SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P10966

- CD8B_HUMAN

UniProt

P10966 - CD8B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
T-cell surface glycoprotein CD8 beta chain
Gene
CD8B, CD8B1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing.

GO - Molecular functioni

  1. MHC class I protein binding Source: UniProtKB
  2. coreceptor activity Source: UniProtKB
  3. protein binding Source: UniProtKB

GO - Biological processi

  1. T cell activation Source: UniProtKB
  2. immune response Source: UniProtKB
  3. regulation of defense response to virus by virus Source: Reactome
  4. regulation of immune response Source: Reactome
  5. transmembrane receptor protein tyrosine kinase signaling pathway Source: UniProtKB
  6. viral process Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Adaptive immunity, Immunity

Enzyme and pathway databases

ReactomeiREACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
REACT_11200. Nef Mediated CD8 Down-regulation.

Names & Taxonomyi

Protein namesi
Recommended name:
T-cell surface glycoprotein CD8 beta chain
Alternative name(s):
CD_antigen: CD8b
Gene namesi
Name:CD8B
Synonyms:CD8B1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:1707. CD8B.

Subcellular locationi

Isoform 3 : Secreted Inferred
Isoform 6 : Secreted Inferred
Isoform 7 : Secreted Inferred
Isoform 8 : Secreted Inferred

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini22 – 170149Extracellular Reviewed prediction
Add
BLAST
Transmembranei171 – 19121Helical; Reviewed prediction
Add
BLAST
Topological domaini192 – 21019Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. T cell receptor complex Source: UniProtKB
  2. early endosome membrane Source: Reactome
  3. external side of plasma membrane Source: Ensembl
  4. extracellular region Source: UniProtKB-SubCell
  5. integral component of plasma membrane Source: ProtInc
  6. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26245.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121
Add
BLAST
Chaini22 – 210189T-cell surface glycoprotein CD8 beta chain
PRO_0000014643Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi41 ↔ 116 Reviewed prediction
Glycosylationi102 – 1021N-linked (GlcNAc...) Reviewed prediction
Modified residuei209 – 2091Phosphotyrosine Reviewed prediction

Post-translational modificationi

Phosphorylated as a consequence of T-cell activation Reviewed prediction.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP10966.
PRIDEiP10966.

PTM databases

PhosphoSiteiP10966.

Expressioni

Tissue specificityi

Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isoform 6 is higher in peripheral CD8+ T-cells than in thymus CD8+ T-cells.1 Publication

Gene expression databases

ArrayExpressiP10966.
BgeeiP10966.
CleanExiHS_CD8B.
GenevestigatoriP10966.

Organism-specific databases

HPAiCAB004353.

Interactioni

Subunit structurei

In general heterodimer of an alpha and a beta chain linked by two disulfide bonds.

Protein-protein interaction databases

BioGridi107364. 2 interactions.
STRINGi9606.ENSP00000331172.

Structurei

3D structure databases

ProteinModelPortaliP10966.
SMRiP10966. Positions 22-187.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini22 – 132111Ig-like V-type
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG45880.
HOVERGENiHBG105700.
KOiK06459.
OMAiIYWLRQR.
OrthoDBiEOG7NSB5C.
PhylomeDBiP10966.
TreeFamiTF338028.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P10966-1) [UniParc]FASTAAdd to Basket

Also known as: M-1, Mbeta1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRPRLWLLLA AQLTVLHGNS VLQQTPAYIK VQTNKMVMLS CEAKISLSNM    50
RIYWLRQRQA PSSDSHHEFL ALWDSAKGTI HGEEVEQEKI AVFRDASRFI 100
LNLTSVKPED SGIYFCMIVG SPELTFGKGT QLSVVDFLPT TAQPTKKSTL 150
KKRVCRLPRP ETQKGPLCSP ITLGLLVAGV LVLLVSLGVA IHLCCRRRRA 200
RLRFMKQFYK 210
Length:210
Mass (Da):23,722
Last modified:July 1, 1989 - v1
Checksum:i675AD919585F4B80
GO
Isoform 2 (identifier: P10966-2) [UniParc]FASTAAdd to Basket

Also known as: M-3, Mbeta2

The sequence of this isoform differs from the canonical sequence as follows:
     208-210: FYK → LRLHPLEKCSRMDY

Show »
Length:221
Mass (Da):25,027
Checksum:iF5D8E834AE123671
GO
Isoform 3 (identifier: P10966-3) [UniParc]FASTAAdd to Basket

Also known as: S-1, Sbeta3

The sequence of this isoform differs from the canonical sequence as follows:
     166-195: Missing.
     208-210: FYK → PQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT

Show »
Length:213
Mass (Da):24,276
Checksum:i79F81C2F066900D3
GO
Isoform 4 (identifier: P10966-4) [UniParc]FASTAAdd to Basket

Also known as: M-2

The sequence of this isoform differs from the canonical sequence as follows:
     208-210: FYK → KFNIVCLKISGFTTCCCFQILQISREYGFGVLLQKDIGQ

Show »
Length:246
Mass (Da):27,681
Checksum:i33E6112A23CE59CD
GO
Isoform 5 (identifier: P10966-6) [UniParc]FASTAAdd to Basket

Also known as: Mbeta3

The sequence of this isoform differs from the canonical sequence as follows:
     208-210: FYK → PQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT

Show »
Length:243
Mass (Da):27,246
Checksum:i9D6B283609CC0752
GO
Isoform 6 (identifier: P10966-7) [UniParc]FASTAAdd to Basket

Also known as: Sbeta1

The sequence of this isoform differs from the canonical sequence as follows:
     166-195: Missing.

Show »
Length:180
Mass (Da):20,752
Checksum:iDBE4D7A3B6A30F58
GO
Isoform 7 (identifier: P10966-8) [UniParc]FASTAAdd to Basket

Also known as: Sbeta4

The sequence of this isoform differs from the canonical sequence as follows:
     165-210: GPLCSPITLG...RLRFMKQFYK → DFTNKQRIGF...TFNPGEFNGC

Show »
Length:206
Mass (Da):23,633
Checksum:iEE0A2D77A82570D4
GO
Isoform 8 (identifier: P10966-9) [UniParc]FASTAAdd to Basket

Also known as: Sbeta5

The sequence of this isoform differs from the canonical sequence as follows:
     166-210: PLCSPITLGL...RLRFMKQFYK → LKGKVYQEPLSPNACMDTTAILQPHRSCLTHGS

Show »
Length:198
Mass (Da):22,237
Checksum:i57D5DEB69D193C5A
GO

Sequence cautioni

The sequence AAD13877.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei165 – 21046GPLCS…KQFYK → DFTNKQRIGFWCPATKRHRS VMSTMWKNERRDTFNPGEFN GC in isoform 7.
VSP_039654Add
BLAST
Alternative sequencei166 – 21045PLCSP…KQFYK → LKGKVYQEPLSPNACMDTTA ILQPHRSCLTHGS in isoform 8.
VSP_039655Add
BLAST
Alternative sequencei166 – 19530Missing in isoform 3 and isoform 6.
VSP_002492Add
BLAST
Alternative sequencei208 – 2103FYK → LRLHPLEKCSRMDY in isoform 2.
VSP_002490
Alternative sequencei208 – 2103FYK → PQGEGISGTFVPQCLHGYYS NTTTSQKLLNPWILKT in isoform 3 and isoform 5.
VSP_002493
Alternative sequencei208 – 2103FYK → KFNIVCLKISGFTTCCCFQI LQISREYGFGVLLQKDIGQ in isoform 4.
VSP_002491

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti173 – 1731Missing no nucleotide entry 1 Publication
Sequence conflicti180 – 1801V → I in AAI00915. 1 Publication
Isoform 5 (identifier: P10966-6)
Sequence conflicti213 – 2131I → V in AAI00915. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X13444 mRNA. Translation: CAA31795.1.
X13445 mRNA. Translation: CAA31796.1.
X13446 mRNA. Translation: CAA31797.1.
X13452 mRNA. Translation: CAA31803.1.
Y00805 mRNA. Translation: CAA68750.1.
M36712 mRNA. Translation: AAA35664.1.
S87090
, S87068, S87070, S87073, S87081 Genomic DNA. Translation: AAB21669.2.
S87087
, S87068, S87070, S87073, S87078, S87081 Genomic DNA. Translation: AAB21670.2.
S87083
, S87068, S87070, S87073, S87078, S87081 Genomic DNA. Translation: AAB21671.2.
S87083
, S87068, S87070, S87073, S87078, S87081 Genomic DNA. Translation: AAB21672.2.
AC111200 Genomic DNA. No translation available.
BC100911 mRNA. Translation: AAI00912.1.
BC100912 mRNA. Translation: AAI00913.1.
BC100913 mRNA. Translation: AAI00914.1.
BC100914 mRNA. Translation: AAI00915.1.
S55731, S55730, S55733 Genomic DNA. Translation: AAD13877.1. Sequence problems.
CCDSiCCDS1994.1. [P10966-3]
CCDS1995.1. [P10966-6]
CCDS1997.1. [P10966-1]
CCDS42708.1. [P10966-2]
CCDS54376.1. [P10966-9]
PIRiC49050.
D46482.
E49050.
G49050.
S01647. E46482.
S01873. C46482.
S01874. B46482.
T01073.
RefSeqiNP_001171571.1. NM_001178100.1. [P10966-9]
NP_004922.1. NM_004931.4. [P10966-1]
NP_742099.1. NM_172101.3. [P10966-2]
NP_742100.1. NM_172102.3. [P10966-3]
NP_757362.1. NM_172213.3. [P10966-6]
UniGeneiHs.405667.

Genome annotation databases

EnsembliENST00000331469; ENSP00000331172; ENSG00000172116. [P10966-6]
ENST00000349455; ENSP00000340592; ENSG00000172116. [P10966-3]
ENST00000390655; ENSP00000375070; ENSG00000172116. [P10966-1]
ENST00000393759; ENSP00000377356; ENSG00000172116. [P10966-2]
ENST00000393761; ENSP00000377358; ENSG00000172116. [P10966-9]
GeneIDi926.
KEGGihsa:926.
UCSCiuc002srw.3. human. [P10966-6]
uc002srx.3. human. [P10966-2]
uc002sry.3. human. [P10966-3]
uc002srz.3. human. [P10966-1]
uc010fgt.3. human. [P10966-9]

Polymorphism databases

DMDMi116032.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Wikipedia

CD8 entry

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X13444 mRNA. Translation: CAA31795.1 .
X13445 mRNA. Translation: CAA31796.1 .
X13446 mRNA. Translation: CAA31797.1 .
X13452 mRNA. Translation: CAA31803.1 .
Y00805 mRNA. Translation: CAA68750.1 .
M36712 mRNA. Translation: AAA35664.1 .
S87090
, S87068 , S87070 , S87073 , S87081 Genomic DNA. Translation: AAB21669.2 .
S87087
, S87068 , S87070 , S87073 , S87078 , S87081 Genomic DNA. Translation: AAB21670.2 .
S87083
, S87068 , S87070 , S87073 , S87078 , S87081 Genomic DNA. Translation: AAB21671.2 .
S87083
, S87068 , S87070 , S87073 , S87078 , S87081 Genomic DNA. Translation: AAB21672.2 .
AC111200 Genomic DNA. No translation available.
BC100911 mRNA. Translation: AAI00912.1 .
BC100912 mRNA. Translation: AAI00913.1 .
BC100913 mRNA. Translation: AAI00914.1 .
BC100914 mRNA. Translation: AAI00915.1 .
S55731 , S55730 , S55733 Genomic DNA. Translation: AAD13877.1 . Sequence problems.
CCDSi CCDS1994.1. [P10966-3 ]
CCDS1995.1. [P10966-6 ]
CCDS1997.1. [P10966-1 ]
CCDS42708.1. [P10966-2 ]
CCDS54376.1. [P10966-9 ]
PIRi C49050.
D46482.
E49050.
G49050.
S01647. E46482.
S01873. C46482.
S01874. B46482.
T01073.
RefSeqi NP_001171571.1. NM_001178100.1. [P10966-9 ]
NP_004922.1. NM_004931.4. [P10966-1 ]
NP_742099.1. NM_172101.3. [P10966-2 ]
NP_742100.1. NM_172102.3. [P10966-3 ]
NP_757362.1. NM_172213.3. [P10966-6 ]
UniGenei Hs.405667.

3D structure databases

ProteinModelPortali P10966.
SMRi P10966. Positions 22-187.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107364. 2 interactions.
STRINGi 9606.ENSP00000331172.

PTM databases

PhosphoSitei P10966.

Polymorphism databases

DMDMi 116032.

Proteomic databases

PaxDbi P10966.
PRIDEi P10966.

Protocols and materials databases

DNASUi 926.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000331469 ; ENSP00000331172 ; ENSG00000172116 . [P10966-6 ]
ENST00000349455 ; ENSP00000340592 ; ENSG00000172116 . [P10966-3 ]
ENST00000390655 ; ENSP00000375070 ; ENSG00000172116 . [P10966-1 ]
ENST00000393759 ; ENSP00000377356 ; ENSG00000172116 . [P10966-2 ]
ENST00000393761 ; ENSP00000377358 ; ENSG00000172116 . [P10966-9 ]
GeneIDi 926.
KEGGi hsa:926.
UCSCi uc002srw.3. human. [P10966-6 ]
uc002srx.3. human. [P10966-2 ]
uc002sry.3. human. [P10966-3 ]
uc002srz.3. human. [P10966-1 ]
uc010fgt.3. human. [P10966-9 ]

Organism-specific databases

CTDi 926.
GeneCardsi GC02M087042.
HGNCi HGNC:1707. CD8B.
HPAi CAB004353.
MIMi 186730. gene.
neXtProti NX_P10966.
PharmGKBi PA26245.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG45880.
HOVERGENi HBG105700.
KOi K06459.
OMAi IYWLRQR.
OrthoDBi EOG7NSB5C.
PhylomeDBi P10966.
TreeFami TF338028.

Enzyme and pathway databases

Reactomei REACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
REACT_11200. Nef Mediated CD8 Down-regulation.

Miscellaneous databases

GenomeRNAii 926.
NextBioi 3832.
PROi P10966.
SOURCEi Search...

Gene expression databases

ArrayExpressi P10966.
Bgeei P10966.
CleanExi HS_CD8B.
Genevestigatori P10966.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view ]
Pfami PF07686. V-set. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 1 hit.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A second subunit of CD8 is expressed in human T cells."
    Norment A.M., Littman D.R.
    EMBO J. 7:3433-3439(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: T-cell.
  2. "The human Lyt-3 molecule requires CD8 for cell surface expression."
    Disanto J.P., Knowles R.W., Flomenberg N.
    EMBO J. 7:3465-3470(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "A second chain of human CD8 is expressed on peripheral blood lymphocytes."
    Shiue L., Gorman S.D., Parnes J.R.
    J. Exp. Med. 168:1993-2005(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Recent duplication of the two human CD8 beta-chain genes."
    Nakayama K., Kawachi Y., Tokito S., Minami N., Yamamoto R., Imai T., Gachelin G., Nakauchi H.
    J. Immunol. 148:1919-1927(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2; 3 AND 4).
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 8).
  7. "Transcriptional diversity at the duplicated human CD8 beta loci."
    DiSanto J.P., Smith D., de Bruin D., Lacy E., Flomenberg N.
    Eur. J. Immunol. 23:320-326(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 162-210 (ISOFORMS 1; 2; 3; 5; 6; 7 AND 8), ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    Tissue: Peripheral blood.

Entry informationi

Entry nameiCD8B_HUMAN
AccessioniPrimary (citable) accession number: P10966
Secondary accession number(s): P14860
, P14861, Q15980, Q496E0, Q496E1, Q496E2, Q9UDB4, Q9UDB5, Q9UDB6, Q9UDB7, Q9UDB8, Q9UDB9, Q9UDC0, Q9UQ55
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: July 1, 1989
Last modified: September 3, 2014
This is version 157 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi