P10966 (CD8B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 131.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: T-cell surface glycoprotein CD8 beta chain Alternative name(s): CD_antigen=CD8b | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 210 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. |
| Subunit structure | In general heterodimer of an alpha and a beta chain linked by two disulfide bonds. |
| Subcellular location | Isoform 1: Cell membrane; Single-pass type I membrane protein Probable. Isoform 2: Cell membrane; Single-pass type I membrane protein Probable. Isoform 4: Cell membrane; Single-pass type I membrane protein Probable. Isoform 5: Cell membrane; Single-pass type I membrane protein Probable. |
| Tissue specificity | Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isoform 6 is higher in peripheral CD8+ T-cells than in thymus CD8+ T-cells. Ref.7 |
| Post-translational modification | Phosphorylated as a consequence of T-cell activation Potential. |
| Sequence similarities | Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Sequence caution | The sequence AAD13877.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: P10966-1) Also known as: M-1; Mbeta1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: P10966-2) Also known as: M-3; Mbeta2; The sequence of this isoform differs from the canonical sequence as follows: 208-210: FYK → LRLHPLEKCSRMDY | |||||||||
| Isoform 3 (identifier: P10966-3) Also known as: S-1; Sbeta3; The sequence of this isoform differs from the canonical sequence as follows: 166-195: Missing. 208-210: FYK → PQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT | |||||||||
| Isoform 4 (identifier: P10966-4) Also known as: M-2; The sequence of this isoform differs from the canonical sequence as follows: 208-210: FYK → KFNIVCLKISGFTTCCCFQILQISREYGFGVLLQKDIGQ | |||||||||
| Isoform 5 (identifier: P10966-6) Also known as: Mbeta3; The sequence of this isoform differs from the canonical sequence as follows: 208-210: FYK → PQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 213 | 1 | I → V in AAI00915. Ref.6 | ||||||
| Isoform 6 (identifier: P10966-7) Also known as: Sbeta1; The sequence of this isoform differs from the canonical sequence as follows: 166-195: Missing. | |||||||||
| Isoform 7 (identifier: P10966-8) Also known as: Sbeta4; The sequence of this isoform differs from the canonical sequence as follows: 165-210: GPLCSPITLG...RLRFMKQFYK → DFTNKQRIGF...TFNPGEFNGC | |||||||||
| Isoform 8 (identifier: P10966-9) Also known as: Sbeta5; The sequence of this isoform differs from the canonical sequence as follows: 166-210: PLCSPITLGL...RLRFMKQFYK → LKGKVYQGPLSPNACMDTTAILQPHRSCLTHGS | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | |||||||||
| Chain | 22 – 210 | 189 | T-cell surface glycoprotein CD8 beta chain | PRO_0000014643 | |||||||
Regions | |||||||||||
| Topological domain | 22 – 170 | 149 | Extracellular Potential | ||||||||
| Transmembrane | 171 – 191 | 21 | Helical; Potential | ||||||||
| Topological domain | 192 – 210 | 19 | Cytoplasmic Potential | ||||||||
| Domain | 22 – 132 | 111 | Ig-like V-type | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 130 | 1 | Phosphothreonine By similarity | ||||||||
| Modified residue | 209 | 1 | Phosphotyrosine Potential | ||||||||
| Glycosylation | 102 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 41 ↔ 116 | Potential | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 165 – 210 | 46 | GPLCS…KQFYK → DFTNKQRIGFWCPATKRHRS VMSTMWKNERRDTFNPGEFN GC in isoform 7. | VSP_039654 | |||||||
| Alternative sequence | 166 – 210 | 45 | PLCSP…KQFYK → LKGKVYQGPLSPNACMDTTA ILQPHRSCLTHGS in isoform 8. | VSP_039655 | |||||||
| Alternative sequence | 166 – 195 | 30 | Missing in isoform 3 and isoform 6. | VSP_002492 | |||||||
| Alternative sequence | 208 – 210 | 3 | FYK → LRLHPLEKCSRMDY in isoform 2. | VSP_002490 | |||||||
| Alternative sequence | 208 – 210 | 3 | FYK → PQGEGISGTFVPQCLHGYYS NTTTSQKLLNPWILKT in isoform 3 and isoform 5. | VSP_002493 | |||||||
| Alternative sequence | 208 – 210 | 3 | FYK → KFNIVCLKISGFTTCCCFQI LQISREYGFGVLLQKDIGQ in isoform 4. | VSP_002491 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 173 | 1 | Missing no nucleotide entry Ref.7 | ||||||||
| Sequence conflict | 180 | 1 | V → I in AAI00915. Ref.6 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A second subunit of CD8 is expressed in human T cells." Norment A.M., Littman D.R. EMBO J. 7:3433-3439(1988) [PubMed: 3145195] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). Tissue: T-cell. |
| [2] | "The human Lyt-3 molecule requires CD8 for cell surface expression." Disanto J.P., Knowles R.W., Flomenberg N. EMBO J. 7:3465-3470(1988) [PubMed: 3145196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "A second chain of human CD8 is expressed on peripheral blood lymphocytes." Shiue L., Gorman S.D., Parnes J.R. J. Exp. Med. 168:1993-2005(1988) [PubMed: 3264320] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Recent duplication of the two human CD8 beta-chain genes." Nakayama K., Kawachi Y., Tokito S., Minami N., Yamamoto R., Imai T., Gachelin G., Nakauchi H. J. Immunol. 148:1919-1927(1992) [PubMed: 1541829] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2; 3 AND 4). |
| [5] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5). |
| [7] | "Transcriptional diversity at the duplicated human CD8 beta loci." DiSanto J.P., Smith D., de Bruin D., Lacy E., Flomenberg N. Eur. J. Immunol. 23:320-326(1993) [PubMed: 8436166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 162-210 (ISOFORMS 1; 2; 3; 5; 6; 7 AND 8), ALTERNATIVE SPLICING, TISSUE SPECIFICITY. Tissue: Peripheral blood. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia CD8 entry |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X13444 mRNA. Translation: CAA31795.1. X13445 mRNA. Translation: CAA31796.1. X13446 mRNA. Translation: CAA31797.1. X13452 mRNA. Translation: CAA31803.1. Y00805 mRNA. Translation: CAA68750.1. M36712 mRNA. Translation: AAA35664.1. S87090 S87081 Genomic DNA. Translation: AAB21669.2.S87087 S87081 Genomic DNA. Translation: AAB21670.2.S87083 S87081 Genomic DNA. Translation: AAB21671.2.S87083 S87081 Genomic DNA. Translation: AAB21672.2.AC111200 Genomic DNA. No translation available. BC100911 mRNA. Translation: AAI00912.1. BC100913 mRNA. Translation: AAI00914.1. BC100914 mRNA. Translation: AAI00915.1. S55731, S55730, S55733 Genomic DNA. Translation: AAD13877.1. Sequence problems. |
| IPI | IPI00023641. IPI00218643. IPI00218644. IPI00218645. IPI00333756. IPI00969417. IPI00969593. IPI00969609. |
| PIR | C49050. D46482. E49050. G49050. E46482. S01647. C46482. S01873. B46482. S01874. T01073. |
| RefSeq | NP_001171571.1. NM_001178100.1. NP_004922.1. NM_004931.4. NP_742099.1. NM_172101.3. NP_742100.1. NM_172102.3. NP_757362.1. NM_172213.3. |
| UniGene | Hs.405667. |
3D structure databases | |
| ProteinModelPortal | P10966. |
| SMR | P10966. Positions 22-143. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P10966. |
Polymorphism databases | |
| DMDM | 116032. |
Proteomic databases | |
| PRIDE | P10966. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000390655; ENSP00000375070; ENSG00000172116. |
| GeneID | 926. |
| KEGG | hsa:926. |
| UCSC | uc002srx.1. human. uc002sry.1. human. uc002srz.1. human. |
Organism-specific databases | |
| CTD | 926. |
| GeneCards | GC02M087042. |
| HGNC | HGNC:1707. CD8B. |
| HPA | CAB004353. |
| MIM | 186730. gene. |
| neXtProt | NX_P10966. |
| PharmGKB | PA26245. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00510000048998. |
| HOVERGEN | HBG105700. |
| OMA | TRIYWLR. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | cd8tcrdownstreampathway. Downstream signaling in naive CD8+ T cells. il12_2pathway. IL12-mediated signaling events. cd8tcrpathway. TCR signaling in naive CD8+ T cells. |
| Reactome | REACT_6185. HIV Infection. REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | P10966. |
| Bgee | P10966. |
| CleanEx | HS_CD8B. |
| Genevestigator | P10966. |
| GermOnline | ENSG00000172116. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007110. Ig-like. IPR013783. Ig-like_fold. IPR003599. Ig_sub. IPR013106. Ig_V-set. [Graphical view] |
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 1 hit. |
| KO | K06459. |
| Pfam | PF07686. V-set. 1 hit. [Graphical view] |
| SMART | SM00409. IG. 1 hit. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 3832. |
| SOURCE | Search... |
Entry information
| Entry name | CD8B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P10966 Secondary accession number(s): P14860 Q9UQ55 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with