P10909 (CLUS_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 157.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Clusterin Alternative name(s): Aging-associated gene 4 protein Apolipoprotein J Short name=Apo-J Complement cytolysis inhibitor Short name=CLI Complement-associated protein SP-40,40 Ku70-binding protein 1 NA1/NA2 Testosterone-repressed prostate message 2 Short name=TRPM-2 Cleaved into the following 2 chains:
| ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 449 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Isoform 1 functions as extracellular chaperone that prevents aggregation of nonnative proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Secreted isoform 1 protects cells against apoptosis and against cytolysis by complement. Intracellular isoforms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. Nuclear isoforms promote apoptosis. Mitochondrial isoforms suppress BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation. Ref.24 Ref.25 Ref.26 Ref.27 Ref.28 Ref.33 Ref.37 Ref.38 Ref.40 Ref.42 Ref.46 Ref.47 Ref.50 Ref.51 Ref.52 |
| Subunit structure | Antiparallel disulfide-linked heterodimer of an alpha chain and a beta chain. Self-associates and forms higher oligomers. Interacts with a broad range of misfolded proteins, including APP, APOC2 and LYZ. Slightly acidic pH promotes interaction with misfolded proteins. Forms high-molecular weight oligomers upon interaction with misfolded proteins. Interacts with APOA1, LRP2, CLUAP1 AND PON1. Interacts with the complement complex. Interacts (via alpha chain) with XRCC6. Interacts with SYVN1, COMMD1, BTRC, CUL1 and with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes. Interacts (via alpha chain) with BAX in stressed cells, where BAX undergoes a conformation change leading to association with the mitochondrial membrane. Does not interact with BAX in unstressed cells. Found in a complex with LTF, CLU, EPPIN and SEMG1. Ref.1 Ref.9 Ref.10 Ref.11 Ref.14 Ref.18 Ref.20 Ref.21 Ref.22 Ref.25 Ref.26 Ref.27 Ref.30 Ref.33 Ref.37 Ref.39 Ref.40 Ref.42 Ref.44 Ref.46 Ref.51 |
| Subcellular location | Isoform 1: Secreted. Note: Can retrotranslocate from the secretory compartments to the cytosol upon cellular stress. Ref.1 Ref.10 Ref.11 Ref.13 Ref.22 Ref.24 Ref.27 Ref.33 Ref.37 Ref.38 Ref.40 Ref.44 Ref.47 Ref.51 Nucleus. Cytoplasm. Mitochondrion membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm › cytosol. Microsome. Endoplasmic reticulum. Cytoplasmic vesicle › secretory vesicle › chromaffin granule By similarity. Note: Isoforms lacking the N-terminal signal sequence have been shown to be cytoplasmic and/or nuclear. Secreted isoforms can retrotranslocate from the secretory compartments to the cytosol upon cellular stress. Detected in perinuclear foci that may be aggresomes containing misfolded, ubiquitinated proteins. Detected at the mitochondrion membrane upon induction of apoptosis. Ref.1 Ref.10 Ref.11 Ref.13 Ref.22 Ref.24 Ref.27 Ref.33 Ref.37 Ref.38 Ref.40 Ref.44 Ref.47 Ref.51 |
| Tissue specificity | Detected in blood plasma, cerebrospinal fluid, milk, seminal plasma and colon mucosa. Detected in the germinal center of colon lymphoid nodules and in colon parasympathetic ganglia of the Auerbach plexus (at protein level). Ubiquitous. Detected in brain, testis, ovary, liver and pancreas, and at lower levels in kidney, heart, spleen and lung. Ref.1 Ref.2 Ref.10 Ref.11 Ref.13 Ref.14 Ref.22 Ref.24 Ref.37 Ref.40 Ref.43 |
| Induction | Up-regulated in response to enterovirus 71 (EV71) infection (at protein level). Up-regulated by agents that induce apoptosis, both at mRNA and protein level. Isoform 1 is up-regulated by androgen. Isoform 2 is down-regulated by androgen. Ref.34 Ref.38 Ref.41 |
| Post-translational modification | Isoform 1 is proteolytically cleaved on its way through the secretory system, probably within the Golgi lumen. Ref.10 Polyubiquitinated, leading to proteasomal degradation. Heavily N-glycosylated. About 30% of the protein mass is comprised of complex N-linked carbohydrate. Ref.10 Ref.18 Ref.23 Ref.29 Ref.37 |
| Sequence similarities | Belongs to the clusterin family. |
| Sequence caution | The sequence AAA35692.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAB06508.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAB06508.1 differs from that shown. Reason: Contaminating sequence. The sequence AAH10514.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAH19588.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAP88927.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAP88927.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAT08041.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAG36598.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAA32847.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BCL2L1 | Q07817-1 | 6 | EBI-4322678,EBI-287195 | |
| DISC1 | Q9NRI5 | 4 | EBI-1104674,EBI-529989 | |
| FOS | P01100 | 2 | EBI-1104674,EBI-852851 | |
| PPARG | P37231 | 3 | EBI-1104674,EBI-781384 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P10909-1) Also known as: 2; CLU35; sCLU; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Major isoform. | ||||||
| Isoform 2 (identifier: P10909-2) Also known as: 1; CLU34; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MQVCSQPQRGCVREQSAINTAPPSAHNAASPGGARGHRVPLTEACKDSRIGGM | ||||||
| Isoform 3 (identifier: P10909-3) The sequence of this isoform differs from the canonical sequence as follows: 1-175: Missing. | ||||||
| Isoform 4 (identifier: P10909-4) Also known as: nCLU; The sequence of this isoform differs from the canonical sequence as follows: 1-33: Missing. | ||||||
| Note: Minor isoform that has been detected in a breast cancer cell line, but not in any other tissues or cell lines. | ||||||
| Isoform 5 (identifier: P10909-5) Also known as: CLU36; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MEACKDSRIGGM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Ref.1 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 | ||||||||
| Chain | 23 – 449 | 427 | Clusterin | PRO_0000005529 | |||||||
| Chain | 23 – 227 | 205 | Clusterin beta chain Ref.14 | PRO_0000005530 | |||||||
| Chain | 228 – 449 | 222 | Clusterin alpha chain Ref.14 | PRO_0000005531 | |||||||
Regions | |||||||||||
| Motif | 78 – 81 | 4 | Nuclear localization signal By similarity | ||||||||
| Motif | 443 – 447 | 5 | Nuclear localization signal By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 86 | 1 | N-linked (GlcNAc...) Ref.17 Ref.18 Ref.23 Ref.32 Ref.48 | ||||||||
| Glycosylation | 103 | 1 | N-linked (GlcNAc...) Ref.17 Ref.18 Ref.23 Ref.32 Ref.48 | ||||||||
| Glycosylation | 145 | 1 | N-linked (GlcNAc...) Ref.17 Ref.18 Ref.23 Ref.32 Ref.48 | ||||||||
| Glycosylation | 291 | 1 | N-linked (GlcNAc...) Ref.17 Ref.18 Ref.23 Ref.32 Ref.45 | ||||||||
| Glycosylation | 317 | 1 | N-linked (GlcNAc...) Ref.45 | ||||||||
| Glycosylation | 354 | 1 | N-linked (GlcNAc...) Ref.18 Ref.23 Ref.29 Ref.31 Ref.32 Ref.48 | ||||||||
| Glycosylation | 374 | 1 | N-linked (GlcNAc...) (complex) Ref.18 Ref.23 Ref.31 Ref.32 Ref.35 Ref.36 Ref.45 Ref.48 Ref.49 | ||||||||
| Disulfide bond | 102 ↔ 313 | Interchain (between beta and alpha chains) Ref.1 Ref.10 Ref.11 Ref.18 Ref.21 | |||||||||
| Disulfide bond | 113 ↔ 305 | Interchain (between beta and alpha chains) Ref.1 Ref.10 Ref.11 Ref.18 Ref.21 | |||||||||
| Disulfide bond | 116 ↔ 302 | Interchain (between beta and alpha chains) Ref.1 Ref.10 Ref.11 Ref.18 Ref.21 | |||||||||
| Disulfide bond | 121 ↔ 295 | Interchain (between beta and alpha chains) Ref.1 Ref.10 Ref.11 Ref.18 Ref.21 | |||||||||
| Disulfide bond | 129 ↔ 285 | Interchain (between beta and alpha chains) Ref.1 Ref.10 Ref.11 Ref.18 Ref.21 | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 175 | 175 | Missing in isoform 3. | VSP_041475 | |||||||
| Alternative sequence | 1 – 33 | 33 | Missing in isoform 4. | VSP_041476 | |||||||
| Alternative sequence | 1 | 1 | M → MQVCSQPQRGCVREQSAINT APPSAHNAASPGGARGHRVP LTEACKDSRIGGM in isoform 2. | VSP_037661 | |||||||
| Alternative sequence | 1 | 1 | M → MEACKDSRIGGM in isoform 5. | VSP_041477 | |||||||
| Natural variant | 317 | 1 | N → H. Ref.6 Corresponds to variant rs9331936 [ dbSNP | Ensembl ]. | VAR_019366 | |||||||
| Natural variant | 328 | 1 | D → N. Ref.6 Corresponds to variant rs9331938 [ dbSNP | Ensembl ]. | VAR_019367 | |||||||
| Natural variant | 396 | 1 | S → L. Ref.6 Corresponds to variant rs13494 [ dbSNP | Ensembl ]. | VAR_019368 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 28 | 1 | D → S AA sequence Ref.9 | ||||||||
| Sequence conflict | 28 | 1 | D → S AA sequence Ref.13 | ||||||||
| Sequence conflict | 47 | 1 | Q → H AA sequence Ref.10 | ||||||||
| Sequence conflict | 52 | 1 | G → Q AA sequence Ref.10 | ||||||||
| Sequence conflict | 172 | 1 | M → V in CAI45990. Ref.5 | ||||||||
| Sequence conflict | 224 | 1 | R → L in BAG36598. Ref.3 | ||||||||
| Sequence conflict | 305 | 1 | C → M AA sequence Ref.9 | ||||||||
| Sequence conflict | 388 | 1 | T → M in CAI45990. Ref.5 | ||||||||
| Sequence conflict | 411 | 1 | D → G in BAG36598. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular structure and functional characterization of a human complement cytolysis inhibitor found in blood and seminal plasma: identity to sulfated glycoprotein 2, a constituent of rat testis fluid." Jenne D.E., Tschopp J. Proc. Natl. Acad. Sci. U.S.A. 86:7123-7127(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF N-TERMINUS, SUBUNIT, DISULFIDE BONDS, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Liver. |
| [2] | "Molecular characterization of human TRPM-2/clusterin, a gene associated with sperm maturation, apoptosis and neurodegeneration." Wong P., Taillefer D., Lakins J., Pineault J., Chader G., Tenniswood M. Eur. J. Biochem. 221:917-925(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Stomach and Testis. |
| [4] | "Full-length cDNA libraries and normalization." Li W.B., Gruber C., Jessee J., Polayes D. Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Small intestine. |
| [6] | NIEHS SNPs program Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-317; ASN-328 AND LEU-396. |
| [7] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain and Spinal ganglion. |
| [9] | "Characterization of a human high density lipoprotein-associated protein, NA1/NA2. Identity with SP-40,40, an inhibitor of complement-mediated cytolysis." James R.W., Hochstrasser A.-C., Borghini I., Martin B.M., Pometta D., Hochstrasser D.F. Arterioscler. Thromb. 11:645-652(1991) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 23-33; 229-242; 303-317 AND 397-403, SUBUNIT, INTERACTION WITH APOA1. |
| [10] | "Purification and characterization of apolipoprotein J." de Silva H., Stuart W.D., Park Y.B., Mao S.J.T., Gil C.M., Wetterau J.R., Busch S.J., Harmony J.A.K. J. Biol. Chem. 265:14292-14297(1990) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 23-52 AND 228-257, SUBUNIT, DISULFIDE BOND, PROTEOLYTIC PROCESSING, GLYCOSYLATION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [11] | "The cerebrospinal-fluid soluble form of Alzheimer's amyloid beta is complexed to SP-40,40 (apolipoprotein J), an inhibitor of the complement membrane-attack complex." Ghiso J., Matsubara E., Koudinov A., Choi-Miura N.-H., Tomita M., Wisniewski T., Frangione B. Biochem. J. 293:27-30(1993) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 23-41 AND 228-246, INTERACTION WITH APP, SUBCELLULAR LOCATION, DISULFIDE BOND, TISSUE SPECIFICITY. |
| [12] | "A serum protein SP40,40 modulates the formation of membrane attack complex of complement on erythrocytes." Choi N.H., Mazda T., Tomita M. Mol. Immunol. 26:835-840(1989) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 23-37 AND 228-242. |
| [13] | "HDL particle associated proteins in plasma and cerebrospinal fluid: identification and partial sequencing." Hochstrasser A.-C., James R.W., Martin B.M., Harrington M., Hochstrasser D.F., Pometta D., Merril C.R. Appl. Theor. Electrophor. 1:73-76(1988) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 23-33 AND 228-240, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [14] | "Apolipoprotein J: structure and tissue distribution." de Silva H.V., Harmony J.A.K., Stuart W.D., Gil C.M., Robbins J. Biochemistry 29:5380-5389(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 34-449 (ISOFORMS 1/2/4), PARTIAL PROTEIN SEQUENCE, SUBUNIT, TISSUE SPECIFICITY. |
| [15] | "Human gliomas and epileptic foci express high levels of a mRNA related to rat testicular sulfated glycoprotein 2, a purported marker of cell death." Danik M., Chabot J.G., Mercier C., Benabid A.L., Chauvin C., Quirion R., Suh M. Proc. Natl. Acad. Sci. U.S.A. 88:8577-8581(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 61-449. Tissue: Astrocytoma. |
| [16] | Glew M.D., Kirszbaum L., Bozas S.E., Walker I.D. Submitted (JAN-1993) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 140-449. Tissue: Fetal liver. |
| [17] | "Molecular cloning and characterization of the novel, human complement-associated protein, SP-40,40: a link between the complement and reproductive systems." Kirszbaum L., Sharpe J.A., Murphy B., D'Apice J.F.A., Classon B., Hudson P., Walker I.D. EMBO J. 8:711-718(1989) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), PARTIAL PROTEIN SEQUENCE. Tissue: Liver. |
| [18] | "SP-40,40, a protein involved in the control of the complement pathway, possesses a unique array of disulphide bridges." Kirszbaum L., Bozas S.E., Walker I.D. FEBS Lett. 297:70-76(1992) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE, DISULFIDE BONDS, GLYCOSYLATION AT ASN-86; ASN-103; ASN-145; ASN-291; ASN-354 AND ASN-374. |
| [19] | "Identification of human aging-associated gene." Kim J.W. Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [20] | "The apolipoprotein A-I binding protein of placenta and the SP-40,40 protein of human blood are different proteins which both bind to apolipoprotein A-I." Ehnholm C., Bozas S.E., Tenkanen H., Kirszbaum L., Metso J., Murphy B., Walker I.D. Biochim. Biophys. Acta 1086:255-260(1991) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH APOA1. |
| [21] | "Identification of the disulfide bonds in human plasma protein SP-40,40 (apolipoprotein-J)." Choi-Miura N.H., Takahashi Y., Nakano Y., Tobe T., Tomita M. J. Biochem. 112:557-561(1992) [PubMed] [Europe PMC] [Abstract] Cited for: DISULFIDE BONDS. |
| [22] | "Apolipoprotein J is associated with paraoxonase in human plasma." Kelso G.J., Stuart W.D., Richter R.J., Furlong C.E., Jordan-Starck T.C., Harmony J.A.K. Biochemistry 33:832-839(1994) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PON1, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [23] | "Identification and characterization of glycosylation sites in human serum clusterin." Kapron J.T., Hilliard G.M., Lakins J.N., Tenniswood M.P., West K.A., Carr S.A., Crabb J.W. Protein Sci. 6:2120-2133(1997) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT ASN-86; ASN-103; ASN-145; ASN-291; ASN-354 AND ASN-374. Tissue: Serum. |
| [24] | "Clusterin is an ATP-independent chaperone with very broad substrate specificity that stabilizes stressed proteins in a folding-competent state." Poon S., Easterbrook-Smith S.B., Rybchyn M.S., Carver J.A., Wilson M.R. Biochemistry 39:15953-15960(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, ABSENCE OF ATPASE ACTIVITY, TISSUE SPECIFICITY. |
| [25] | "Suppression of apolipoprotein C-II amyloid formation by the extracellular chaperone, clusterin." Hatters D.M., Wilson M.R., Easterbrook-Smith S.B., Howlett G.J. Eur. J. Biochem. 269:2789-2794(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT. |
| [26] | "Mildly acidic pH activates the extracellular molecular chaperone clusterin." Poon S., Rybchyn M.S., Easterbrook-Smith S.B., Carver J.A., Pankhurst G.J., Wilson M.R. J. Biol. Chem. 277:39532-39540(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT, CIRCULAR DICHROISM. |
| [27] | "Synthesis and functional analyses of nuclear clusterin, a cell death protein." Leskov K.S., Klokov D.Y., Li J., Kinsella T.J., Boothman D.A. J. Biol. Chem. 278:11590-11600(2003) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, IDENTIFICATION OF ISOFORM 4, FUNCTION, INTERACTION WITH XRCC6, SUBCELLULAR LOCATION. |
| [28] | "Essential requirement of apolipoprotein J (clusterin) signaling for IkappaB expression and regulation of NF-kappaB activity." Santilli G., Aronow B.J., Sala A. J. Biol. Chem. 278:38214-38219(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [29] | "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry." Zhang H., Li X.-J., Martin D.B., Aebersold R. Nat. Biotechnol. 21:660-666(2003) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT ASN-354. Tissue: Serum. |
| [30] | "Isolation and characterization of a novel gene CLUAP1 whose expression is frequently upregulated in colon cancer." Takahashi M., Lin Y.-M., Nakamura Y., Furukawa Y. Oncogene 23:9289-9294(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CLUAP1. |
| [31] | "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry." Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. Proteomics 4:454-465(2004) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-354 AND ASN-374, MASS SPECTROMETRY. Tissue: Plasma. |
| [32] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-86; ASN-103; ASN-145; ASN-291; ASN-354 AND ASN-374, MASS SPECTROMETRY. Tissue: Plasma. |
| [33] | "Clusterin inhibits apoptosis by interacting with activated Bax." Zhang H., Kim J.K., Edwards C.A., Xu Z., Taichman R., Wang C.Y. Nat. Cell Biol. 7:909-915(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH BAX. |
| [34] | "Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection." Leong W.F., Chow V.T. Cell. Microbiol. 8:565-580(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION, MASS SPECTROMETRY. |
| [35] | "Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry." Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T., Loo J.A. J. Proteome Res. 5:1493-1503(2006) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-374, MASS SPECTROMETRY. Tissue: Saliva. |
| [36] | "Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach." Lewandrowski U., Moebius J., Walter U., Sickmann A. Mol. Cell. Proteomics 5:226-233(2006) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-374, MASS SPECTROMETRY. Tissue: Platelet. |
| [37] | "Effects of glycosylation on the structure and function of the extracellular chaperone clusterin." Stewart E.M., Aquilina J.A., Easterbrook-Smith S.B., Murphy-Durland D., Jacobsen C., Moestrup S., Wilson M.R. Biochemistry 46:1412-1422(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT, INTERACTION WITH LRP2, GLYCOSYLATION, SUBCELLULAR LOCATION, MASS SPECTROMETRY, CIRCULAR DICHROISM, TISSUE SPECIFICITY. |
| [38] | "Multiple pathways regulating the anti-apoptotic protein clusterin in breast cancer." Ranney M.K., Ahmed I.S., Potts K.R., Craven R.J. Biochim. Biophys. Acta 1772:1103-1111(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INDUCTION, PROTEASOMAL DEGRADATION, SUBCELLULAR LOCATION. |
| [39] | "Characterization of an eppin protein complex from human semen and spermatozoa." Wang Z., Widgren E.E., Richardson R.T., O'Rand M.G. Biol. Reprod. 77:476-484(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH LTF; SEMG1 AND EPPIN. |
| [40] | "The extracellular chaperone clusterin influences amyloid formation and toxicity by interacting with prefibrillar structures." Yerbury J.J., Poon S., Meehan S., Thompson B., Kumita J.R., Dobson C.M., Wilson M.R. FASEB J. 21:2312-2322(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [41] | "Differential regulation of clusterin and its isoforms by androgens in prostate cells." Cochrane D.R., Wang Z., Muramaki M., Gleave M.E., Nelson C.C. J. Biol. Chem. 282:2278-2287(2007) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, IDENTIFICATION OF ISOFORMS 1 AND 2, INDUCTION BY ANDROGEN. |
| [42] | "The extracellular chaperone clusterin potently inhibits human lysozyme amyloid formation by interacting with prefibrillar species." Kumita J.R., Poon S., Caddy G.L., Hagan C.L., Dumoulin M., Yerbury J.J., Stewart E.M., Robinson C.V., Wilson M.R., Dobson C.M. J. Mol. Biol. 369:157-167(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT. |
| [43] | "Clusterin expression in normal mucosa and colorectal cancer." Andersen C.L., Schepeler T., Thorsen K., Birkenkamp-Demtroder K., Mansilla F., Aaltonen L.A., Laurberg S., Orntoft T.F. Mol. Cell. Proteomics 6:1039-1048(2007) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, IDENTIFICATION OF ISOFORMS 1; 2 AND 5, TISSUE SPECIFICITY. |
| [44] | "Stress-induced retrotranslocation of clusterin/ApoJ into the cytosol." Nizard P., Tetley S., Le Drean Y., Watrin T., Le Goff P., Wilson M.R., Michel D. Traffic 8:554-565(2007) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH SYVN1, UBIQUITINATION. |
| [45] | "Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry." Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F. Proteomics 8:3833-3847(2008) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-291; ASN-317 AND ASN-374, MASS SPECTROMETRY. Tissue: Milk. |
| [46] | "Structural characterization of clusterin-chaperone client protein complexes." Wyatt A.R., Yerbury J.J., Wilson M.R. J. Biol. Chem. 284:21920-21927(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT. |
| [47] | "Clusterin is a short half-life, poly-ubiquitinated protein, which controls the fate of prostate cancer cells." Rizzi F., Caccamo A.E., Belloni L., Bettuzzi S. J. Cell. Physiol. 219:314-323(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, UBIQUITINATION. |
| [48] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-86; ASN-103; ASN-145; ASN-354 AND ASN-374, MASS SPECTROMETRY. Tissue: Liver. |
| [49] | "Enrichment of glycopeptides for glycan structure and attachment site identification." Nilsson J., Rueetschi U., Halim A., Hesse C., Carlsohn E., Brinkmalm G., Larson G. Nat. Methods 6:809-811(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-374, STRUCTURE OF CARBOHYDRATES, MASS SPECTROMETRY. Tissue: Cerebrospinal fluid. |
| [50] | "Identification of human plasma proteins as major clients for the extracellular chaperone clusterin." Wyatt A.R., Wilson M.R. J. Biol. Chem. 285:3532-3539(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [51] | "Clusterin facilitates COMMD1 and I-kappaB degradation to enhance NF-kappaB activity in prostate cancer cells." Zoubeidi A., Ettinger S., Beraldi E., Hadaschik B., Zardan A., Klomp L.W., Nelson C.C., Rennie P.S., Gleave M.E. Mol. Cancer Res. 8:119-130(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH COMMD1; UBIQUITIN; CUL1 ANDBTRC, IDENTIFICATION IN A E3 UBIQUITIN-PROTEIN LIGASE COMPLEX. |
| [52] | "Clusterin facilitates in vivo clearance of extracellular misfolded proteins." Wyatt A.R., Yerbury J.J., Berghofer P., Greguric I., Katsifis A., Dobson C.M., Wilson M.R. Cell. Mol. Life Sci. 68:3919-3931(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M25915 mRNA. Translation: AAA35692.1. Different initiation. M63379 M63378 Genomic DNA. Translation: AAB06507.1.M64722 mRNA. Translation: AAB06508.1. Sequence problems. AK093399 mRNA. Translation: BAG52708.1. AK313870 mRNA. Translation: BAG36598.1. Different initiation. CR599675 mRNA. No translation available. BX648414 mRNA. Translation: CAI45990.1. AY341244 Genomic DNA. Translation: AAP88927.1. Different initiation. AF311103 Genomic DNA. No translation available. BC010514 mRNA. Translation: AAH10514.1. Different initiation. BC019588 mRNA. Translation: AAH19588.1. Different initiation. BU150467 mRNA. No translation available. J02908 mRNA. Translation: AAA51765.1. M74816 mRNA. Translation: AAA60321.1. L00974 Genomic DNA. Translation: AAA60567.1. X14723 mRNA. Translation: CAA32847.1. Different initiation. AY513288 mRNA. Translation: AAT08041.1. Different initiation. |
| IPI | IPI00291262. IPI00400826. IPI00954954. IPI00976752. IPI00978715. |
| PIR | A41386. S43646. |
| RefSeq | NP_001822.3. NM_001831.3. |
| UniGene | Hs.436657. |
3D structure databases | |
| ProteinModelPortal | P10909. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P10909. 26 interactions. |
| MINT | MINT-3007494. |
| STRING | 9606.ENSP00000315130. |
PTM databases | |
| PhosphoSite | P10909. |
Polymorphism databases | |
| DMDM | 116533. |
2D gel databases | |
| DOSAC-COBS-2DPAGE | P10909. |
| OGP | P10909. |
| REPRODUCTION-2DPAGE | IPI00291262. |
| SWISS-2DPAGE | P10909. |
Proteomic databases | |
| PaxDb | P10909. |
| PRIDE | P10909. |
Protocols and materials databases | |
| DNASU | 1191. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000316403; ENSP00000315130; ENSG00000120885. ENST00000405140; ENSP00000385419; ENSG00000120885. ENST00000523500; ENSP00000429620; ENSG00000120885. ENST00000546343; ENSP00000446413; ENSG00000120885. ENST00000560366; ENSP00000453939; ENSG00000120885. |
| GeneID | 1191. |
| KEGG | hsa:1191. |
| UCSC | uc003xfw.2. human. uc003xfy.2. human. |
Organism-specific databases | |
| CTD | 1191. |
| GeneCards | GC08M027454. |
| HGNC | HGNC:2095. CLU. |
| HPA | CAB000476. CAB016253. HPA000572. |
| MIM | 185430. gene. |
| neXtProt | NX_P10909. |
| PharmGKB | PA26620. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG26650. |
| HOVERGEN | HBG006908. |
| InParanoid | P10909. |
| OMA | SSPFYFW. |
| OrthoDB | EOG447FTH. |
Enzyme and pathway databases | |
| Reactome | REACT_604. Hemostasis. |
Gene expression databases | |
| ArrayExpress | P10909. |
| Bgee | P10909. |
| CleanEx | HS_CLU. |
| Genevestigator | P10909. |
| GermOnline | ENSG00000120885. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR016016. Clusterin. IPR000753. Clusterin-like. IPR016015. Clusterin_C. IPR016014. Clusterin_N. [Graphical view] |
| PANTHER | PTHR10970:SF1. PTHR10970:SF1. 1 hit. |
| Pfam | PF01093. Clusterin. 1 hit. [Graphical view] |
| PIRSF | PIRSF002368. Clusterin. 1 hit. |
| SMART | SM00035. CLa. 1 hit. SM00030. CLb. 1 hit. [Graphical view] |
| PROSITE | PS00492. CLUSTERIN_1. 1 hit. PS00493. CLUSTERIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL1741303. |
| ChiTaRS | CLU. human. |
| GenomeRNAi | 1191. |
| NextBio | 4922. |
| PMAP-CutDB | P10909. |
| SOURCE | Search... |
Entry information
| Entry name | CLUS_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P10909 Secondary accession number(s): B2R9Q1 Q7Z5B9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
