Reviewed,
UniProtKB/Swiss-Prot P10896 (RCA_ARATH)
Last modified
June 16, 2009.
Version 94.
History...
Clusters with 100%,
90%,
50% identity |
 Documents (2) |
 Third-party data |
 Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Binary interactions · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic Short name=RuBisCO activase Short name=RA | ||||||
| Gene names |
| ||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Complete proteome] | ||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › eurosids II › Brassicales › Brassicaceae › Arabidopsis |
Protein attributes
| Sequence length | 474 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Activation of RuBisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase; EC 4.1.1.39) involves the ATP-dependent carboxylation of the epsilon-amino group of lysine leading to a carbamate structure. |
| Subcellular location | Plastid › chloroplast stroma. Plastid › chloroplast › plastoglobule. Ref.7 Ref.8 |
| Sequence similarities | Belongs to the RuBisCO activase family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: P10896-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: P10896-2) The sequence of this isoform differs from the canonical sequence as follows: 439-474: GAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVYNF → TEEKEPSK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 58 | 58 | Chloroplast | ||||||
| Chain | 59 – 474 | 416 | Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic | PRO_0000030228 | |||||
Regions | |||||||||
| Nucleotide binding | 165 – 172 | 8 | ATP Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 439 – 474 | 36 | GAQQV…CVYNF → TEEKEPSK in isoform Short. | VSP_005539 | |||||
Experimental info | |||||||||
| Sequence conflict | 163 – 164 | 2 | IW → SR in CAA32429. Ref.1 | ||||||
| Sequence conflict | 202 – 203 | 2 | PA → VR in CAA32429. Ref.1 | ||||||
| Sequence conflict | 292 | 1 | A → G in CAA32429. Ref.1 | ||||||
| Sequence conflict | 296 | 1 | R → L in CAA32429. Ref.1 | ||||||
| Sequence conflict | 304 – 306 | 3 | YWA → LTG in CAA32429. Ref.1 | ||||||
| Sequence conflict | 316 – 317 | 2 | CK → W in CAA32429. Ref.1 | ||||||
| Sequence conflict | 441 – 442 | 2 | QQ → HE in CAA32429. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure of an Arabidopsis thaliana cDNA encoding rubisco activase." Werneke J.M., Ogren W.L. Nucleic Acids Res. 17:2871-2871(1989) [PubMed: 2717419] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Leaf. |
| [2] | "Molecular basis of the ribulose-1,5-bisphosphate carboxylase/oxygenase activase mutation in Arabidopsis thaliana is a guanine-to-adenine transition at the 5'-splice junction of intron 3." Orozco B.M., McClung C.R., Werneke J.M., Ogren W.L. Plant Physiol. 102:227-232(1993) [PubMed: 8108496] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana." Lin X., Kaul S., Rounsley S.D., Shea T.P., Benito M.-I., Town C.D., Fujii C.Y., Mason T.M., Bowman C.L., Barnstead M.E., Feldblyum T.V., Buell C.R., Ketchum K.A., Lee J.J., Ronning C.M., Koo H.L., Moffat K.S., Cronin L.A.  Venter J.C.Nature 402:761-768(1999) [PubMed: 10617197] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [4] | "Empirical analysis of transcriptional activity in the Arabidopsis genome." Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. Ecker J.R.Science 302:842-846(2003) [PubMed: 14593172] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). Strain: cv. Columbia. |
| [5] | "Full-length cDNA from Arabidopsis thaliana." Brover V.V., Troukhan M.E., Alexandrov N.A., Lu Y.-P., Flavell R.B., Feldmann K.A. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [6] | "Alternative mRNA splicing generates the two ribulosebisphosphate carboxylase/oxygenase activase polypeptides in spinach and Arabidopsis." Werneke J.M., Chatfield J.M., Ogren W.L. Plant Cell 1:815-825(1989) [PubMed: 2535524] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| [7] | "Proteomics of the chloroplast envelope membranes from Arabidopsis thaliana." Ferro M., Salvi D., Brugiere S., Miras S., Kowalski S., Louwagie M., Garin J., Joyard J., Rolland N. Mol. Cell. Proteomics 2:325-345(2003) [PubMed: 12766230] [Abstract] Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [8] | "Protein profiling of plastoglobules in chloroplasts and chromoplasts. A surprising site for differential accumulation of metabolic enzymes." Ytterberg A.J., Peltier J.-B., van Wijk K.J. Plant Physiol. 140:984-997(2006) [PubMed: 16461379] [Abstract] Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| X14212 mRNA. Translation: CAA32429.1. M86720 Genomic DNA. Translation: AAA20202.1. M86720 Genomic DNA. Translation: AAA20203.1. AC003000 Genomic DNA. Translation: AAB87122.1. AY052703 mRNA. Translation: AAK96607.1. AF325049 mRNA. Translation: AAG40401.1. AY056108 mRNA. Translation: AAL06995.1. BT000710 mRNA. Translation: AAN31853.1. AY088487 mRNA. Translation: AAM66023.1. | |
| IPI | IPI00518163. IPI00526733. |
| PIR | S04048. T01002. T01003. |
| RefSeq | NP_565913.1. |
| UniGene | At.25299 At.25319 At.47493 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P10896. 1 interaction. |
2-D gel databases | |
| SWISS-2DPAGE | P10896. |
Proteomic databases | |
| PRIDE | P10896. |
| ProMEX | P10896. |
Genome annotation databases | |
| GeneID | 818558. |
| GenomeReviews | Gene locus AT2G39730 in contig CT485783_GR. |
| KEGG | ath:AT2G39730. |
| NMPDR | fig|3702.1.peg.11091. |
Organism-specific databases | |
| TAIR | At2g39730. |
Phylogenomic databases | |
| OMA | P10896. RDDRIGV. |
Gene expression databases | |
| ArrayExpress | P10896. |
Family and domain databases | |
| InterPro | IPR003959. ATPase_AAA_core. [Graphical view] |
| Pfam | PF00004. AAA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | RCA_ARATH | ||||||||
| Accession | Primary (citable) accession number: P10896 Secondary accession number(s): Q39197, Q39198, Q940T8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | PPAP (Plant Proteome Annotation Project) | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |
