Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic

Gene

RCA

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Activation of RuBisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase; EC 4.1.1.39) involves the ATP-dependent carboxylation of the epsilon-amino group of lysine leading to a carbamate structure.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi165 – 172ATPSequence analysis8

GO - Molecular functioni

  • ADP binding Source: TAIR
  • ATP binding Source: TAIR
  • enzyme regulator activity Source: TAIR
  • ribulose-1,5-bisphosphate carboxylase/oxygenase activator activity Source: TAIR

GO - Biological processi

  • defense response to bacterium Source: TAIR
  • leaf senescence Source: TAIR
  • response to cold Source: TAIR
  • response to jasmonic acid Source: TAIR
  • response to light stimulus Source: TAIR
Complete GO annotation...

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic
Short name:
RA
Short name:
RuBisCO activase
Gene namesi
Name:RCA
Ordered Locus Names:At2g39730
ORF Names:T5I7.3
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 2

Organism-specific databases

TAIRiAT2G39730.

Subcellular locationi

GO - Cellular componenti

  • apoplast Source: TAIR
  • cell wall Source: TAIR
  • chloroplast Source: TAIR
  • chloroplast envelope Source: TAIR
  • chloroplast stroma Source: TAIR
  • chloroplast thylakoid membrane Source: TAIR
  • membrane Source: TAIR
  • nucleus Source: TAIR
  • plastoglobule Source: TAIR
  • stromule Source: TAIR
  • thylakoid Source: TAIR
Complete GO annotation...

Keywords - Cellular componenti

Chloroplast, Plastid

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 58ChloroplastAdd BLAST58
ChainiPRO_000003022859 – 474Ribulose bisphosphate carboxylase/oxygenase activase, chloroplasticAdd BLAST416

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei78Phosphothreonine; by CK21 Publication1
Modified residuei283PhosphothreonineCombined sources1

Post-translational modificationi

Phosphorylated at Thr-78 by CK2.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP10896.
PRIDEiP10896.

2D gel databases

SWISS-2DPAGEP10896.
World-2DPAGE0003:P10896.

PTM databases

iPTMnetiP10896.

Expressioni

Gene expression databases

ExpressionAtlasiP10896. baseline and differential.
GenevisibleiP10896. AT.

Interactioni

Protein-protein interaction databases

BioGridi3896. 3 interactors.
IntActiP10896. 2 interactors.
STRINGi3702.AT2G39730.1.

Structurei

Secondary structure

1474
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi135 – 147Combined sources13
Beta strandi159 – 164Combined sources6
Helixi171 – 181Combined sources11
Beta strandi187 – 190Combined sources4
Helixi204 – 218Combined sources15
Beta strandi225 – 227Combined sources3
Helixi241 – 253Combined sources13
Beta strandi255 – 257Combined sources3
Beta strandi280 – 286Combined sources7
Helixi292 – 297Combined sources6
Beta strandi299 – 304Combined sources6
Helixi309 – 319Combined sources11
Beta strandi321 – 324Combined sources4
Helixi327 – 336Combined sources10
Helixi342 – 364Combined sources23
Helixi366 – 368Combined sources3
Helixi369 – 373Combined sources5
Beta strandi376 – 378Combined sources3
Helixi390 – 414Combined sources25

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4W5WX-ray2.90A59-437[»]
ProteinModelPortaliP10896.
SMRiP10896.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the RuBisCO activase family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG0651. Eukaryota.
COG1222. LUCA.
HOGENOMiHOG000243931.
InParanoidiP10896.
OMAiDFDNTMD.
OrthoDBiEOG09360DH8.
PhylomeDBiP10896.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR003959. ATPase_AAA_core.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00004. AAA. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: P10896-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAVSTVGA INRAPLSLNG SGSGAVSAPA STFLGKKVVT VSRFAQSNKK
60 70 80 90 100
SNGSFKVLAV KEDKQTDGDR WRGLAYDTSD DQQDITRGKG MVDSVFQAPM
110 120 130 140 150
GTGTHHAVLS SYEYVSQGLR QYNLDNMMDG FYIAPAFMDK LVVHITKNFL
160 170 180 190 200
TLPNIKVPLI LGIWGGKGQG KSFQCELVMA KMGINPIMMS AGELESGNAG
210 220 230 240 250
EPAKLIRQRY REAADLIKKG KMCCLFINDL DAGAGRMGGT TQYTVNNQMV
260 270 280 290 300
NATLMNIADN PTNVQLPGMY NKEENARVPI ICTGNDFSTL YAPLIRDGRM
310 320 330 340 350
EKFYWAPTRE DRIGVCKGIF RTDKIKDEDI VTLVDQFPGQ SIDFFGALRA
360 370 380 390 400
RVYDDEVRKF VESLGVEKIG KRLVNSREGP PVFEQPEMTY EKLMEYGNML
410 420 430 440 450
VMEQENVKRV QLAETYLSQA ALGDANADAI GRGTFYGKGA QQVNLPVPEG
460 470
CTDPVAENFD PTARSDDGTC VYNF
Length:474
Mass (Da):51,981
Last modified:December 1, 2000 - v2
Checksum:i4AD07691E1892A4F
GO
Isoform Short (identifier: P10896-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     439-474: GAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVYNF → TEEKEPSK

Show »
Length:446
Mass (Da):49,100
Checksum:i8C29E05DBC8593F4
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti163 – 164IW → SR in CAA32429 (PubMed:2717419).Curated2
Sequence conflicti202 – 203PA → VR in CAA32429 (PubMed:2717419).Curated2
Sequence conflicti226F → L in AAN18180 (PubMed:14593172).Curated1
Sequence conflicti292A → G in CAA32429 (PubMed:2717419).Curated1
Sequence conflicti296R → L in CAA32429 (PubMed:2717419).Curated1
Sequence conflicti304 – 306YWA → LTG in CAA32429 (PubMed:2717419).Curated3
Sequence conflicti316 – 317CK → W in CAA32429 (PubMed:2717419).Curated2
Sequence conflicti339G → D in AAN18180 (PubMed:14593172).Curated1
Sequence conflicti339G → D in AAK96483 (PubMed:14593172).Curated1
Sequence conflicti441 – 442QQ → HE in CAA32429 (PubMed:2717419).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005539439 – 474GAQQV…CVYNF → TEEKEPSK in isoform Short. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X14212 mRNA. Translation: CAA32429.1.
M86720 Genomic DNA. Translation: AAA20202.1.
M86720 Genomic DNA. Translation: AAA20203.1.
AC003000 Genomic DNA. Translation: AAB87122.1.
CP002685 Genomic DNA. Translation: AEC09714.1.
CP002685 Genomic DNA. Translation: AEC09715.1.
AY052703 mRNA. Translation: AAK96607.1.
AF325049 mRNA. Translation: AAG40401.1.
AY052290 mRNA. Translation: AAK96483.1.
AY056108 mRNA. Translation: AAL06995.1.
BT000613 mRNA. Translation: AAN18180.1.
BT000710 mRNA. Translation: AAN31853.1.
AY088487 mRNA. Translation: AAM66023.1.
PIRiS04048.
T01002.
T01003.
RefSeqiNP_565913.1. NM_129531.3. [P10896-1]
NP_850320.1. NM_179989.3. [P10896-2]
UniGeneiAt.25263.
At.25299.
At.25319.
At.47493.

Genome annotation databases

EnsemblPlantsiAT2G39730.1; AT2G39730.1; AT2G39730. [P10896-1]
GeneIDi818558.
GrameneiAT2G39730.1; AT2G39730.1; AT2G39730.
KEGGiath:AT2G39730.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X14212 mRNA. Translation: CAA32429.1.
M86720 Genomic DNA. Translation: AAA20202.1.
M86720 Genomic DNA. Translation: AAA20203.1.
AC003000 Genomic DNA. Translation: AAB87122.1.
CP002685 Genomic DNA. Translation: AEC09714.1.
CP002685 Genomic DNA. Translation: AEC09715.1.
AY052703 mRNA. Translation: AAK96607.1.
AF325049 mRNA. Translation: AAG40401.1.
AY052290 mRNA. Translation: AAK96483.1.
AY056108 mRNA. Translation: AAL06995.1.
BT000613 mRNA. Translation: AAN18180.1.
BT000710 mRNA. Translation: AAN31853.1.
AY088487 mRNA. Translation: AAM66023.1.
PIRiS04048.
T01002.
T01003.
RefSeqiNP_565913.1. NM_129531.3. [P10896-1]
NP_850320.1. NM_179989.3. [P10896-2]
UniGeneiAt.25263.
At.25299.
At.25319.
At.47493.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4W5WX-ray2.90A59-437[»]
ProteinModelPortaliP10896.
SMRiP10896.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi3896. 3 interactors.
IntActiP10896. 2 interactors.
STRINGi3702.AT2G39730.1.

PTM databases

iPTMnetiP10896.

2D gel databases

SWISS-2DPAGEP10896.
World-2DPAGE0003:P10896.

Proteomic databases

PaxDbiP10896.
PRIDEiP10896.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT2G39730.1; AT2G39730.1; AT2G39730. [P10896-1]
GeneIDi818558.
GrameneiAT2G39730.1; AT2G39730.1; AT2G39730.
KEGGiath:AT2G39730.

Organism-specific databases

TAIRiAT2G39730.

Phylogenomic databases

eggNOGiKOG0651. Eukaryota.
COG1222. LUCA.
HOGENOMiHOG000243931.
InParanoidiP10896.
OMAiDFDNTMD.
OrthoDBiEOG09360DH8.
PhylomeDBiP10896.

Miscellaneous databases

PROiP10896.

Gene expression databases

ExpressionAtlasiP10896. baseline and differential.
GenevisibleiP10896. AT.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR003959. ATPase_AAA_core.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00004. AAA. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiRCA_ARATH
AccessioniPrimary (citable) accession number: P10896
Secondary accession number(s): Q39197
, Q39198, Q8H172, Q940T8, Q941B7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: December 1, 2000
Last modified: November 30, 2016
This is version 147 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.