Reviewed,
UniProtKB/Swiss-Prot P10909 (CLUS_HUMAN)
Last modified
February 9, 2010.
Version 123.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Clusterin Alternative name(s): Complement-associated protein SP-40,40 Complement cytolysis inhibitor Short name=CLI NA1/NA2 Apolipoprotein J Short name=Apo-J Testosterone-repressed prostate message 2 Short name=TRPM-2 Ku70-binding protein 1 Aging-associated gene 4 protein Cleaved into the following 2 chains: 1- Recommended name: Clusterin beta chain Alternative name(s): ApoJalpha Complement cytolysis inhibitor a chain 2- Recommended name: Clusterin alpha chain Alternative name(s): ApoJbeta Complement cytolysis inhibitor b chain | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 449 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Not yet clear. It is known to be expressed in a variety of tissues and it seems to be able to bind to cells, membranes and hydrophobic proteins. It has been associated with programmed cell death (apoptosis). |
| Subunit structure | Antiparallel disulfide-linked heterodimer. Interacts with APOA1, CLUAP1 AND PON1. Ref.16 Ref.20 Ref.21 Ref.22 Ref.25 |
| Subcellular location | |
| Tissue specificity | Plasma. Ref.33 |
| Induction | Up-regulated in response to enterovirus 71 (EV71) infection (at protein level). Ref.28 |
| Post-translational modification | Phosphorylation sites are present in the extracelllular medium. |
| Sequence similarities | Belongs to the clusterin family. |
| Sequence caution | The sequence AAP88927.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P10909-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P10909-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MQVCSQPQRGCVREQSAINTAPPSAHNAASPGGARGHRVPLTEACKDSRIGGM | ||||||
| Note: Ref.4 (AAB06508) sequence differs from that shown due to a frameshifts in position 37. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 | ||||||||
| Chain | 23 – 449 | 427 | Clusterin | PRO_0000005529 | |||||||
| Chain | 23 – 227 | 205 | Clusterin beta chain Ref.12 | PRO_0000005530 | |||||||
| Chain | 228 – 449 | 222 | Clusterin alpha chain Ref.12 | PRO_0000005531 | |||||||
Amino acid modifications | |||||||||||
| Modified residue | 393 | 1 | Phosphothreonine Ref.33 | ||||||||
| Modified residue | 394 | 1 | Phosphoserine Ref.33 | ||||||||
| Modified residue | 396 | 1 | Phosphoserine Ref.33 | ||||||||
| Glycosylation | 86 | 1 | N-linked (GlcNAc...) Ref.16 Ref.23 Ref.27 Ref.32 Ref.15 | ||||||||
| Glycosylation | 103 | 1 | N-linked (GlcNAc...) Ref.16 Ref.23 Ref.27 Ref.32 Ref.15 | ||||||||
| Glycosylation | 145 | 1 | N-linked (GlcNAc...) Ref.16 Ref.23 Ref.27 Ref.32 Ref.15 | ||||||||
| Glycosylation | 291 | 1 | N-linked (GlcNAc...) Ref.16 Ref.23 Ref.27 Ref.31 Ref.15 | ||||||||
| Glycosylation | 317 | 1 | N-linked (GlcNAc...) Ref.31 | ||||||||
| Glycosylation | 354 | 1 | N-linked (GlcNAc...) Ref.16 Ref.23 Ref.27 Ref.32 Ref.24 Ref.26 | ||||||||
| Glycosylation | 374 | 1 | N-linked (GlcNAc...) Ref.16 Ref.23 Ref.27 Ref.32 Ref.31 Ref.26 Ref.29 Ref.30 | ||||||||
| Disulfide bond | 102 ↔ 313 | Interchain (between beta and alpha chains) Ref.16 Ref.21 | |||||||||
| Disulfide bond | 113 ↔ 305 | Interchain (between beta and alpha chains) Ref.16 Ref.21 | |||||||||
| Disulfide bond | 116 ↔ 302 | Interchain (between beta and alpha chains) Ref.16 Ref.21 | |||||||||
| Disulfide bond | 121 ↔ 295 | Interchain (between beta and alpha chains) Ref.16 Ref.21 | |||||||||
| Disulfide bond | 129 ↔ 285 | Interchain (between beta and alpha chains) Ref.16 Ref.21 | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 | 1 | M → MQVCSQPQRGCVREQSAINT APPSAHNAASPGGARGHRVP LTEACKDSRIGGM in isoform 2. | VSP_037661 | |||||||
| Natural variant | 317 | 1 | N → H: dbSNP rs9331936. Ref.5 | VAR_019366 | |||||||
| Natural variant | 328 | 1 | D → N: dbSNP rs9331938. Ref.5 | VAR_019367 | |||||||
| Natural variant | 396 | 1 | S → L: dbSNP rs13494. Ref.5 | VAR_019368 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 28 | 1 | D → S AA sequence Ref.7 | ||||||||
| Sequence conflict | 28 | 1 | D → S AA sequence Ref.11 | ||||||||
| Sequence conflict | 31 – 33 | 3 | LQE → PQD in AAA51765. Ref.3 | ||||||||
| Sequence conflict | 47 | 1 | Q → H AA sequence Ref.8 | ||||||||
| Sequence conflict | 52 | 1 | G → Q AA sequence Ref.8 | ||||||||
| Sequence conflict | 172 | 1 | M → V in CAI45990. Ref.4 | ||||||||
| Sequence conflict | 224 | 1 | R → L in BAG36598. Ref.18 | ||||||||
| Sequence conflict | 305 | 1 | C → M AA sequence Ref.7 | ||||||||
| Sequence conflict | 388 | 1 | T → M in CAI45990. Ref.4 | ||||||||
| Sequence conflict | 411 | 1 | D → G in BAG36598. Ref.18 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular structure and functional characterization of a human complement cytolysis inhibitor found in blood and seminal plasma: identity to sulfated glycoprotein 2, a constituent of rat testis fluid." Jenne D.E., Tschopp J. Proc. Natl. Acad. Sci. U.S.A. 86:7123-7127(1989) [PubMed: 2780565] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Molecular characterization of human TRPM-2/clusterin, a gene associated with sperm maturation, apoptosis and neurodegeneration." Wong P., Taillefer D., Lakins J., Pineault J., Chader G., Tenniswood M. Eur. J. Biochem. 221:917-925(1994) [PubMed: 8181474] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Full-length cDNA libraries and normalization." Li W.B., Gruber C., Jessee J., Polayes D. Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Small intestine. |
| [5] | NIEHS SNPs program Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-317; ASN-328 AND LEU-396. |
| [6] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "Characterization of a human high density lipoprotein-associated protein, NA1/NA2. Identity with SP-40,40, an inhibitor of complement-mediated cytolysis." James R.W., Hochstrasser A.-C., Borghini I., Martin B.M., Pometta D., Hochstrasser D.F. Arterioscler. Thromb. 11:645-652(1991) [PubMed: 1903064] [Abstract] Cited for: PROTEIN SEQUENCE OF 23-33; 229-242; 303-317 AND 397-403. |
| [8] | "Purification and characterization of apolipoprotein J." de Silva H., Stuart W.D., Park Y.B., Mao S.J.T., Gil C.M., Wetterau J.R., Busch S.J., Harmony J.A.K. J. Biol. Chem. 265:14292-14297(1990) [PubMed: 2387851] [Abstract] Cited for: PROTEIN SEQUENCE OF 23-52 AND 228-257. |
| [9] | "The cerebrospinal-fluid soluble form of Alzheimer's amyloid beta is complexed to SP-40,40 (apolipoprotein J), an inhibitor of the complement membrane-attack complex." Ghiso J., Matsubara E., Koudinov A., Choi-Miura N.-H., Tomita M., Wisniewski T., Frangione B. Biochem. J. 293:27-30(1993) [PubMed: 8328966] [Abstract] Cited for: PROTEIN SEQUENCE OF 23-41 AND 228-246. |
| [10] | "A serum protein SP40,40 modulates the formation of membrane attack complex of complement on erythrocytes." Choi N.H., Mazda T., Tomita M. Mol. Immunol. 26:835-840(1989) [PubMed: 2601725] [Abstract] Cited for: PROTEIN SEQUENCE OF 23-37 AND 228-242. |
| [11] | "HDL particle associated proteins in plasma and cerebrospinal fluid: identification and partial sequencing." Hochstrasser A.-C., James R.W., Martin B.M., Harrington M., Hochstrasser D.F., Pometta D., Merril C.R. Appl. Theor. Electrophor. 1:73-76(1988) [PubMed: 3154963] [Abstract] Cited for: PROTEIN SEQUENCE OF 23-33 AND 228-240. |
| [12] | "Apolipoprotein J: structure and tissue distribution." de Silva H.V., Harmony J.A.K., Stuart W.D., Gil C.M., Robbins J. Biochemistry 29:5380-5389(1990) [PubMed: 1974459] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 31-449 (ISOFORMS 1/2). |
| [13] | "Human gliomas and epileptic foci express high levels of a mRNA related to rat testicular sulfated glycoprotein 2, a purported marker of cell death." Danik M., Chabot J.G., Mercier C., Benabid A.L., Chauvin C., Quirion R., Suh M. Proc. Natl. Acad. Sci. U.S.A. 88:8577-8581(1991) [PubMed: 1924317] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 61-449. Tissue: Astrocytoma. |
| [14] | Glew M.D., Kirszbaum L., Bozas S.E., Walker I.D. Submitted (JAN-1993) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 140-449. Tissue: Fetal liver. |
| [15] | "Molecular cloning and characterization of the novel, human complement-associated protein, SP-40,40: a link between the complement and reproductive systems." Kirszbaum L., Sharpe J.A., Murphy B., D'Apice J.F.A., Classon B., Hudson P., Walker I.D. EMBO J. 8:711-718(1989) [PubMed: 2721499] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), PARTIAL PROTEIN SEQUENCE. Tissue: Liver. |
| [16] | "SP-40,40, a protein involved in the control of the complement pathway, possesses a unique array of disulphide bridges." Kirszbaum L., Bozas S.E., Walker I.D. FEBS Lett. 297:70-76(1992) [PubMed: 1551440] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE, DISULFIDE BONDS, GLYCOSYLATION AT ASN-86; ASN-103; ASN-145; ASN-291; ASN-354 AND ASN-374. |
| [17] | "Identification of human aging-associated gene." Kim J.W. Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [18] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [19] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [20] | "The apolipoprotein A-I binding protein of placenta and the SP-40,40 protein of human blood are different proteins which both bind to apolipoprotein A-I." Ehnholm C., Bozas S.E., Tenkanen H., Kirszbaum L., Metso J., Murphy B., Walker I.D. Biochim. Biophys. Acta 1086:255-260(1991) [PubMed: 1742316] [Abstract] Cited for: INTERACTION WITH APOA1. |
| [21] | "Identification of the disulfide bonds in human plasma protein SP-40,40 (apolipoprotein-J)." Choi-Miura N.H., Takahashi Y., Nakano Y., Tobe T., Tomita M. J. Biochem. 112:557-561(1992) [PubMed: 1491011] [Abstract] Cited for: DISULFIDE BONDS. |
| [22] | "Apolipoprotein J is associated with paraoxonase in human plasma." Kelso G.J., Stuart W.D., Richter R.J., Furlong C.E., Jordan-Starck T.C., Harmony J.A.K. Biochemistry 33:832-839(1994) [PubMed: 8292612] [Abstract] Cited for: INTERACTION WITH PON1. |
| [23] | "Identification and characterization of glycosylation sites in human serum clusterin." Kapron J.T., Hilliard G.M., Lakins J.N., Tenniswood M.P., West K.A., Carr S.A., Crabb J.W. Protein Sci. 6:2120-2133(1997) [PubMed: 9336835] [Abstract] Cited for: GLYCOSYLATION AT ASN-86; ASN-103; ASN-145; ASN-291; ASN-354 AND ASN-374. |
| [24] | "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry." Zhang H., Li X.-J., Martin D.B., Aebersold R. Nat. Biotechnol. 21:660-666(2003) [PubMed: 12754519] [Abstract] Cited for: GLYCOSYLATION AT ASN-354. |
| [25] | "Isolation and characterization of a novel gene CLUAP1 whose expression is frequently upregulated in colon cancer." Takahashi M., Lin Y.-M., Nakamura Y., Furukawa Y. Oncogene 23:9289-9294(2004) [PubMed: 15480429] [Abstract] Cited for: INTERACTION WITH CLUAP1. |
| [26] | "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry." Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. Proteomics 4:454-465(2004) [PubMed: 14760718] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-354 AND ASN-374, MASS SPECTROMETRY. Tissue: Plasma. |
| [27] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed: 16335952] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-86; ASN-103; ASN-145; ASN-291; ASN-354 AND ASN-374, MASS SPECTROMETRY. Tissue: Plasma. |
| [28] | "Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection." Leong W.F., Chow V.T. Cell. Microbiol. 8:565-580(2006) [PubMed: 16548883] [Abstract] Cited for: INDUCTION, MASS SPECTROMETRY. |
| [29] | "Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry." Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T., Loo J.A. J. Proteome Res. 5:1493-1503(2006) [PubMed: 16740002] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-374, MASS SPECTROMETRY. Tissue: Saliva. |
| [30] | "Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach." Lewandrowski U., Moebius J., Walter U., Sickmann A. Mol. Cell. Proteomics 5:226-233(2006) [PubMed: 16263699] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-374, MASS SPECTROMETRY. Tissue: Platelet. |
| [31] | "Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry." Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F. Proteomics 8:3833-3847(2008) [PubMed: 18780401] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-291; ASN-317 AND ASN-374, MASS SPECTROMETRY. Tissue: Milk. |
| [32] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-86; ASN-103; ASN-145; ASN-354 AND ASN-374, MASS SPECTROMETRY. Tissue: Liver. |
| [33] | "An initial characterization of the serum phosphoproteome." Zhou W., Ross M.M., Tessitore A., Ornstein D., Vanmeter A., Liotta L.A., Petricoin E.F. III J. Proteome Res. 8:5523-5531(2009) [PubMed: 19824718] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-393; SER-394 AND SER-396, TISSUE SPECIFICITY, MASS SPECTROMETRY. Tissue: Serum. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M25915 mRNA. Translation: AAA35692.1. Different initiation. M63379 M63378 Genomic DNA. Translation: AAB06507.1. M64722 mRNA. Translation: AAB06508.1. Sequence problems. CR599675 mRNA. No translation available. BX648414 mRNA. Translation: CAI45990.1. AY341244 Genomic DNA. Translation: AAP88927.1. Different initiation. AF311103 Genomic DNA. No translation available. J02908 mRNA. Translation: AAA51765.1. Different initiation. M74816 mRNA. Translation: AAA60321.1. L00974 Genomic DNA. Translation: AAA60567.1. X14723 mRNA. Translation: CAA32847.1. Different initiation. AY513288 mRNA. Translation: AAT08041.1. Different initiation. AK313870 mRNA. Translation: BAG36598.1. Different initiation. BC010514 mRNA. Translation: AAH10514.1. Different initiation. BC019588 mRNA. Translation: AAH19588.1. Different initiation. |
| IPI | IPI00291262. IPI00400826. |
| PIR | A41386. S43646. |
| RefSeq | NP_001822.2. NP_976084.1. |
| UniGene | Hs.436657 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P10909. 6 interactions. |
| STRING | P10909. |
2-D gel databases | |
| SWISS-2DPAGE | P10909. |
| Cornea-2DPAGE | P10909. |
| DOSAC-COBS-2DPAGE | P10909. |
| OGP | P10909. |
| REPRODUCTION-2DPAGE | IPI00291262. |
Proteomic databases | |
| PRIDE | P10909. |
Genome annotation databases | |
| Ensembl | ENST00000316403; ENSP00000315130; ENSG00000120885; Homo sapiens. [Genome view] ENST00000380446; ENSP00000369812; ENSG00000120885; Homo sapiens. [Genome view] ENST00000405140; ENSP00000385419; ENSG00000120885; Homo sapiens. [Genome view] |
| GeneID | 1191. |
| KEGG | hsa:1191. |
| UCSC | uc003xfw.1. human. |
Organism-specific databases | |
| CTD | 1191. |
| GeneCards | GC08M027510. |
| H-InvDB | HIX0007408. |
| HGNC | HGNC:2095. CLU. |
| HPA | CAB000476. CAB016253. HPA000572. |
| MIM | 185430. gene. |
| PharmGKB | PA26620. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG17094. |
| HOVERGEN | P10909. |
| InParanoid | P10909. |
| OMA | NGDRIDS. |
| OrthoDB | EOG9BP3WX. |
Enzyme and pathway databases | |
| Reactome | REACT_604. Hemostasis. |
Gene expression databases | |
| ArrayExpress | P10909. |
| Bgee | P10909. |
| CleanEx | HS_CLU. |
| Genevestigator | P10909. |
| GermOnline | ENSG00000120885. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR016016. Clusterin. IPR000753. Clusterin-like. IPR016015. Clusterin_C. IPR016014. Clusterin_N. [Graphical view] |
| PANTHER | PTHR10970:SF1. Clusterin. 1 hit. |
| Pfam | PF01093. Clusterin. 1 hit. [Graphical view] |
| PIRSF | PIRSF002368. Clusterin. 1 hit. |
| SMART | SM00035. CLa. 1 hit. SM00030. CLb. 1 hit. [Graphical view] |
| PROSITE | PS00492. CLUSTERIN_1. 1 hit. PS00493. CLUSTERIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 4922. |
| PMAP-CutDB | P10909. |
| SOURCE | Search... |
Entry information
| Entry name | CLUS_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P10909 Secondary accession number(s): B2R9Q1 Q7Z5B9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


