 – 650 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 663 – 666 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 669 – 674 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 679 – 693 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 694 – 696 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 706 – 714 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 727 – 736 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 741 – 743 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 747 – 760 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The complete amino acid sequence of the shorter form of human basic fibroblast growth factor receptor deduced from its cDNA." Itoh N., Terachi T., Ohta M., Seo M.K. Biochem. Biophys. Res. Commun. 169:680-685(1990) [PubMed: 2162671] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 15). Tissue: Placenta. |
| [2] | "Cloning and expression of two distinct high-affinity receptors cross-reacting with acidic and basic fibroblast growth factors." Dionne C.A., Crumley G.R., Bellot F., Kaplow J.M., Searfoss G., Ruta M., Burgess W.H., Jaye M., Schlessinger J. EMBO J. 9:2685-2692(1990) [PubMed: 1697263] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH FGF1 AND FGF2. Tissue: Neonatal brain stem. |
| [3] | "Diverse forms of a receptor for acidic and basic fibroblast growth factors." Johnson D.E., Lee P.L., Lu J., Williams L.T. Mol. Cell. Biol. 10:4728-4736(1990) [PubMed: 2167437] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 6; 15; 17 AND 18). |
| [4] | "Complete sequence of a human receptor for acidic and basic fibroblast growth factors." Isacchi A., Bergonzoni L., Sarmientos P. Nucleic Acids Res. 18:1906-1906(1990) [PubMed: 2159626] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [5] | "cDNA cloning and expression of a human FGF receptor which binds acidic and basic FGF." Wennstroem S., Sandstroem C., Claesson-Welsh L. Growth Factors 4:197-208(1991) [PubMed: 1722683] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 14), INTERACTION WITH FGF1 AND FGF2. Tissue: Teratocarcinoma. |
| [6] | "Molecular cloning of a human basic fibroblast growth factor receptor cDNA and expression of a biologically active extracellular domain in a baculovirus system." Kiefer M.C., Baird A., George-Nascimento C., Nguyen T., Mason O.B., Boley L.J., Valenzuela P., Barr P.J. Growth Factors 5:115-127(1991) [PubMed: 1662973] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 14). |
| [7] | "Alternative splicing generates at least five different isoforms of the human basic-FGF receptor." Eisemann A., Ahn J.A., Graziani G., Tronick S.R., Ron D. Oncogene 6:1195-1202(1991) [PubMed: 1650441] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 6; 14; 15 AND 16). Tissue: Lung. |
| [8] | "Fibroblast growth factor receptors from liver vary in three structural domains." Hou J., Kan M., McKeehan K., McBride G., Adams P., McKeehan W.L. Science 251:665-668(1991) [PubMed: 1846977] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12 AND 13). Tissue: Liver. |
| [9] | "K-sam-related gene, N-sam, encodes fibroblast growth factor receptor and is expressed in T-lymphocytic tumors." Hattori Y., Odagiri H., Katoh O., Sakamoto H., Morita T., Shimotohno K., Tobinai K., Sugimura T., Terada M. Cancer Res. 52:3367-3371(1992) [PubMed: 1317750] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [10] | "A case of Kallmann syndrome carrying a missense mutation in alternatively spliced exon 8A encoding the immunoglobulin-like domain IIIb of fibroblast growth factor receptor 1." Miura K., Miura S., Yoshiura K., Seminara S., Hamaguchi D., Niikawa N., Masuzaki H. Hum. Reprod. 25:1076-1080(2010) [PubMed: 20139426] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 19), ROLE IN DISEASE. |
| [11] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 6; 14 AND 21). Tissue: Placenta and Testis. |
| [12] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 14 AND 20). Tissue: Brain and Colon. |
| [13] | NIEHS SNPs program Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS SER-22; ARG-818 AND CYS-822. |
| [14] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [15] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 14 AND 15), VARIANT GLY-213. Tissue: Pancreas, Testis and Uterus. |
| [16] | "Multivalent ligand-receptor binding interactions in the fibroblast growth factor system produce a cooperative growth factor and heparin mechanism for receptor dimerization." Pantoliano M.W., Horlick R.A., Springer B.A., Van Dyk D.E., Tobery T., Wetmore D.R., Lear J.D., Nahapetian A.T., Bradley J.D., Sisk W.P. Biochemistry 33:10229-10248(1994) [PubMed: 7520751] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-370 (ISOFORM 15), PROTEIN SEQUENCE OF 22-129 (ISOFORM 15). |
| [17] | "Distinct role of 2-O-, N-, and 6-O-sulfate groups of heparin in the formation of the ternary complex with basic fibroblast growth factor and soluble FGF receptor-1." Rusnati M., Coltrini D., Caccia P., Dell'Era P., Zoppetti G., Oreste P., Valsasina B., Presta M. Biochem. Biophys. Res. Commun. 203:450-458(1994) [PubMed: 8074689] [Abstract] Cited for: PROTEIN SEQUENCE OF 81-100 (ISOFORMS 1/2/4/5/14/16). |
| [18] | "A novel protein tyrosine kinase gene whose expression is modulated during endothelial cell differentiation." Ruta M., Howk R., Ricca G., Drohan W., Zabelshansky M., Laureys G., Barton D.E., Francke U., Schlessinger J., Givol D. Oncogene 3:9-15(1988) Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 201-822 (ISOFORMS 1/6/10/14/15). |
| [19] | "The human fibroblast growth factor receptor genes: a common structural arrangement underlies the mechanisms for generating receptor forms that differ in their third immunoglobulin domain." Johnson D.E., Lu J., Chen H., Werner S., Williams L.T. Mol. Cell. Biol. 11:4627-4634(1991) [PubMed: 1652059] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 313-391 (ISOFORMS 17/18), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 313-360 (ISOFORMS 1/2/4/5/6/7/8/9/10/11/12/13/14/15), NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 313-360 (ISOFORM 19), TISSUE SPECIFICITY. Tissue: Foreskin fibroblast and Umbilical vein. |
| [20] | "A novel c-fgr exon utilized in Epstein-Barr virus-infected B lymphocytes but not in normal monocytes." Gutkind S.J., Link D.C., Katamine S., Lacal P., Miki T., Ley T.J., Robbins K.C. Mol. Cell. Biol. 11:1500-1507(1991) [PubMed: 1847500] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA]. |
| [21] | "A tyrosine-phosphorylated carboxy-terminal peptide of the fibroblast growth factor receptor (Flg) is a binding site for the SH2 domain of phospholipase C-gamma 1." Mohammadi M., Honegger A.M., Rotin D., Fischer R., Bellot F., Li W., Dionne C.A., Jaye M., Rubinstein M., Schlessinger J. Mol. Cell. Biol. 11:5068-5078(1991) [PubMed: 1656221] [Abstract] Cited for: INTERACTION WITH PLCG1. |
| [22] | "Point mutation of an FGF receptor abolishes phosphatidylinositol turnover and Ca2+ flux but not mitogenesis." Peters K.G., Marie J., Wilson E., Ives H.E., Escobedo J., del Rosario M., Mirda D., Williams L.T. Nature 358:678-681(1992) [PubMed: 1379697] [Abstract] Cited for: MUTAGENESIS OF TYR-766, FUNCTION, CATALYTIC ACTIVITY, AUTOPHOSPHORYLATION, INTERACTION WITH PLCG1. |
| [23] | "Point mutation in FGF receptor eliminates phosphatidylinositol hydrolysis without affecting mitogenesis." Mohammadi M., Dionne C.A., Li W., Lin N., Spivak T., Honegger A.M., Jaye M., Schlessinger J. Nature 358:681-684(1992) [PubMed: 1379698] [Abstract] Cited for: MUTAGENESIS OF TYR-766, FUNCTION IN CELL PROLIFERATION. |
| [24] | "Internalization of fibroblast growth factor receptor is inhibited by a point mutation at tyrosine 766." Sorokin A., Mohammadi M., Huang J., Schlessinger J. J. Biol. Chem. 269:17056-17061(1994) [PubMed: 7516330] [Abstract] Cited for: MUTAGENESIS OF TYR-766, SUBCELLULAR LOCATION. |
| [25] | "Identification of six novel autophosphorylation sites on fibroblast growth factor receptor 1 and elucidation of their importance in receptor activation and signal transduction." Mohammadi M., Dikic I., Sorokin A., Burgess W.H., Jaye M., Schlessinger J. Mol. Cell. Biol. 16:977-989(1996) [PubMed: 8622701] [Abstract] Cited for: PHOSPHORYLATION AT TYR-463; TYR-583; TYR-585; TYR-653; TYR-654 AND TYR-730, CATALYTIC ACTIVITY, ENZYME REGULATION, FUNCTION IN PHOSPHORYLATION OF PLCG1 AND SHC1; ACTIVATION OF MAP KINASES AND REGULATION OF CELL PROLIFERATION AND DIFFERENTIATION, MUTAGENESIS OF TYR-653 AND TYR-654. |
| [26] | "Receptor specificity of the fibroblast growth factor family." Ornitz D.M., Xu J., Colvin J.S., McEwen D.G., MacArthur C.A., Coulier F., Gao G., Goldfarb M. J. Biol. Chem. 271:15292-15297(1996) [PubMed: 8663044] [Abstract] Cited for: INTERACTION WITH FGF1; FGF2; FGF4; FGF5; FGF6, FUNCTION IN CELL PROLIFERATION. |
| [27] | "Structure of a heparin-linked biologically active dimer of fibroblast growth factor." DiGabriele A.D., Lax I., Chen D.I., Svahn C.M., Jaye M., Schlessinger J., Hendrickson W.A. Nature 393:812-817(1998) [PubMed: 9655399] [Abstract] Cited for: INTERACTION WITH FGF1, PHOSPHORYLATION. |
| [28] | "The t(6;8)(q27;p11) translocation in a stem cell myeloproliferative disorder fuses a novel gene, FOP, to fibroblast growth factor receptor 1." Popovici C., Zhang B., Gregoire M.-J., Jonveaux P., Lafage-Pochitaloff M., Birnbaum D., Pebusque M.-J. Blood 93:1381-1389(1999) [PubMed: 9949182] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH FGFR1OP. |
| [29] | "Grb10, a positive, stimulatory signaling adapter in platelet-derived growth factor BB-, insulin-like growth factor I-, and insulin-mediated mitogenesis." Wang J., Dai H., Yousaf N., Moussaif M., Deng Y., Boufelliga A., Swamy O.R., Leone M.E., Riedel H. Mol. Cell. Biol. 19:6217-6228(1999) [PubMed: 10454568] [Abstract] Cited for: INTERACTION WITH GRB10. |
| [30] | "FGFR1 is fused to the centrosome-associated protein CEP110 in the 8p12 stem cell myeloproliferative disorder with t(8;9)(p12;q33)." Guasch G., Mack G.J., Popovici C., Dastugue N., Birnbaum D., Rattner J.B., Pebusque M.-J. Blood 95:1788-1796(2000) [PubMed: 10688839] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH CEP110. |
| [31] | "Stimulation of phosphatidylinositol 3-kinase by fibroblast growth factor receptors is mediated by coordinated recruitment of multiple docking proteins." Ong S.H., Hadari Y.R., Gotoh N., Guy G.R., Schlessinger J., Lax I. Proc. Natl. Acad. Sci. U.S.A. 98:6074-6079(2001) [PubMed: 11353842] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF FRS2 AND GAB1 AND IN ACTIVATION OF PIK3R1. |
| [32] | "The Shb adaptor protein binds to tyrosine 766 in the FGFR-1 and regulates the Ras/MEK/MAPK pathway via FRS2 phosphorylation in endothelial cells." Cross M.J., Lu L., Magnusson P., Nyqvist D., Holmqvist K., Welsh M., Claesson-Welsh L. Mol. Biol. Cell 13:2881-2893(2002) [PubMed: 12181353] [Abstract] Cited for: FUNCTION IN ACTIVATION OF SIGNALING VIA RAS AND MAP KINASES AND CELL PROLIFERATION, FUNCTION IN PHOSPHORYLATION OF FRS2; SHB AND PTPN11/SHP2, INTERACTION WITH SHB AND FGF2, MUTAGENESIS OF TYR-766. |
| [33] | "Identification of a novel gene, FGFR1OP2, fused to FGFR1 in 8p11 myeloproliferative syndrome." Grand E.K., Grand F.H., Chase A.J., Ross F.M., Corcoran M.M., Oscier D.G., Cross N.C.P. Genes Chromosomes Cancer 40:78-83(2004) [PubMed: 15034873] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH FGFR1OP2. |
| [34] | "90-kDa ribosomal S6 kinase is a direct target for the nuclear fibroblast growth factor receptor 1 (FGFR1): role in FGFR1 signaling." Hu Y., Fang X., Dunham S.M., Prada C., Stachowiak E.K., Stachowiak M.K. J. Biol. Chem. 279:29325-29335(2004) [PubMed: 15117958] [Abstract] Cited for: FUNCTION IN ACTIVATION OF RPS6KA1 AND CREB1, CATALYTIC ACTIVITY, INTERACTION WITH RPS6KA1, MUTAGENESIS OF LYS-514, SUBCELLULAR LOCATION. |
| [35] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed: 16335952] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-296, MASS SPECTROMETRY. Tissue: Plasma. |
| [36] | "Phosphotyrosine profiling identifies the KG-1 cell line as a model for the study of FGFR1 fusions in acute myeloid leukemia." Gu T.-L., Goss V.L., Reeves C., Popova L., Nardone J., Macneill J., Walters D.K., Wang Y., Rush J., Comb M.J., Druker B.J., Polakiewicz R.D. Blood 108:4202-4204(2006) [PubMed: 16946300] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH FGFR1OP2. |
| [37] | "Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family." Zhang X., Ibrahimi O.A., Olsen S.K., Umemori H., Mohammadi M., Ornitz D.M. J. Biol. Chem. 281:15694-15700(2006) [PubMed: 16597617] [Abstract] Cited for: INTERACTION WITH FGF1; FGF8; FGF10; FGF19; FGF21; FGF22 AND FGF23, FUNCTION IN STIMULATION OF CELL PROLIFERATION. |
| [38] | "Factors controlling fibroblast growth factor receptor-1's cytoplasmic trafficking and its regulation as revealed by FRAP analysis." Dunham-Ems S.M., Pudavar H.E., Myers J.M., Maher P.A., Prasad P.N., Stachowiak M.K. Mol. Biol. Cell 17:2223-2235(2006) [PubMed: 16481405] [Abstract] Cited for: SUBCELLULAR LOCATION, GLYCOSYLATION. |
| [39] | "Autophosphorylation of FGFR1 kinase is mediated by a sequential and precisely ordered reaction." Furdui C.M., Lew E.D., Schlessinger J., Anderson K.S. Mol. Cell 21:711-717(2006) [PubMed: 16507368] [Abstract] Cited for: PHOSPHORYLATION AT TYR-463; TYR-653; TYR-654; TYR-583 AND TYR-585, MASS SPECTROMETRY. |
| [40] | "14-3-3 integrates pro-survival signals mediated by the AKT and MAPK pathways in ZNF198-FGFR1 transformed hematopoietic cells." Dong S., Kang S., Gu T., Kardar S., Fu H., Lonial S., Khoury H.J., Khuri F., Chen J. Blood 110:360-369(2007) [PubMed: 17389761] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH FGFR1OP2. |
| [41] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-653, MASS SPECTROMETRY. Tissue: Lung carcinoma. |
| [42] | "Tissue-specific expression of betaKlotho and fibroblast growth factor (FGF) receptor isoforms determines metabolic activity of FGF19 and FGF21." Kurosu H., Choi M., Ogawa Y., Dickson A.S., Goetz R., Eliseenkova A.V., Mohammadi M., Rosenblatt K.P., Kliewer S.A., Kuro-o M. J. Biol. Chem. 282:26687-26695(2007) [PubMed: 17623664] [Abstract] Cited for: INTERACTION WITH FGF19; FGF21 AND KLB, FUNCTION IN REGULATION OF GLUCOSE UPTAKE IN ADIPOCYTES. |
| [43] | "Fibroblast growth factor receptor-induced phosphorylation of STAT1 at the Golgi apparatus without translocation to the nucleus." Citores L., Bai L., Sorensen V., Olsnes S. J. Cell. Physiol. 212:148-156(2007) [PubMed: 17311277] [Abstract] Cited for: FUNCTION IN STAT1 PHOSPHORYLATION, GLYCOSYLATION, PHOSPHORYLATION. |
| [44] | "Ubiquitination of fibroblast growth factor receptor 1 is required for its intracellular sorting but not for its endocytosis." Haugsten E.M., Malecki J., Bjorklund S.M., Olsnes S., Wesche J. Mol. Biol. Cell 19:3390-3403(2008) [PubMed: 18480409] [Abstract] Cited for: UBIQUITINATION, CATALYTIC ACTIVITY, FUNCTION AS FGF1 RECEPTOR AND IN ACTIVATION OF PLCG1; FRS2; MAPK1/ERK2 AND MAPK3/ERK1, ENZYME REGULATION, SUBCELLULAR LOCATION. |
| [45] | "Novel mechanisms of fibroblast growth factor receptor 1 regulation by extracellular matrix protein anosmin-1." Hu Y., Guimond S.E., Travers P., Cadman S., Hohenester E., Turnbull J.E., Kim S.H., Bouloux P.M. J. Biol. Chem. 284:29905-29920(2009) [PubMed: 19696444] [Abstract] Cited for: INTERACTION WITH KAL1. |
| [46] | "Fibroblast growth factor receptor-1 (FGFR1) nuclear dynamics reveal a novel mechanism in transcription control." Dunham-Ems S.M., Lee Y.W., Stachowiak E.K., Pudavar H., Claus P., Prasad P.N., Stachowiak M.K. Mol. Biol. Cell 20:2401-2412(2009) [PubMed: 19261810] [Abstract] Cited for: FUNCTION IN CHROMATIN BINDING AND TRANSCRIPTION REGULATION, SUBCELLULAR LOCATION. |
| [47] | "The precise sequence of FGF receptor autophosphorylation is kinetically driven and is disrupted by oncogenic mutations." Lew E.D., Furdui C.M., Anderson K.S., Schlessinger J. Sci. Signal. 2:RA6-RA6(2009) [PubMed: 19224897] [Abstract] Cited for: FUNCTION AS PROTO-ONCOGENE, ACTIVE SITE, MUTAGENESIS OF ASN-546 AND ASP-623, CATALYTIC ACTIVITY, PHOSPHORYLATION AT TYR-463; TYR-653; TYR-654; TYR-583; TYR-585 AND TYR-730, MASS SPECTROMETRY, ENZYME REGULATION. |
| [48] | "Isolated C-terminal tail of FGF23 alleviates hypophosphatemia by inhibiting FGF23-FGFR-Klotho complex formation." Goetz R., Nakada Y., Hu M.C., Kurosu H., Wang L., Nakatani T., Shi M., Eliseenkova A.V., Razzaque M.S., Moe O.W., Kuro-o M., Mohammadi M. Proc. Natl. Acad. Sci. U.S.A. 107:407-412(2010) [PubMed: 19966287] [Abstract] Cited for: INTERACTION WITH FGF23 AND KLB. |
| [49] | "Nedd4-1 binds and ubiquitylates activated FGFR1 to control its endocytosis and function." Persaud A., Alberts P., Hayes M., Guettler S., Clarke I., Sicheri F., Dirks P., Ciruna B., Rotin D. EMBO J. 30:3259-3273(2011) [PubMed: 21765395] [Abstract] Cited for: FUNCTION IN ACTIVATION OF AKT1; PLCG1; MAPK1/ERK2, MAPK3/ERK1 AND MAP KINASE SIGNALING, FUNCTION IN REGULATION OF NEURONAL DIFFERENTIATION AND EMBRYONIC DEVELOPMENT, SUBCELLULAR LOCATION, INTERACTION WITH NEDD4; PLCG1 AND FRS2, UBIQUITINATION, DEGRADATION. |
| [50] | "The structure and function of vertebrate fibroblast growth factor receptor 1." Groth C., Lardelli M. Int. J. Dev. Biol. 46:393-400(2002) [PubMed: 12141425] [Abstract] Cited for: REVIEW ON ALTERNATIVE SPLICE FORMS; LIGANDS; SIGNALING PATHWAYS AND SUBCELLULAR LOCATION. |
| [51] | "Cellular signaling by fibroblast growth factor receptors." Eswarakumar V.P., Lax I., Schlessinger J. Cytokine Growth Factor Rev. 16:139-149(2005) [PubMed: 15863030] [Abstract] Cited for: REVIEW ON FUNCTION; ROLE IN DISEASE; SIGNALING PATHWAYS; SUBUNIT; DOMAIN STRUCTURE; LIGAND SELECTIVITY AND ENZYME REGULATION. |
| [52] | "Fibroblast growth factor signalling: from development to cancer." Turner N., Grose R. Nat. Rev. Cancer 10:116-129(2010) [PubMed: 20094046] [Abstract] Cited for: REVIEW ON FUNCTION IN FGF SIGNALING. |
| [53] | "Novel insights in FGFR1 regulation: lessons from Kallmann syndrome." Hu Y., Bouloux P.M. Trends Endocrinol. Metab. 21:385-393(2010) [PubMed: 20117945] [Abstract] Cited for: REVIEW ON SIGNALING AND ROLE IN KALLMAN SYNDROME. |
| [54] | "Structure of the FGF receptor tyrosine kinase domain reveals a novel autoinhibitory mechanism." Mohammadi M., Schlessinger J., Hubbard S.R. Cell 86:577-587(1996) [PubMed: 8752212] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 464-762. |
| [55] | "Structures of the tyrosine kinase domain of fibroblast growth factor receptor in complex with inhibitors." Mohammadi M., McMahon G., Sun L., Tang C., Hirth P., Yeh B.K., Hubbard S.R., Schlessinger J. Science 276:955-960(1997) [PubMed: 9139660] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 464-762 IN COMPLEX WITH SU4984. |
| [56] | "Crystal structures of two FGF-FGFR complexes reveal the determinants of ligand-receptor specificity." Plotnikov A.N., Hubbard S.R., Schlessinger J., Mohammadi M. Cell 101:413-424(2000) [PubMed: 10830168] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 141-365 IN COMPLEX WITH FGF1, FUNCTION, DISULFIDE BONDS. |
| [57] | "Crystal structure of a ternary FGF-FGFR-heparin complex reveals a dual role for heparin in FGFR binding and dimerization." Schlessinger J., Plotnikov A.N., Ibrahimi O.A., Eliseenkova A.V., Yeh B.K., Yayon A., Linhardt R.J., Mohammadi M. Mol. Cell 6:743-750(2000) [PubMed: 11030354] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 143-364 IN COMPLEX WITH FGF2 AND HEPARIN, DISULFIDE BONDS. |
| [58] | "Solution structure of the first Ig-like domain of human fibroblast growth factor receptor 1." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 38-124. |
| [59] | "The selectivity of receptor tyrosine kinase signaling is controlled by a secondary SH2 domain binding site." Bae J.H., Lew E.D., Yuzawa S., Tome F., Lax I., Schlessinger J. Cell 138:514-524(2009) [PubMed: 19665973] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 458-774 IN COMPLEX WITH PLCG1 AND ATP ANALOG, FUNCTION, CATALYTIC ACTIVITY, SUBUNIT, AUTOPHOSPHORYLATION, PHOSPHORYLATION AT TYR-653; TYR-654 AND TYR-766. |
| [60] | "Asymmetric receptor contact is required for tyrosine autophosphorylation of fibroblast growth factor receptor in living cells." Bae J.H., Boggon T.J., Tome F., Mandiyan V., Lax I., Schlessinger J. Proc. Natl. Acad. Sci. U.S.A. 107:2866-2871(2010) [PubMed: 20133753] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 458-765 OF MUTANT GLU-577, FUNCTION, CATALYTIC ACTIVITY, SUBUNIT, MUTAGENESIS OF ARG-577. |
| [61] | "A novel mode of protein kinase inhibition exploiting hydrophobic motifs of autoinhibited kinases: discovery of ATP-independent inhibitors of fibroblast growth factor receptor." Eathiraj S., Palma R., Hirschi M., Volckova E., Nakuci E., Castro J., Chen C.R., Chan T.C., France D.S., Ashwell M.A. J. Biol. Chem. 286:20677-20687(2011) [PubMed: 21454610] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.01 ANGSTROMS) OF 461-765 IN COMPLEX WITH ARQ 069, ENZYME REGULATION. |
| [62] | "A common mutation in the fibroblast growth factor receptor 1 gene in Pfeiffer syndrome." Muenke M., Schell U., Hehr A., Robin N.H., Losken H.W., Schinzel A., Pulleyn L.J., Rutland P., Reardon W., Malcolm S., Winter R.M. Nat. Genet. 8:269-274(1994) [PubMed: 7874169] [Abstract] Cited for: VARIANT PS ARG-252. |
| [63] | "An unusual FGFR1 mutation (fibroblast growth factor receptor 1 mutation) in a girl with non-syndromic trigonocephaly." Kress W., Petersen B., Collmann H., Grimm T. Cytogenet. Cell Genet. 91:138-140(2000) [PubMed: 11173846] [Abstract] Cited for: VARIANT TRICEPH THR-300. |
| [64] | "Loss-of-function mutations in FGFR1 cause autosomal dominant Kallmann syndrome." Dode C., Levilliers J., Dupont J.-M., De Paepe A., Le Du N., Soussi-Yanicostas N., Coimbra R.S., Delmaghani S., Compain-Nouaille S., Baverel F., Pecheux C., Le Tessier D., Cruaud C., Delpech M., Speleman F., Vermeulen S., Amalfitano A., Bachelot Y. Hardelin J.-P.Nat. Genet. 33:463-465(2003) [PubMed: 12627230] [Abstract] Cited for: VARIANTS KAL2 ASP-97; CYS-99; SER-167; TYR-277; MET-607; ARG-666; ARG-719 AND SER-772. |
| [65] | "Clinical assessment and mutation analysis of Kallmann syndrome 1 (KAL1) and fibroblast growth factor receptor 1 (FGFR1, or KAL2) in five families and 18 sporadic patients." Sato N., Katsumata N., Kagami M., Hasegawa T., Hori N., Kawakita S., Minowada S., Shimotsuka A., Shishiba Y., Yokozawa M., Yasuda T., Nagasaki K., Hasegawa D., Hasegawa Y., Tachibana K., Naiki Y., Horikawa R., Tanaka T., Ogata T. J. Clin. Endocrinol. Metab. 89:1079-1088(2004) [PubMed: 15001591] [Abstract] Cited for: VARIANT KAL2 SER-745. |
| [66] | "Mutations that cause osteoglophonic dysplasia define novel roles for FGFR1 in bone elongation." White K.E., Cabral J.M., Davis S.I., Fishburn T., Evans W.E., Ichikawa S., Fields J., Yu X., Shaw N.J., McLellan N.J., McKeown C., FitzPatrick D., Yu K., Ornitz D.M., Econs M.J. Am. J. Hum. Genet. 76:361-367(2005) [PubMed: 15625620] [Abstract] Cited for: VARIANTS OGD ILE-330; CYS-374 AND ARG-381, CHARACTERIZATION OF VARIANT OGD CYS-374. |
| [67] | "Kallmann syndrome: 14 novel mutations in KAL1 and FGFR1 (KAL2)." Albuisson J., Pecheux C., Carel J.-C., Lacombe D., Leheup B., Lapuzina P., Bouchard P., Legius E., Matthijs G., Wasniewska M., Delpech M., Young J., Hardelin J.-P., Dode C. Hum. Mutat. 25:98-99(2005) [PubMed: 15605412] [Abstract] Cited for: VARIANTS KAL2 ILE-102; ALA-129; MET-273 AND THR-520. |
| [68] | "Gonadotrophin therapy in Kallmann syndrome caused by heterozygous mutations of the gene for fibroblast growth factor receptor 1: report of three families: case report." Sato N., Hasegawa T., Hori N., Fukami M., Yoshimura Y., Ogata T. Hum. Reprod. 20:2173-2178(2005) [PubMed: 15845591] [Abstract] Cited for: VARIANTS KAL2 ARG-687 AND SER-745. |
| [69] | "Extended mutational analyses of FGFR1 in osteoglophonic dysplasia." Farrow E.G., Davis S.I., Mooney S.D., Beighton P., Mascarenhas L., Gutierrez Y.R., Pitukcheewanont P., White K.E. Am. J. Med. Genet. A 140:537-539(2006) [PubMed: 16470795] [Abstract] Cited for: VARIANTS OGD ILE-330 AND ARG-381. |
| [70] | "Novel fibroblast growth factor receptor 1 mutations in patients with congenital hypogonadotropic hypogonadism with and without anosmia." Trarbach E.B., Costa E.M.F., Versiani B., de Castro M., Baptista M.T.M., Garmes H.M., de Mendonca B.B., Latronico A.C. J. Clin. Endocrinol. Metab. 91:4006-4012(2006) [PubMed: 16882753] [Abstract] Cited for: VARIANT IHH SER-48, VARIANT IHH/KAL2 LEU-366, VARIANTS KAL2 PRO-245; TRP-250; VAL-343; SER-722 AND ILE-795. |
| [71] | "Mutations in fibroblast growth factor receptor 1 cause Kallmann syndrome with a wide spectrum of reproductive phenotypes." Pitteloud N., Meysing A., Quinton R., Acierno J.S. Jr., Dwyer A.A., Plummer L., Fliers E., Boepple P., Hayes F., Seminara S., Hughes V.A., Ma J., Bouloux P., Mohammadi M., Crowley W.F. Jr. Mol. Cell. Endocrinol. 254:60-69(2006) [PubMed: 16764984] [Abstract] Cited for: VARIANTS KAL2 CYS-78; ILE-102; HIS-224; ASP-237; GLN-254; MET-273; GLY-274 CYS-339; CYS-346; VAL-538; ARG-703 AND SER-703, VARIANT VAL-769. |
| [72] | "Paediatric phenotype of Kallmann syndrome due to mutations of fibroblast growth factor receptor 1 (FGFR1)." Zenaty D., Bretones P., Lambe C., Guemas I., David M., Leger J., de Roux N. Mol. Cell. Endocrinol. 254:78-83(2006) [PubMed: 16757108] [Abstract] Cited for: VARIANTS KAL2 SER-178; GLY-622 AND GLN-622. |
| [73] | "Mutations in fibroblast growth factor receptor 1 cause both Kallmann syndrome and normosmic idiopathic hypogonadotropic hypogonadism." Pitteloud N., Acierno J.S. Jr., Meysing A., Eliseenkova A.V., Ma J., Ibrahimi O.A., Metzger D.L., Hayes F.J., Dwyer A.A., Hughes V.A., Yialamas M., Hall J.E., Grant E., Mohammadi M., Crowley W.F. Jr. Proc. Natl. Acad. Sci. U.S.A. 103:6281-6286(2006) [PubMed: 16606836] [Abstract] Cited for: VARIANT IHH/KAL2 SER-237, VARIANTS IHH HIS-722 AND LYS-724, CHARACTERIZATION OF VARIANT IHH/KAL2 SER-237, CHARACTERIZATION OF VARIANTS IHH HIS-722 AND LYS-724. |
| [74] | "Novel FGFR1 sequence variants in Kallmann syndrome, and genetic evidence that the FGFR1c isoform is required in olfactory bulb and palate morphogenesis." Dode C., Fouveaut C., Mortier G., Janssens S., Bertherat J., Mahoudeau J., Kottler M.-L., Chabrolle C., Gancel A., Francois I., Devriendt K., Wolczynski S., Pugeat M., Pineiro-Garcia A., Murat A., Bouchard P., Young J., Delpech M., Hardelin J.-P. Hum. Mutat. 28:97-98(2007) [PubMed: 17154279] [Abstract] Cited for: VARIANTS KAL2 PHE-101; TRP-250; ASP-270; ARG-283; CYS-332; ARG-621; PHE-685; PHE-693 AND SER-772, VARIANTS LYS-77 AND CYS-822. |
| [75] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-125; THR-252 AND LEU-664. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M37722 mRNA. Translation: AAA75007.1. X52833 mRNA. Translation: CAA37015.1. M34185 mRNA. Translation: AAA35836.1. M34186 mRNA. Translation: AAA35837.1. M34187 mRNA. Translation: AAA35838.1. M34188 mRNA. Translation: AAA35839.1. X51803 mRNA. Translation: CAA36101.1. M34641 mRNA. Translation: AAA35835.1. M60485 mRNA. Translation: AAA35840.1. X57118 mRNA. Translation: CAA40400.1. X57119 mRNA. Translation: CAA40401.1. X57120 mRNA. Translation: CAA40402.1. X57121 mRNA. Translation: CAA40403.1. X57122 mRNA. Translation: CAA40404.1. M63887 mRNA. Translation: AAA35958.1. M63888 mRNA. Translation: AAA35959.1. M63889 mRNA. Translation: AAA35960.1. X66945 mRNA. Translation: CAA47375.1. FJ809917 mRNA. Translation: ACO38646.1. AK291754 mRNA. Translation: BAF84443.1. AK292470 mRNA. Translation: BAF85159.1. AK309947 mRNA. No translation available. AB208919 mRNA. Translation: BAD92156.1. Different initiation. AK222718 mRNA. Translation: BAD96438.1. AY585209 Genomic DNA. Translation: AAS79322.1. AC087623 Genomic DNA. No translation available. BC015035 mRNA. Translation: AAH15035.1. BC018128 mRNA. Translation: AAH18128.1. BC091494 mRNA. Translation: AAH91494.1. Y00665 mRNA. Translation: CAA68679.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00005142. IPI00012036. IPI00012039. IPI00012042. IPI00165947. IPI00216859. IPI00220983. IPI00328245. IPI00332838. IPI00410124. IPI00410125. IPI00410216. IPI00410217. IPI00410218. IPI00410219. IPI00410220. IPI00410223. IPI00455176. IPI00954560. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | A41266. C36464. C40862. TVHUFG. S11692. A40862. S19167. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001167534.1. NM_001174063.1. NP_001167535.1. NM_001174064.1. NP_001167536.1. NM_001174065.1. NP_001167537.1. NM_001174066.1. NP_001167538.1. NM_001174067.1. NP_056934.2. NM_015850.3. NP_075593.1. NM_023105.2. NP_075594.1. NM_023106.2. NP_075598.2. NM_023110.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.264887. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P11362. Positions 32-359, 457-764. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-4019N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P11362. 7 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-1499363. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 120046. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000341462; ENSP00000340636; ENSG00000077782. ENST00000397091; ENSP00000380280; ENSG00000077782. ENST00000397108; ENSP00000380297; ENSG00000077782. ENST00000397113; ENSP00000380302; ENSG00000077782. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 2260. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:2260. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003xlp.1. human. uc003xlu.1. human. uc003xlv.1. human. uc010lwg.1. human. uc010lwh.1. human. uc010lwj.1. human. uc010lwk.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 2260. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC08M038268. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:3688. FGFR1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB033614. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 101600. phenotype. 136350. gene. 146110. phenotype. 147950. phenotype. 166250. phenotype. 190440. phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 3366. Isolated trigonocephaly. 478. Kallmann syndrome. 2326. Kallmann syndrome - heart disease. 168953. Myeloid neoplasm associated with FGFR1 rearrangement. 432. Normosmic congenital hypogonadotropic hypogonadism. 2645. Osteoglophonic dwarfism. 93258. Pfeiffer syndrome type 1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA28127. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG14717. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00600000084001. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG000345. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | VIVYKMK. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4BCDMC. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 2.7.10.1. 2681. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | fgf_pathway. FGF signaling pathway. glypican_1pathway. Glypican 1 network. syndecan_4_pathway. Syndecan-4-mediated signaling events. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. REACT_111102. Signal Transduction. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_FGFR1. HS_FLG. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000077782. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR007110. Ig-like. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003598. Ig_sub2. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase. IPR008266. Tyr_kinase_AS. IPR020635. Tyr_kinase_cat_dom. IPR016248. Tyr_kinase_fibroblast_GF_rcpt. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 3 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K04362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF07679. I-set. 3 hits. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF000628. FGFR. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00109. TYRKINASE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00408. IGc2. 3 hits. SM00219. TyrKc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50835. IG_LIKE. 3 hits. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00039. Palifermin. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 9163. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | FGFR1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P11362 Secondary accession number(s): A8K6T9 Q9UDF2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with