Reviewed,
UniProtKB/Swiss-Prot P11362 (FGFR1_HUMAN)
Last modified
June 16, 2009.
Version 137.
History...
Clusters with 100%,
90%,
50% identity |
Documents (8) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Basic fibroblast growth factor receptor 1 Short name=FGFR-1 Short name=bFGF-R EC=2.7.10.1 Alternative name(s): Fms-like tyrosine kinase 2 c-fgr CD_antigen=CD331 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 822 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Receptor for basic fibroblast growth factor. A shorter form of the receptor could be a receptor for FGF1 (aFGF). |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. |
| Subunit structure | Interacts with SHB. Interacts with KLB By similarity. |
| Subcellular location | |
| Post-translational modification | Binding of FGF1 and heparin promotes autophosphorylation on tyrosine residues and activation of the receptor. |
| Involvement in disease | Defects in FGFR1 are a cause of Pfeiffer syndrome (PS) [MIM:101600]; also known as acrocephalosyndactyly type V (ACS5). PS is characterized by craniosynostosis (premature fusion of the skull sutures) with deviation and enlargement of the thumbs and great toes, brachymesophalangy, with phalangeal ankylosis and a varying degree of soft tissue syndactyly. Ref.32 Defects in FGFR1 are a cause of idiopathic hypogonadotropic hypogonadism (IHH) [MIM:146110]. IHH is defined as a deficiency of the pituitary secretion of follicle-stimulating hormone and luteinizing hormone, which results in the impairment of pubertal maturation and of reproductive function. Ref.40 Ref.43 Defects in FGFR1 are the cause of Kallmann syndrome type 2 (KAL2) [MIM:147950]; also known as hypogonadotropic hypogonadism and anosmia. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin-releasing hormone-synthesizing neurons. In some cases, midline cranial anomalies (cleft lip/palate and imperfect fusion) are present and anosmia may be absent or inconspicuous. Ref.40 Ref.34 Ref.35 Ref.37 Ref.38 Ref.41 Ref.42 Ref.44 Defects in FGFR1 are the cause of osteoglophonic dysplasia (OGD) [MIM:166250]; also known as osteoglophonic dwarfism. OGD is characterized by craniosynostosis, prominent supraorbital ridge, and depressed nasal bridge, as well as by rhizomelic dwarfism and nonossifying bone lesions. Inheritance is autosomal dominant. Ref.36 Ref.39 Defects in FGFR1 are the cause of non-syndromic trigonocephaly [MIM:190440]; also known as metopic craniosynostosis. The term trigonocephaly describes the typical keel-shaped deformation of the forehead resulting from premature fusion of the frontal suture. Trigonocephaly may occur also as a part of a syndrome. Ref.33 A chromosomal aberration involving FGFR1 may be a cause of stem cell leukemia lymphoma syndrome (SCLL). Translocation t(8;13)(p11;q12) with ZMYM2. SCLL usually presents as lymphoblastic lymphoma in association with a myeloproliferative disorder, often accompanied by pronounced peripheral eosinophilia and/or prominent eosinophilic infiltrates in the affected bone marrow. A chromosomal aberration involving FGFR1 may be a cause of stem cell myeloproliferative disorder (MPD). Translocation t(6;8)(q27;p11) with FGFR1OP. Insertion ins(12;8)(p11;p11p22) with FGFR1OP2. MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma. In general it progresses to acute myeloid leukemia. The fusion proteins FGFR1OP2-FGFR1, FGFR1OP-FGFR1 or FGFR1-FGFR1OP may exhibit constitutive kinase activity and be responsible for the transforming activity. A chromosomal aberration involving FGFR1 may be a cause of stem cell myeloproliferative disorder (MPD). Translocation t(8;9)(p12;q33) with CEP110. MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma. In general it progresses to acute myeloid leukemia. The fusion protein CEP110-FGFR1 is found in the cytoplasm, exhibits constitutive kinase activity and may be responsible for the transforming activity. |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily. Contains 3 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CDH1 | P12830 | 1 | EBI-1028277,EBI-727477 | |
| CTNNB1 | P35222 | 1 | EBI-1028277,EBI-491549 |
Alternative products
| This entry describes 18 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P11362-1) Also known as: Alpha A1; IV; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P11362-8) Also known as: Alpha A2; The sequence of this isoform differs from the canonical sequence as follows: 619-662: CIHRDLAARN...YYKKTTNGRL → VWNLKAPLVH...RTGHSPHRLL 663-822: Missing. | ||||||
| Isoform 3 (identifier: P11362-17) Also known as: Alpha A3; The sequence of this isoform differs from the canonical sequence as follows: 32-61: QPWGAPVEVESFLVHPGDLLQLRCRLRDDV → CPDLQEAKSCSASFHSITPLPFGLGTRLSD 62-822: Missing. | ||||||
| Isoform 4 (identifier: P11362-2) Also known as: Alpha B1; The sequence of this isoform differs from the canonical sequence as follows: 428-429: Missing. | ||||||
| Isoform 5 (identifier: P11362-9) Also known as: Alpha B2; The sequence of this isoform differs from the canonical sequence as follows: 428-429: Missing. 619-662: CIHRDLAARN...YYKKTTNGRL → VWNLKAPLVH...RTGHSPHRLL 663-822: Missing. | ||||||
| Isoform 6 (identifier: P11362-3) Also known as: Beta A1; II; H2; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. | ||||||
| Isoform 7 (identifier: P11362-10) Also known as: Beta A2; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. 619-662: CIHRDLAARN...YYKKTTNGRL → VWNLKAPLVH...RTGHSPHRLL 663-822: Missing. | ||||||
| Isoform 8 (identifier: P11362-4) Also known as: Beta B1; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. 428-429: Missing. | ||||||
| Isoform 9 (identifier: P11362-11) Also known as: Beta B2; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. 428-429: Missing. 619-662: CIHRDLAARN...YYKKTTNGRL → VWNLKAPLVH...RTGHSPHRLL 663-822: Missing. | ||||||
| Isoform 10 (identifier: P11362-5) Also known as: Gamma A1; The sequence of this isoform differs from the canonical sequence as follows: 1-160: Missing. | ||||||
| Isoform 11 (identifier: P11362-12) Also known as: Gamma A2; The sequence of this isoform differs from the canonical sequence as follows: 1-160: Missing. 619-662: CIHRDLAARN...YYKKTTNGRL → VWNLKAPLVH...RTGHSPHRLL 663-822: Missing. | ||||||
| Isoform 12 (identifier: P11362-6) Also known as: Gamma B1; The sequence of this isoform differs from the canonical sequence as follows: 1-160: Missing. 428-429: Missing. | ||||||
| Isoform 13 (identifier: P11362-13) Also known as: Gamma B2; The sequence of this isoform differs from the canonical sequence as follows: 1-160: Missing. 428-429: Missing. 619-662: CIHRDLAARN...YYKKTTNGRL → VWNLKAPLVH...RTGHSPHRLL 663-822: Missing. | ||||||
| Isoform 14 (identifier: P11362-7) Also known as: A; III; The sequence of this isoform differs from the canonical sequence as follows: 148-149: Missing. | ||||||
| Isoform 15 (identifier: P11362-14) Also known as: I; H3; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. 148-149: Missing. | ||||||
| Isoform 16 (identifier: P11362-15) Also known as: V; The sequence of this isoform differs from the canonical sequence as follows: 120-150: DALPSSEDDDDDDDSSSEEKETDNTKPNRMP → ACPDLQEAKWCSASFHSITPLPFGLGTRLSD 151-822: Missing. | ||||||
| Isoform 17 (identifier: P11362-16) Also known as: H4; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. 313-391: TAGVNTTDKE...TGAFLISCMV → VIMAPVFVGQ...RAAGMGGAGL 392-822: Missing. | ||||||
| Isoform 18 (identifier: P11362-18) Also known as: H5; The sequence of this isoform differs from the canonical sequence as follows: 31-119: Missing. 148-149: Missing. 313-391: TAGVNTTDKE...TGAFLISCMV → VIMAPVFVGQ...RAAGMGGAGL 392-822: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 22 – 822 | 801 | Basic fibroblast growth factor receptor 1 | PRO_0000016780 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 22 – 376 | 355 | Extracellular Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 377 – 397 | 21 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 398 – 822 | 425 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 25 – 119 | 95 | Ig-like C2-type 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 158 – 246 | 89 | Ig-like C2-type 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 255 – 357 | 103 | Ig-like C2-type 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 478 – 767 | 290 | Protein kinase | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 484 – 492 | 9 | ATP By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 160 – 177 | 18 | Heparin-binding | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 623 | 1 | Proton acceptor By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 514 | 1 | ATP By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 428 – 429 | 2 | Breakpoint for translocation to form CEP110-FGFR1 OR FGFR1-CEP110 fusion proteins | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 428 – 429 | 2 | Breakpoint for translocation to form FGFR1OP-FGFR1 or FGFR1-FGFR1OP fusion proteins | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 428 – 429 | 2 | Breakpoint for translocation to form FGFR1OP2-FGFR1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 766 | 1 | Mediates interaction with PLC-gamma and SHB | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 653 | 1 | Phosphotyrosine Ref.26 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 654 | 1 | Phosphotyrosine; by autocatalysis By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 766 | 1 | Phosphotyrosine; by autocatalysis | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 77 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 117 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 227 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 240 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 264 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 296 | 1 | N-linked (GlcNAc...) Ref.23 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 317 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 330 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 55 ↔ 101 | Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 178 ↔ 230 | Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 277 ↔ 341 | Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 160 | 160 | Missing in isoform 10, isoform 11, isoform 12 and isoform 13. | VSP_002957 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 31 – 119 | 89 | Missing in isoform 6, isoform 7, isoform 8, isoform 9, isoform 15, isoform 17 and isoform 18. | VSP_002958 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 32 – 61 | 30 | QPWGA…LRDDV → CPDLQEAKSCSASFHSITPL PFGLGTRLSD in isoform 3. | VSP_009836 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 62 – 822 | 761 | Missing in isoform 3. | VSP_009837 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 120 – 150 | 31 | DALPS…PNRMP → ACPDLQEAKWCSASFHSITP LPFGLGTRLSD in isoform 16. | VSP_009838 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 148 – 149 | 2 | Missing in isoform 14, isoform 15 and isoform 18. | VSP_002959 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 151 – 822 | 672 | Missing in isoform 16. | VSP_009839 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 313 – 391 | 79 | TAGVN…ISCMV → VIMAPVFVGQSTGKETTVSG AQVPVGRLSCPRMGSFLTLQ AHTLHLSRDLATSPRTSNRG HKVEVSWEQRAAGMGGAGL in isoform 17 and isoform 18. | VSP_009840 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 392 – 822 | 431 | Missing in isoform 17 and isoform 18. | VSP_009841 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 428 – 429 | 2 | Missing in isoform 4, isoform 5, isoform 8, isoform 9, isoform 12 and isoform 13. | VSP_002960 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 619 – 662 | 44 | CIHRD…TNGRL → VWNLKAPLVHTPRPGSQECP GDRGQCDEDSRLWPRTGHSP HRLL in isoform 2, isoform 5, isoform 7, isoform 9, isoform 11 and isoform 13. | VSP_009842 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 663 – 822 | 160 | Missing in isoform 2, isoform 5, isoform 7, isoform 9, isoform 11 and isoform 13. | VSP_009843 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 22 | 1 | R → S: dbSNP rs17175750. Ref.11 | VAR_019290 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 48 | 1 | G → S in IHH. Ref.40 | VAR_030968 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 77 | 1 | N → K Ref.44 | VAR_030969 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 78 | 1 | R → C in KAL2. Ref.41 | VAR_030970 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 97 | 1 | G → D in KAL2. Ref.34 | VAR_017885 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 99 | 1 | Y → C in KAL2. Ref.34 | VAR_017886 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 101 | 1 | C → F in KAL2. Ref.44 | VAR_030971 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 102 | 1 | V → I in KAL2. Ref.37 Ref.41 | VAR_030972 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 125 | 1 | S → L in a breast infiltrating ductal carcinoma sample; somatic mutation. Ref.45 | VAR_042201 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 129 | 1 | D → A in KAL2. Ref.37 | VAR_030973 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 167 | 1 | A → S in KAL2; with cleft palate, corpus callosum agenesis, unilateral deafness and fusion of fourth and fifth metacarpal bones. Ref.34 | VAR_017887 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 178 | 1 | C → S in KAL2; with severe ear anomalies. Ref.42 | VAR_030974 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 213 | 1 | W → G: dbSNP rs17851623. Ref.12 | VAR_030975 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 224 | 1 | D → H in KAL2. Ref.41 | VAR_030976 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 237 | 1 | G → D in KAL2. Ref.41 | VAR_030977 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 237 | 1 | G → S in IHH/KAL2; also found in a family member with isolated anosmia; may impair proper folding. Ref.43 | VAR_030978 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 245 | 1 | L → P in KAL2. Ref.40 | VAR_030979 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 250 | 1 | R → W in KAL2. Ref.40 Ref.44 | VAR_030980 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 252 | 1 | P → R in PS; seems to be a gain of function. Ref.32 | VAR_004111 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 252 | 1 | P → T in a lung bronchoalveolar carcinoma sample; somatic mutation. Ref.32 Ref.45 | VAR_042202 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 254 | 1 | R → Q in KAL2. Ref.41 | VAR_030981 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 270 | 1 | G → D in KAL2. Ref.44 | VAR_030982 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 273 | 1 | V → M in KAL2. Ref.37 Ref.41 | VAR_030983 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 274 | 1 | E → G in KAL2; also found in a family member with isolated anosmia. Ref.41 | VAR_030984 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 277 | 1 | C → Y in KAL2. Ref.34 | VAR_017888 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 283 | 1 | P → R in KAL2. Ref.44 | VAR_030985 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 300 | 1 | I → T in non-syndromic trigonocephaly. Ref.33 | VAR_030986 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 330 | 1 | N → I in OGD. Ref.36 Ref.39 | VAR_030987 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 332 | 1 | S → C in KAL2. Ref.44 | VAR_030988 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 339 | 1 | Y → C in KAL2. Ref.41 | VAR_030989 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 343 | 1 | A → V in KAL2. Ref.40 | VAR_030990 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 346 | 1 | S → C in KAL2; also found in a family member with isolated anosmia. Ref.41 | VAR_030991 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 366 | 1 | P → L in IHH/KAL2. Ref.40 | VAR_030992 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 374 | 1 | Y → C in OGD; elevated basal activity and increased FGF2-mediated activity. Ref.36 | VAR_030993 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 381 | 1 | C → R in OGD. Ref.36 Ref.39 | VAR_030994 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 520 | 1 | A → T in KAL2. Ref.37 | VAR_030995 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 538 | 1 | I → V in KAL2. Ref.41 | VAR_030996 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 607 | 1 | V → M in KAL2; with bimanual synkinesis. Ref.34 | VAR_017889 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 621 | 1 | H → R in KAL2. Ref.44 | VAR_030997 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 622 | 1 | R → G in KAL2; with severe ear anomalies. Ref.42 | VAR_030998 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 622 | 1 | R → Q in KAL2. Ref.42 | VAR_030999 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 664 | 1 | V → L in a lung large cell carcinoma sample; somatic mutation. Ref.45 | VAR_042203 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 666 | 1 | W → R in KAL2; with cleft palate. Ref.34 | VAR_017890 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 685 | 1 | S → F in KAL2. Ref.44 | VAR_031000 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 687 | 1 | G → R in KAL2. Ref.38 | VAR_031001 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 693 | 1 | I → F in KAL2. Ref.44 | VAR_031002 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 703 | 1 | G → R in KAL2. Ref.41 | VAR_031003 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 703 | 1 | G → S in KAL2. Ref.41 | VAR_031004 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 719 | 1 | M → R in KAL2. Ref.34 | VAR_017891 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 722 | 1 | P → H in IHH; associated with K-724; also found in a family member with isolated anosmia; reduced tyrosine kinase activity. Ref.43 | VAR_031005 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 722 | 1 | P → S in KAL2. Ref.40 | VAR_031006 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 724 | 1 | N → K in IHH; associated with H-722; also found in a family member with isolated anosmia; reduced tyrosine kinase activity. Ref.43 | VAR_031007 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 745 | 1 | P → S in KAL2. Ref.35 Ref.38 | VAR_031008 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 769 | 1 | L → V: dbSNP rs2956723. Ref.41 | VAR_031009 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 772 | 1 | P → S in KAL2; with cleft palate, unilateral absence of nasal cartilage, iris coloboma. Ref.34 Ref.44 | VAR_017892 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 795 | 1 | V → I in KAL2; also found in a family member with isolated anosmia. Ref.40 | VAR_031010 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 818 | 1 | G → R: dbSNP rs17182456. Ref.11 | VAR_019291 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 822 | 1 | R → C: dbSNP rs17182463. Ref.44 Ref.11 | VAR_019292 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 766 | 1 | Y → F: Fails to interact with PLC-gamma and SHB. Ref.16 Ref.17 Ref.21 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 24 | 1 | S → C in AAA35958. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 24 | 1 | S → C in AAA35959. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 192 | 1 | K → E in AAA35837. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 194 | 1 | G → S in AAA35835. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 308 | 1 | V → A in AAA35958. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 308 | 1 | V → A in AAA35959. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 364 | 1 | E → Q in CAA68679. Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 469 | 1 | P → L in AAA75007. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 817 | 1 | G → R in CAA36101. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 817 | 1 | G → R in CAA01958. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 151 – 156 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 158 – 161 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 165 – 169 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 174 – 177 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 180 – 184 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 187 – 192 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 199 – 201 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 207 – 209 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 210 – 213 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 214 – 219 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 222 – 224 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 226 – 234 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 237 – 248 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 265 – 267 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 273 – 276 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 286 – 293 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 295 – 297 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 306 – 313 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 320 – 323 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 325 – 328 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 333 – 335 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 337 – 344 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 349 – 358 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 469 – 471 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 475 – 477 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 478 – 483 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 492 – 498 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 508 – 514 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 522 – 538 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 547 – 551 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 553 – 556 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 558 – 561 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 569 – 574 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 597 – 616 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 626 – 628 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 629 – 631 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 637 – 639 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 648 – 650 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 663 – 666 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 669 – 674 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 679 – 693 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 694 – 696 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 706 – 714 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 727 – 736 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 741 – 743 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 747 – 760 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequence of a human receptor for acidic and basic fibroblast growth factors." Isacchi A., Bergonzoni L., Sarmientos P. Nucleic Acids Res. 18:1906-1906(1990) [PubMed: 2159626] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [2] | "Cloning and expression of two distinct high-affinity receptors cross-reacting with acidic and basic fibroblast growth factors." Dionne C.A., Crumley G.R., Bellot F., Kaplow J.M., Searfoss G., Ruta M., Burgess W.H., Jaye M., Schlessinger J. EMBO J. 9:2685-2692(1990) [PubMed: 1697263] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Neonatal brain stem. |
| [3] | "K-sam-related gene, N-sam, encodes fibroblast growth factor receptor and is expressed in T-lymphocytic tumors." Hattori Y., Odagiri H., Katoh O., Sakamoto H., Morita T., Shimotohno K., Tobinai K., Sugimura T., Terada M. Cancer Res. 52:3367-3371(1992) [PubMed: 1317750] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Fibroblast growth factor receptors from liver vary in three structural domains." Hou J., Kan M., McKeehan K., McBride G., Adams P., McKeehan W.L. Science 251:665-668(1991) [PubMed: 1846977] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12 AND 13). Tissue: Liver. |
| [5] | "Molecular cloning of a human basic fibroblast growth factor receptor cDNA and expression of a biologically active extracellular domain in a baculovirus system." Kiefer M.C., Baird A., George-Nascimento C., Nguyen T., Mason O.B., Boley L.J., Valenzuela P., Barr P.J. Growth Factors 5:115-127(1991) [PubMed: 1662973] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 14). |
| [6] | "The complete amino acid sequence of the shorter form of human basic fibroblast growth factor receptor deduced from its cDNA." Itoh N., Terachi T., Ohta M., Seo M.K. Biochem. Biophys. Res. Commun. 169:680-685(1990) [PubMed: 2162671] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 15). Tissue: Placenta. |
| [7] | "Diverse forms of a receptor for acidic and basic fibroblast growth factors." Johnson D.E., Lee P.L., Lu J., Williams L.T. Mol. Cell. Biol. 10:4728-4736(1990) [PubMed: 2167437] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 6; 15; 17 AND 18). |
| [8] | "Alternative splicing generates at least five different isoforms of the human basic-FGF receptor." Eisemann A., Ahn J.A., Graziani G., Tronick S.R., Ron D. Oncogene 6:1195-1202(1991) [PubMed: 1650441] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 6; 14; 15 AND 16). Tissue: Lung. |
| [9] | "cDNA cloning and expression of a human FGF receptor which binds acidic and basic FGF." Wennstroem S., Sandstroem C., Claesson-Welsh L. Growth Factors 4:197-208(1991) [PubMed: 1722683] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 14). Tissue: Teratocarcinoma. |
| [10] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 6 AND 14). Tissue: Placenta and Testis. |
| [11] | NIEHS SNPs program Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS SER-22; ARG-818 AND CYS-822. |
| [12] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 14 AND 15), VARIANT GLY-213. Tissue: Testis and Uterus. |
| [13] | "A novel protein tyrosine kinase gene whose expression is modulated during endothelial cell differentiation." Ruta M., Howk R., Ricca G., Drohan W., Zabelshansky M., Laureys G., Barton D.E., Francke U., Schlessinger J., Givol D. Oncogene 3:9-15(1988) Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 201-822. |
| [14] | "A novel c-fgr exon utilized in Epstein-Barr virus-infected B lymphocytes but not in normal monocytes." Gutkind S.J., Link D.C., Katamine S., Lacal P., Miki T., Ley T.J., Robbins K.C. Mol. Cell. Biol. 11:1500-1507(1991) [PubMed: 1847500] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA]. |
| [15] | "Distinct role of 2-O-, N-, and 6-O-sulfate groups of heparin in the formation of the ternary complex with basic fibroblast growth factor and soluble FGF receptor-1." Rusnati M., Coltrini D., Caccia P., Dell'Era P., Zoppetti G., Oreste P., Valsasina B., Presta M. Biochem. Biophys. Res. Commun. 203:450-458(1994) [PubMed: 8074689] [Abstract] Cited for: PROTEIN SEQUENCE OF 81-100. |
| [16] | "Point mutation of an FGF receptor abolishes phosphatidylinositol turnover and Ca2+ flux but not mitogenesis." Peters K.G., Marie J., Wilson E., Ives H.E., Escobedo J., del Rosario M., Mirda D., Williams L.T. Nature 358:678-681(1992) [PubMed: 1379697] [Abstract] Cited for: MUTAGENESIS OF TYR-766. |
| [17] | "Point mutation in FGF receptor eliminates phosphatidylinositol hydrolysis without affecting mitogenesis." Mohammadi M., Dionne C.A., Li W., Lin N., Spivak T., Honegger A.M., Jaye M., Schlessinger J. Nature 358:681-684(1992) [PubMed: 1379698] [Abstract] Cited for: MUTAGENESIS OF TYR-766. |
| [18] | "Structure of a heparin-linked biologically active dimer of fibroblast growth factor." DiGabriele A.D., Lax I., Chen D.I., Svahn C.M., Jaye M., Schlessinger J., Hendrickson W.A. Nature 393:812-817(1998) [PubMed: 9655399] [Abstract] Cited for: INTERACTION WITH FGF1, PHOSPHORYLATION. |
| [19] | "The t(6;8)(q27;p11) translocation in a stem cell myeloproliferative disorder fuses a novel gene, FOP, to fibroblast growth factor receptor 1." Popovici C., Zhang B., Gregoire M.-J., Jonveaux P., Lafage-Pochitaloff M., Birnbaum D., Pebusque M.-J. Blood 93:1381-1389(1999) [PubMed: 9949182] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH FGFR1OP. |
| [20] | "FGFR1 is fused to the centrosome-associated protein CEP110 in the 8p12 stem cell myeloproliferative disorder with t(8;9)(p12;q33)." Guasch G., Mack G.J., Popovici C., Dastugue N., Birnbaum D., Rattner J.B., Pebusque M.-J. Blood 95:1788-1796(2000) [PubMed: 10688839] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH CEP110. |
| [21] | "The Shb adaptor protein binds to tyrosine 766 in the FGFR-1 and regulates the Ras/MEK/MAPK pathway via FRS2 phosphorylation in endothelial cells." Cross M.J., Lu L., Magnusson P., Nyqvist D., Holmqvist K., Welsh M., Claesson-Welsh L. Mol. Biol. Cell 13:2881-2893(2002) [PubMed: 12181353] [Abstract] Cited for: INTERACTION WITH SHB, MUTAGENESIS OF TYR-766. |
| [22] | "Identification of a novel gene, FGFR1OP2, fused to FGFR1 in 8p11 myeloproliferative syndrome." Grand E.K., Grand F.H., Chase A.J., Ross F.M., Corcoran M.M., Oscier D.G., Cross N.C.P. Genes Chromosomes Cancer 40:78-83(2004) [PubMed: 15034873] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH FGFR1OP2. |
| [23] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed: 16335952] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-296, MASS SPECTROMETRY. Tissue: Plasma. |
| [24] | "Phosphotyrosine profiling identifies the KG-1 cell line as a model for the study of FGFR1 fusions in acute myeloid leukemia." Gu T.-L., Goss V.L., Reeves C., Popova L., Nardone J., Macneill J., Walters D.K., Wang Y., Rush J., Comb M.J., Druker B.J., Polakiewicz R.D. Blood 108:4202-4204(2006) [PubMed: 16946300] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH FGFR1OP2. |
| [25] | "14-3-3 integrates pro-survival signals mediated by the AKT and MAPK pathways in ZNF198-FGFR1 transformed hematopoietic cells." Dong S., Kang S., Gu T., Kardar S., Fu H., Lonial S., Khoury H.J., Khuri F., Chen J. Blood 110:360-369(2007) [PubMed: 17389761] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH FGFR1OP2. |
| [26] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-653, MASS SPECTROMETRY. |
| [27] | "Structure of the FGF receptor tyrosine kinase domain reveals a novel autoinhibitory mechanism." Mohammadi M., Schlessinger J., Hubbard S.R. Cell 86:577-587(1996) [PubMed: 8752212] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 464-762. |
| [28] | "Structures of the tyrosine kinase domain of fibroblast growth factor receptor in complex with inhibitors." Mohammadi M., McMahon G., Sun L., Tang C., Hirth P., Yeh B.K., Hubbard S.R., Schlessinger J. Science 276:955-960(1997) [PubMed: 9139660] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 464-762. |
| [29] | "Crystal structures of two FGF-FGFR complexes reveal the determinants of ligand-receptor specificity." Plotnikov A.N., Hubbard S.R., Schlessinger J., Mohammadi M. Cell 101:413-424(2000) [PubMed: 10830168] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 141-364 IN COMPLEX WITH FGF1. |
| [30] | "Crystal structure of a ternary FGF-FGFR-heparin complex reveals a dual role for heparin in FGFR binding and dimerization." Schlessinger J., Plotnikov A.N., Ibrahimi O.A., Eliseenkova A.V., Yeh B.K., Yayon A., Linhardt R.J., Mohammadi M. Mol. Cell 6:743-750(2000) [PubMed: 11030354] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 143-364 IN COMPLEX WITH FGF2 AND HEPARIN. |
| [31] | "Solution structure of the first Ig-like domain of human fibroblast growth factor receptor 1." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 38-124. |
| [32] | "A common mutation in the fibroblast growth factor receptor 1 gene in Pfeiffer syndrome." Muenke M., Schell U., Hehr A., Robin N.H., Losken H.W., Schinzel A., Pulleyn L.J., Rutland P., Reardon W., Malcolm S., Winter R.M. Nat. Genet. 8:269-274(1994) [PubMed: 7874169] [Abstract] Cited for: VARIANT PS ARG-252. |
| [33] | "An unusual FGFR1 mutation (fibroblast growth factor receptor 1 mutation) in a girl with non-syndromic trigonocephaly." Kress W., Petersen B., Collmann H., Grimm T. Cytogenet. Cell Genet. 91:138-140(2000) [PubMed: 11173846] [Abstract] Cited for: VARIANT NON-SYNDROMIC TRIGONOCEPHALY THR-300. |
| [34] | "Loss-of-function mutations in FGFR1 cause autosomal dominant Kallmann syndrome." Dode C., Levilliers J., Dupont J.-M., De Paepe A., Le Du N., Soussi-Yanicostas N., Coimbra R.S., Delmaghani S., Compain-Nouaille S., Baverel F., Pecheux C., Le Tessier D., Cruaud C., Delpech M., Speleman F., Vermeulen S., Amalfitano A., Bachelot Y. Hardelin J.-P.Nat. Genet. 33:463-465(2003) [PubMed: 12627230] [Abstract] Cited for: VARIANTS KAL2 ASP-97; CYS-99; SER-167; TYR-277; MET-607; ARG-666; ARG-719 AND SER-772. |
| [35] | "Clinical assessment and mutation analysis of Kallmann syndrome 1 (KAL1) and fibroblast growth factor receptor 1 (FGFR1, or KAL2) in five families and 18 sporadic patients." Sato N., Katsumata N., Kagami M., Hasegawa T., Hori N., Kawakita S., Minowada S., Shimotsuka A., Shishiba Y., Yokozawa M., Yasuda T., Nagasaki K., Hasegawa D., Hasegawa Y., Tachibana K., Naiki Y., Horikawa R., Tanaka T., Ogata T. J. Clin. Endocrinol. Metab. 89:1079-1088(2004) [PubMed: 15001591] [Abstract] Cited for: VARIANT KAL2 SER-745. |
| [36] | "Mutations that cause osteoglophonic dysplasia define novel roles for FGFR1 in bone elongation." White K.E., Cabral J.M., Davis S.I., Fishburn T., Evans W.E., Ichikawa S., Fields J., Yu X., Shaw N.J., McLellan N.J., McKeown C., FitzPatrick D., Yu K., Ornitz D.M., Econs M.J. Am. J. Hum. Genet. 76:361-367(2005) [PubMed: 15625620] [Abstract] Cited for: VARIANTS OGD ILE-330; CYS-374 AND ARG-381, CHARACTERIZATION OF VARIANT OGD CYS-374. |
| [37] | "Kallmann syndrome: 14 novel mutations in KAL1 and FGFR1 (KAL2)." Albuisson J., Pecheux C., Carel J.-C., Lacombe D., Leheup B., Lapuzina P., Bouchard P., Legius E., Matthijs G., Wasniewska M., Delpech M., Young J., Hardelin J.-P., Dode C. Hum. Mutat. 25:98-99(2005) [PubMed: 15605412] [Abstract] Cited for: VARIANTS KAL2 ILE-102; ALA-129; MET-273 AND THR-520. |
| [38] | "Gonadotrophin therapy in Kallmann syndrome caused by heterozygous mutations of the gene for fibroblast growth factor receptor 1: report of three families: case report." Sato N., Hasegawa T., Hori N., Fukami M., Yoshimura Y., Ogata T. Hum. Reprod. 20:2173-2178(2005) [PubMed: 15845591] [Abstract] Cited for: VARIANTS KAL2 ARG-687 AND SER-745. |
| [39] | "Extended mutational analyses of FGFR1 in osteoglophonic dysplasia." Farrow E.G., Davis S.I., Mooney S.D., Beighton P., Mascarenhas L., Gutierrez Y.R., Pitukcheewanont P., White K.E. Am. J. Med. Genet. A 140:537-539(2006) [PubMed: 16470795] [Abstract] Cited for: VARIANTS OGD ILE-330 AND ARG-381. |
| [40] | "Novel fibroblast growth factor receptor 1 mutations in patients with congenital hypogonadotropic hypogonadism with and without anosmia." Trarbach E.B., Costa E.M.F., Versiani B., de Castro M., Baptista M.T.M., Garmes H.M., de Mendonca B.B., Latronico A.C. J. Clin. Endocrinol. Metab. 91:4006-4012(2006) [PubMed: 16882753] [Abstract] Cited for: VARIANT IHH SER-48, VARIANT IHH/KAL2 LEU-366, VARIANTS KAL2 PRO-245; TRP-250; VAL-343; SER-722 AND ILE-795. |
| [41] | "Mutations in fibroblast growth factor receptor 1 cause Kallmann syndrome with a wide spectrum of reproductive phenotypes." Pitteloud N., Meysing A., Quinton R., Acierno J.S. Jr., Dwyer A.A., Plummer L., Fliers E., Boepple P., Hayes F., Seminara S., Hughes V.A., Ma J., Bouloux P., Mohammadi M., Crowley W.F. Jr. Mol. Cell. Endocrinol. 254:60-69(2006) [PubMed: 16764984] [Abstract] Cited for: VARIANTS KAL2 CYS-78; ILE-102; HIS-224; ASP-237; GLN-254; MET-273; GLY-274 CYS-339; CYS-346; VAL-538; ARG-703 AND SER-703, VARIANT VAL-769. |
| [42] | "Paediatric phenotype of Kallmann syndrome due to mutations of fibroblast growth factor receptor 1 (FGFR1)." Zenaty D., Bretones P., Lambe C., Guemas I., David M., Leger J., de Roux N. Mol. Cell. Endocrinol. 254:78-83(2006) [PubMed: 16757108] [Abstract] Cited for: VARIANTS KAL2 SER-178; GLY-622 AND GLN-622. |
| [43] | "Mutations in fibroblast growth factor receptor 1 cause both Kallmann syndrome and normosmic idiopathic hypogonadotropic hypogonadism." Pitteloud N., Acierno J.S. Jr., Meysing A., Eliseenkova A.V., Ma J., Ibrahimi O.A., Metzger D.L., Hayes F.J., Dwyer A.A., Hughes V.A., Yialamas M., Hall J.E., Grant E., Mohammadi M., Crowley W.F. Jr. Proc. Natl. Acad. Sci. U.S.A. 103:6281-6286(2006) [PubMed: 16606836] [Abstract] Cited for: VARIANT IHH/KAL2 SER-237, VARIANTS IHH HIS-722 AND LYS-724, CHARACTERIZATION OF VARIANT IHH/KAL2 SER-237, CHARACTERIZATION OF VARIANTS IHH HIS-722 AND LYS-724. |
| [44] | "Novel FGFR1 sequence variants in Kallmann syndrome, and genetic evidence that the FGFR1c isoform is required in olfactory bulb and palate morphogenesis." Dode C., Fouveaut C., Mortier G., Janssens S., Bertherat J., Mahoudeau J., Kottler M.-L., Chabrolle C., Gancel A., Francois I., Devriendt K., Wolczynski S., Pugeat M., Pineiro-Garcia A., Murat A., Bouchard P., Young J., Delpech M., Hardelin J.-P. Hum. Mutat. 28:97-98(2007) [PubMed: 17154279] [Abstract] Cited for: VARIANTS KAL2 PHE-101; TRP-250; ASP-270; ARG-283; CYS-332; ARG-621; PHE-685; PHE-693 AND SER-772, VARIANTS LYS-77 AND CYS-822. |
| [45] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-125; THR-252 AND LEU-664. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| X51803 mRNA. Translation: CAA36101.1. X52833 mRNA. Translation: CAA37015.1. X66945 mRNA. Translation: CAA47375.1. M63887 mRNA. Translation: AAA35958.1. M63888 mRNA. Translation: AAA35959.1. M63889 mRNA. Translation: AAA35960.1. M60485 mRNA. Translation: AAA35840.1. M37722 mRNA. Translation: AAA75007.1. M34185 mRNA. Translation: AAA35836.1. M34186 mRNA. Translation: AAA35837.1. M34187 mRNA. Translation: AAA35838.1. M34188 mRNA. Translation: AAA35839.1. X57118 mRNA. Translation: CAA40400.1. X57119 mRNA. Translation: CAA40401.1. X57120 mRNA. Translation: CAA40402.1. X57121 mRNA. Translation: CAA40403.1. X57122 mRNA. Translation: CAA40404.1. M34641 mRNA. Translation: AAA35835.1. AK291754 mRNA. Translation: BAF84443.1. AK292470 mRNA. Translation: BAF85159.1. AY585209 Genomic DNA. Translation: AAS79322.1. BC015035 mRNA. Translation: AAH15035.1. BC018128 mRNA. Translation: AAH18128.1. BC091494 mRNA. Translation: AAH91494.1. Y00665 mRNA. Translation: CAA68679.1. A29216 Unassigned DNA. Translation: CAA01958.1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00005142. IPI00012036. IPI00012039. IPI00012042. IPI00165947. IPI00216859. IPI00220983. IPI00328245. IPI00332838. IPI00410124. IPI00410125. IPI00410216. IPI00410217. IPI00410218. IPI00410219. IPI00410220. IPI00410223. IPI00455176. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | C36464. C40862. TVHUFG. S11692. A40862. S19167. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_056934.2. NP_075593.1. NP_075594.1. NP_075595.1. NP_075596.1. NP_075598.2. NP_075599.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.264887 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P11362. Positions 25-119. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP:4019N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P11362. 5 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSG00000077782. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 2260. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:2260. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC08M038389. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0019616. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:3688. FGFR1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 101600. phenotype. 136350. gene. 146110. phenotype. 147950. phenotype. 166250. phenotype. 190440. phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 432. Hypogonadism, hypogonadotropic, congenital, normosmic. 3366. Isolated trigonocephaly. 478. Kallmann syndrome. 2326. Kallmann syndrome - heart disease. 2645. Osteoglophonic dwarfism. 710. Pfeiffer syndrome. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA28127. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | P11362. LCTARPA. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 2.7.10.1. 247. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | fgf_pathway. FGF signaling pathway. glypican_1pathway. Glypican 1 network. syndecan_4_pathway. Syndecan-4-mediated signaling events. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_9470. Signaling by FGFR. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_FGFR1. HS_FLG. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000077782. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR016248. Fibroblast_GF_rcpt. IPR013151. Ig. IPR007110. Ig-like. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003598. Ig_sub2. IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR001245. Tyr_pkinase. IPR008266. Tyr_pkinase_AS. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 3 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF07679. I-set. 2 hits. PF00047. ig. 1 hit. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF000628. FGFR. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00109. TYRKINASE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00408. IGc2. 3 hits. SM00219. TyrKc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50835. IG_LIKE. 3 hits. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00039. Palifermin. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 9163. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P11362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | FGFR1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P11362 Secondary accession number(s): A8K6T9 Q8N685 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


