Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P10966

- CD8B_HUMAN

UniProt

P10966 - CD8B_HUMAN

Protein

T-cell surface glycoprotein CD8 beta chain

Gene

CD8B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 158 (01 Oct 2014)
      Sequence version 1 (01 Jul 1989)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing.

    GO - Molecular functioni

    1. coreceptor activity Source: UniProtKB
    2. MHC class I protein binding Source: UniProtKB
    3. protein binding Source: UniProtKB

    GO - Biological processi

    1. immune response Source: UniProtKB
    2. regulation of defense response to virus by virus Source: Reactome
    3. regulation of immune response Source: Reactome
    4. T cell activation Source: UniProtKB
    5. transmembrane receptor protein tyrosine kinase signaling pathway Source: UniProtKB
    6. viral process Source: Reactome

    Keywords - Biological processi

    Adaptive immunity, Immunity

    Enzyme and pathway databases

    ReactomeiREACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
    REACT_11200. Nef Mediated CD8 Down-regulation.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    T-cell surface glycoprotein CD8 beta chain
    Alternative name(s):
    CD_antigen: CD8b
    Gene namesi
    Name:CD8B
    Synonyms:CD8B1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:1707. CD8B.

    Subcellular locationi

    GO - Cellular componenti

    1. early endosome membrane Source: Reactome
    2. external side of plasma membrane Source: Ensembl
    3. extracellular region Source: UniProtKB-SubCell
    4. integral component of plasma membrane Source: ProtInc
    5. plasma membrane Source: Reactome
    6. T cell receptor complex Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26245.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2121Add
    BLAST
    Chaini22 – 210189T-cell surface glycoprotein CD8 beta chainPRO_0000014643Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi41 ↔ 116PROSITE-ProRule annotation
    Glycosylationi102 – 1021N-linked (GlcNAc...)Sequence Analysis
    Modified residuei209 – 2091PhosphotyrosineSequence Analysis

    Post-translational modificationi

    Phosphorylated as a consequence of T-cell activation.Curated

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiP10966.
    PRIDEiP10966.

    PTM databases

    PhosphoSiteiP10966.

    Expressioni

    Tissue specificityi

    Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isoform 6 is higher in peripheral CD8+ T-cells than in thymus CD8+ T-cells.1 Publication

    Gene expression databases

    ArrayExpressiP10966.
    BgeeiP10966.
    CleanExiHS_CD8B.
    GenevestigatoriP10966.

    Organism-specific databases

    HPAiCAB004353.

    Interactioni

    Subunit structurei

    In general heterodimer of an alpha and a beta chain linked by two disulfide bonds.

    Protein-protein interaction databases

    BioGridi107364. 2 interactions.
    STRINGi9606.ENSP00000331172.

    Structurei

    3D structure databases

    ProteinModelPortaliP10966.
    SMRiP10966. Positions 22-187.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini22 – 170149ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini192 – 21019CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei171 – 19121HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini22 – 132111Ig-like V-typeAdd
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG45880.
    HOVERGENiHBG105700.
    KOiK06459.
    OMAiIYWLRQR.
    OrthoDBiEOG7NSB5C.
    PhylomeDBiP10966.
    TreeFamiTF338028.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    [Graphical view]
    PfamiPF07686. V-set. 1 hit.
    [Graphical view]
    SMARTiSM00409. IG. 1 hit.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P10966-1) [UniParc]FASTAAdd to Basket

    Also known as: M-1, Mbeta1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRPRLWLLLA AQLTVLHGNS VLQQTPAYIK VQTNKMVMLS CEAKISLSNM    50
    RIYWLRQRQA PSSDSHHEFL ALWDSAKGTI HGEEVEQEKI AVFRDASRFI 100
    LNLTSVKPED SGIYFCMIVG SPELTFGKGT QLSVVDFLPT TAQPTKKSTL 150
    KKRVCRLPRP ETQKGPLCSP ITLGLLVAGV LVLLVSLGVA IHLCCRRRRA 200
    RLRFMKQFYK 210
    Length:210
    Mass (Da):23,722
    Last modified:July 1, 1989 - v1
    Checksum:i675AD919585F4B80
    GO
    Isoform 2 (identifier: P10966-2) [UniParc]FASTAAdd to Basket

    Also known as: M-3, Mbeta2

    The sequence of this isoform differs from the canonical sequence as follows:
         208-210: FYK → LRLHPLEKCSRMDY

    Show »
    Length:221
    Mass (Da):25,027
    Checksum:iF5D8E834AE123671
    GO
    Isoform 3 (identifier: P10966-3) [UniParc]FASTAAdd to Basket

    Also known as: S-1, Sbeta3

    The sequence of this isoform differs from the canonical sequence as follows:
         166-195: Missing.
         208-210: FYK → PQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT

    Show »
    Length:213
    Mass (Da):24,276
    Checksum:i79F81C2F066900D3
    GO
    Isoform 4 (identifier: P10966-4) [UniParc]FASTAAdd to Basket

    Also known as: M-2

    The sequence of this isoform differs from the canonical sequence as follows:
         208-210: FYK → KFNIVCLKISGFTTCCCFQILQISREYGFGVLLQKDIGQ

    Show »
    Length:246
    Mass (Da):27,681
    Checksum:i33E6112A23CE59CD
    GO
    Isoform 5 (identifier: P10966-6) [UniParc]FASTAAdd to Basket

    Also known as: Mbeta3

    The sequence of this isoform differs from the canonical sequence as follows:
         208-210: FYK → PQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT

    Show »
    Length:243
    Mass (Da):27,246
    Checksum:i9D6B283609CC0752
    GO
    Isoform 6 (identifier: P10966-7) [UniParc]FASTAAdd to Basket

    Also known as: Sbeta1

    The sequence of this isoform differs from the canonical sequence as follows:
         166-195: Missing.

    Show »
    Length:180
    Mass (Da):20,752
    Checksum:iDBE4D7A3B6A30F58
    GO
    Isoform 7 (identifier: P10966-8) [UniParc]FASTAAdd to Basket

    Also known as: Sbeta4

    The sequence of this isoform differs from the canonical sequence as follows:
         165-210: GPLCSPITLG...RLRFMKQFYK → DFTNKQRIGF...TFNPGEFNGC

    Show »
    Length:206
    Mass (Da):23,633
    Checksum:iEE0A2D77A82570D4
    GO
    Isoform 8 (identifier: P10966-9) [UniParc]FASTAAdd to Basket

    Also known as: Sbeta5

    The sequence of this isoform differs from the canonical sequence as follows:
         166-210: PLCSPITLGL...RLRFMKQFYK → LKGKVYQEPLSPNACMDTTAILQPHRSCLTHGS

    Show »
    Length:198
    Mass (Da):22,237
    Checksum:i57D5DEB69D193C5A
    GO

    Sequence cautioni

    The sequence AAD13877.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti173 – 1731Missing no nucleotide entry (PubMed:8436166)Curated
    Sequence conflicti180 – 1801V → I in AAI00915. (PubMed:15489334)Curated
    Isoform 5 (identifier: P10966-6)
    Sequence conflicti213 – 2131I → V in AAI00915. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei165 – 21046GPLCS…KQFYK → DFTNKQRIGFWCPATKRHRS VMSTMWKNERRDTFNPGEFN GC in isoform 7. 1 PublicationVSP_039654Add
    BLAST
    Alternative sequencei166 – 21045PLCSP…KQFYK → LKGKVYQEPLSPNACMDTTA ILQPHRSCLTHGS in isoform 8. 2 PublicationsVSP_039655Add
    BLAST
    Alternative sequencei166 – 19530Missing in isoform 3 and isoform 6. 2 PublicationsVSP_002492Add
    BLAST
    Alternative sequencei208 – 2103FYK → LRLHPLEKCSRMDY in isoform 2. 2 PublicationsVSP_002490
    Alternative sequencei208 – 2103FYK → PQGEGISGTFVPQCLHGYYS NTTTSQKLLNPWILKT in isoform 3 and isoform 5. 3 PublicationsVSP_002493
    Alternative sequencei208 – 2103FYK → KFNIVCLKISGFTTCCCFQI LQISREYGFGVLLQKDIGQ in isoform 4. CuratedVSP_002491

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X13444 mRNA. Translation: CAA31795.1.
    X13445 mRNA. Translation: CAA31796.1.
    X13446 mRNA. Translation: CAA31797.1.
    X13452 mRNA. Translation: CAA31803.1.
    Y00805 mRNA. Translation: CAA68750.1.
    M36712 mRNA. Translation: AAA35664.1.
    S87090
    , S87068, S87070, S87073, S87081 Genomic DNA. Translation: AAB21669.2.
    S87087
    , S87068, S87070, S87073, S87078, S87081 Genomic DNA. Translation: AAB21670.2.
    S87083
    , S87068, S87070, S87073, S87078, S87081 Genomic DNA. Translation: AAB21671.2.
    S87083
    , S87068, S87070, S87073, S87078, S87081 Genomic DNA. Translation: AAB21672.2.
    AC111200 Genomic DNA. No translation available.
    BC100911 mRNA. Translation: AAI00912.1.
    BC100912 mRNA. Translation: AAI00913.1.
    BC100913 mRNA. Translation: AAI00914.1.
    BC100914 mRNA. Translation: AAI00915.1.
    S55731, S55730, S55733 Genomic DNA. Translation: AAD13877.1. Sequence problems.
    CCDSiCCDS1994.1. [P10966-3]
    CCDS1995.1. [P10966-6]
    CCDS1997.1. [P10966-1]
    CCDS42708.1. [P10966-2]
    CCDS54376.1. [P10966-9]
    PIRiC49050.
    D46482.
    E49050.
    G49050.
    S01647. E46482.
    S01873. C46482.
    S01874. B46482.
    T01073.
    RefSeqiNP_001171571.1. NM_001178100.1. [P10966-9]
    NP_004922.1. NM_004931.4. [P10966-1]
    NP_742099.1. NM_172101.3. [P10966-2]
    NP_742100.1. NM_172102.3. [P10966-3]
    NP_757362.1. NM_172213.3. [P10966-6]
    UniGeneiHs.405667.

    Genome annotation databases

    EnsembliENST00000331469; ENSP00000331172; ENSG00000172116. [P10966-6]
    ENST00000349455; ENSP00000340592; ENSG00000172116. [P10966-3]
    ENST00000390655; ENSP00000375070; ENSG00000172116. [P10966-1]
    ENST00000393759; ENSP00000377356; ENSG00000172116. [P10966-2]
    ENST00000393761; ENSP00000377358; ENSG00000172116. [P10966-9]
    GeneIDi926.
    KEGGihsa:926.
    UCSCiuc002srw.3. human. [P10966-6]
    uc002srx.3. human. [P10966-2]
    uc002sry.3. human. [P10966-3]
    uc002srz.3. human. [P10966-1]
    uc010fgt.3. human. [P10966-9]

    Polymorphism databases

    DMDMi116032.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Wikipedia

    CD8 entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X13444 mRNA. Translation: CAA31795.1 .
    X13445 mRNA. Translation: CAA31796.1 .
    X13446 mRNA. Translation: CAA31797.1 .
    X13452 mRNA. Translation: CAA31803.1 .
    Y00805 mRNA. Translation: CAA68750.1 .
    M36712 mRNA. Translation: AAA35664.1 .
    S87090
    , S87068 , S87070 , S87073 , S87081 Genomic DNA. Translation: AAB21669.2 .
    S87087
    , S87068 , S87070 , S87073 , S87078 , S87081 Genomic DNA. Translation: AAB21670.2 .
    S87083
    , S87068 , S87070 , S87073 , S87078 , S87081 Genomic DNA. Translation: AAB21671.2 .
    S87083
    , S87068 , S87070 , S87073 , S87078 , S87081 Genomic DNA. Translation: AAB21672.2 .
    AC111200 Genomic DNA. No translation available.
    BC100911 mRNA. Translation: AAI00912.1 .
    BC100912 mRNA. Translation: AAI00913.1 .
    BC100913 mRNA. Translation: AAI00914.1 .
    BC100914 mRNA. Translation: AAI00915.1 .
    S55731 , S55730 , S55733 Genomic DNA. Translation: AAD13877.1 . Sequence problems.
    CCDSi CCDS1994.1. [P10966-3 ]
    CCDS1995.1. [P10966-6 ]
    CCDS1997.1. [P10966-1 ]
    CCDS42708.1. [P10966-2 ]
    CCDS54376.1. [P10966-9 ]
    PIRi C49050.
    D46482.
    E49050.
    G49050.
    S01647. E46482.
    S01873. C46482.
    S01874. B46482.
    T01073.
    RefSeqi NP_001171571.1. NM_001178100.1. [P10966-9 ]
    NP_004922.1. NM_004931.4. [P10966-1 ]
    NP_742099.1. NM_172101.3. [P10966-2 ]
    NP_742100.1. NM_172102.3. [P10966-3 ]
    NP_757362.1. NM_172213.3. [P10966-6 ]
    UniGenei Hs.405667.

    3D structure databases

    ProteinModelPortali P10966.
    SMRi P10966. Positions 22-187.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107364. 2 interactions.
    STRINGi 9606.ENSP00000331172.

    PTM databases

    PhosphoSitei P10966.

    Polymorphism databases

    DMDMi 116032.

    Proteomic databases

    PaxDbi P10966.
    PRIDEi P10966.

    Protocols and materials databases

    DNASUi 926.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000331469 ; ENSP00000331172 ; ENSG00000172116 . [P10966-6 ]
    ENST00000349455 ; ENSP00000340592 ; ENSG00000172116 . [P10966-3 ]
    ENST00000390655 ; ENSP00000375070 ; ENSG00000172116 . [P10966-1 ]
    ENST00000393759 ; ENSP00000377356 ; ENSG00000172116 . [P10966-2 ]
    ENST00000393761 ; ENSP00000377358 ; ENSG00000172116 . [P10966-9 ]
    GeneIDi 926.
    KEGGi hsa:926.
    UCSCi uc002srw.3. human. [P10966-6 ]
    uc002srx.3. human. [P10966-2 ]
    uc002sry.3. human. [P10966-3 ]
    uc002srz.3. human. [P10966-1 ]
    uc010fgt.3. human. [P10966-9 ]

    Organism-specific databases

    CTDi 926.
    GeneCardsi GC02M087042.
    HGNCi HGNC:1707. CD8B.
    HPAi CAB004353.
    MIMi 186730. gene.
    neXtProti NX_P10966.
    PharmGKBi PA26245.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG45880.
    HOVERGENi HBG105700.
    KOi K06459.
    OMAi IYWLRQR.
    OrthoDBi EOG7NSB5C.
    PhylomeDBi P10966.
    TreeFami TF338028.

    Enzyme and pathway databases

    Reactomei REACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
    REACT_11200. Nef Mediated CD8 Down-regulation.

    Miscellaneous databases

    GenomeRNAii 926.
    NextBioi 3832.
    PROi P10966.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P10966.
    Bgeei P10966.
    CleanExi HS_CD8B.
    Genevestigatori P10966.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    [Graphical view ]
    Pfami PF07686. V-set. 1 hit.
    [Graphical view ]
    SMARTi SM00409. IG. 1 hit.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A second subunit of CD8 is expressed in human T cells."
      Norment A.M., Littman D.R.
      EMBO J. 7:3433-3439(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
      Tissue: T-cell.
    2. "The human Lyt-3 molecule requires CD8 for cell surface expression."
      Disanto J.P., Knowles R.W., Flomenberg N.
      EMBO J. 7:3465-3470(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "A second chain of human CD8 is expressed on peripheral blood lymphocytes."
      Shiue L., Gorman S.D., Parnes J.R.
      J. Exp. Med. 168:1993-2005(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "Recent duplication of the two human CD8 beta-chain genes."
      Nakayama K., Kawachi Y., Tokito S., Minami N., Yamamoto R., Imai T., Gachelin G., Nakauchi H.
      J. Immunol. 148:1919-1927(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2; 3 AND 4).
    5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 8).
    7. "Transcriptional diversity at the duplicated human CD8 beta loci."
      DiSanto J.P., Smith D., de Bruin D., Lacy E., Flomenberg N.
      Eur. J. Immunol. 23:320-326(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 162-210 (ISOFORMS 1; 2; 3; 5; 6; 7 AND 8), ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
      Tissue: Peripheral blood.

    Entry informationi

    Entry nameiCD8B_HUMAN
    AccessioniPrimary (citable) accession number: P10966
    Secondary accession number(s): P14860
    , P14861, Q15980, Q496E0, Q496E1, Q496E2, Q9UDB4, Q9UDB5, Q9UDB6, Q9UDB7, Q9UDB8, Q9UDB9, Q9UDC0, Q9UQ55
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 1, 1989
    Last sequence update: July 1, 1989
    Last modified: October 1, 2014
    This is version 158 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    3. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3