Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P10747

- CD28_HUMAN

UniProt

P10747 - CD28_HUMAN

Protein

T-cell-specific surface glycoprotein CD28

Gene

CD28

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 157 (01 Oct 2014)
      Sequence version 1 (01 Jul 1989)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.

    GO - Molecular functioni

    1. coreceptor activity Source: UniProtKB
    2. identical protein binding Source: UniProtKB
    3. protease binding Source: BHF-UCL
    4. protein binding Source: UniProtKB
    5. SH3/SH2 adaptor activity Source: UniProtKB

    GO - Biological processi

    1. apoptotic signaling pathway Source: Ensembl
    2. cell surface receptor signaling pathway Source: UniProtKB
    3. cytokine biosynthetic process Source: UniProtKB
    4. epidermal growth factor receptor signaling pathway Source: Reactome
    5. Fc-epsilon receptor signaling pathway Source: Reactome
    6. fibroblast growth factor receptor signaling pathway Source: Reactome
    7. humoral immune response Source: UniProtKB
    8. innate immune response Source: Reactome
    9. negative thymic T cell selection Source: Ensembl
    10. neurotrophin TRK receptor signaling pathway Source: Reactome
    11. phosphatidylinositol-mediated signaling Source: Reactome
    12. positive regulation of alpha-beta T cell proliferation Source: Ensembl
    13. positive regulation of inflammatory response to antigenic stimulus Source: Ensembl
    14. positive regulation of interleukin-2 biosynthetic process Source: UniProtKB
    15. positive regulation of isotype switching to IgG isotypes Source: Ensembl
    16. positive regulation of mitosis Source: UniProtKB
    17. positive regulation of signal transduction Source: GOC
    18. positive regulation of T cell proliferation Source: UniProtKB
    19. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
    20. positive regulation of translation Source: UniProtKB
    21. positive regulation of viral genome replication Source: UniProtKB
    22. regulation of defense response to virus by virus Source: Reactome
    23. regulatory T cell differentiation Source: BHF-UCL
    24. T cell costimulation Source: Reactome
    25. viral process Source: Reactome

    Enzyme and pathway databases

    ReactomeiREACT_11139. Nef mediated downregulation of CD28 cell surface expression.
    REACT_147727. Constitutive PI3K/AKT Signaling in Cancer.
    REACT_19183. CD28 co-stimulation.
    REACT_19238. CD28 dependent Vav1 pathway.
    REACT_19358. CD28 dependent PI3K/Akt signaling.
    REACT_75829. PIP3 activates AKT signaling.
    SignaLinkiP10747.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    T-cell-specific surface glycoprotein CD28
    Alternative name(s):
    TP44
    CD_antigen: CD28
    Gene namesi
    Name:CD28
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:1653. CD28.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. external side of plasma membrane Source: MGI
    3. integral component of plasma membrane Source: UniProtKB
    4. plasma membrane Source: MGI

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26207.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1818Add
    BLAST
    Chaini19 – 220202T-cell-specific surface glycoprotein CD28PRO_0000014652Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi37 – 371N-linked (GlcNAc...)1 Publication
    Disulfide bondi40 ↔ 1121 Publication
    Disulfide bondi66 ↔ 861 Publication
    Glycosylationi71 – 711N-linked (GlcNAc...)1 Publication
    Glycosylationi92 – 921N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi105 – 1051N-linked (GlcNAc...)1 Publication
    Glycosylationi129 – 1291N-linked (GlcNAc...)1 Publication
    Modified residuei189 – 1891Phosphoserine1 Publication
    Modified residuei191 – 1911Phosphotyrosine1 Publication
    Modified residuei209 – 2091Phosphotyrosine1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiP10747.
    PaxDbiP10747.
    PRIDEiP10747.

    PTM databases

    PhosphoSiteiP10747.

    Expressioni

    Tissue specificityi

    Expressed in T-cells and plasma cells, but not in less mature B-cells.

    Gene expression databases

    ArrayExpressiP10747.
    BgeeiP10747.
    CleanExiHS_CD28.
    GenevestigatoriP10747.

    Interactioni

    Subunit structurei

    Homodimer; disulfide-linked. Interacts with DUSP14. Binds to CD80/B7-1 and CD86/B7-2/B70. Interacts with GRB2.2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PIK3R1P279868EBI-4314301,EBI-79464

    Protein-protein interaction databases

    BioGridi107378. 12 interactions.
    DIPiDIP-6043N.
    IntActiP10747. 7 interactions.
    MINTiMINT-4656075.

    Structurei

    Secondary structure

    1
    220
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi27 – 304
    Beta strandi35 – 439
    Beta strandi49 – 5810
    Beta strandi64 – 7411
    Beta strandi77 – 793
    Beta strandi81 – 833
    Beta strandi85 – 906
    Beta strandi92 – 10110
    Helixi104 – 1063
    Beta strandi108 – 12114
    Beta strandi123 – 1253
    Beta strandi131 – 1344

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1YJDX-ray2.70C17-152[»]
    3WA4X-ray1.35B189-196[»]
    ProteinModelPortaliP10747.
    SMRiP10747. Positions 19-136.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP10747.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini19 – 152134ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini180 – 22041CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei153 – 17927HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini28 – 137110Ig-like V-typeAdd
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG48152.
    HOVERGENiHBG004094.
    InParanoidiP10747.
    KOiK06470.
    OMAiAPTYANS.
    OrthoDBiEOG7W6WMJ.
    PhylomeDBiP10747.
    TreeFamiTF335679.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    InterProiIPR008093. CD28.
    IPR013783. Ig-like_fold.
    IPR013106. Ig_V-set.
    [Graphical view]
    PfamiPF07686. V-set. 1 hit.
    [Graphical view]
    PRINTSiPR01717. CD28ANTIGEN.

    Sequences (7)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P10747-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLRLLLALNL FPSIQVTGNK ILVKQSPMLV AYDNAVNLSC KYSYNLFSRE    50
    FRASLHKGLD SAVEVCVVYG NYSQQLQVYS KTGFNCDGKL GNESVTFYLQ 100
    NLYVNQTDIY FCKIEVMYPP PYLDNEKSNG TIIHVKGKHL CPSPLFPGPS 150
    KPFWVLVVVG GVLACYSLLV TVAFIIFWVR SKRSRLLHSD YMNMTPRRPG 200
    PTRKHYQPYA PPRDFAAYRS 220
    Length:220
    Mass (Da):25,066
    Last modified:July 1, 1989 - v1
    Checksum:i1D9B6552A5878D0F
    GO
    Isoform 2 (identifier: P10747-2) [UniParc]FASTAAdd to Basket

    Also known as: CD28-S2

    The sequence of this isoform differs from the canonical sequence as follows:
         19-137: Missing.

    Show »
    Length:101
    Mass (Da):11,528
    Checksum:iF9B205F1D1BBFDC9
    GO
    Isoform 3 (identifier: P10747-3) [UniParc]FASTAAdd to Basket

    Also known as: CD28i

    The sequence of this isoform differs from the canonical sequence as follows:
         40-124: CKYSYNLFSR...EVMYPPPYLD → Y

    Show »
    Length:136
    Mass (Da):15,369
    Checksum:iC9AF33467706D2BE
    GO
    Isoform 4 (identifier: P10747-4) [UniParc]FASTAAdd to Basket

    Also known as: CD28-S1

    The sequence of this isoform differs from the canonical sequence as follows:
         40-137: CKYSYNLFSR...SNGTIIHVKG → W

    Show »
    Length:123
    Mass (Da):14,014
    Checksum:i3DE54211F2642520
    GO
    Isoform 5 (identifier: P10747-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-124: CKYSYNLFSR...EVMYPPPYLD → Y
         138-139: KH → EE
         140-220: Missing.

    Show »
    Length:55
    Mass (Da):6,099
    Checksum:iA2F24E0CFBD16D90
    GO
    Isoform 6 (identifier: P10747-6) [UniParc]FASTAAdd to Basket

    Also known as: CD28-S3

    The sequence of this isoform differs from the canonical sequence as follows:
         40-124: CKYSYNLFSR...EVMYPPPYLD → Y
         152-207: Missing.

    Show »
    Length:80
    Mass (Da):8,823
    Checksum:iC09D0EC41F748AFC
    GO
    Isoform 7 (identifier: P10747-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-17: MLRLLLALNLFPSIQVT → MPCGLSALIMCPKGMVAVVVAVDDGDSQALA

    Show »
    Length:234
    Mass (Da):26,186
    Checksum:i02AD85397834E57E
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1717MLRLL…SIQVT → MPCGLSALIMCPKGMVAVVV AVDDGDSQALA in isoform 7. 1 PublicationVSP_047701Add
    BLAST
    Alternative sequencei19 – 137119Missing in isoform 2. 1 PublicationVSP_002494Add
    BLAST
    Alternative sequencei40 – 13798CKYSY…IHVKG → W in isoform 4. 1 PublicationVSP_002496Add
    BLAST
    Alternative sequencei40 – 12485CKYSY…PPYLD → Y in isoform 3, isoform 5 and isoform 6. 2 PublicationsVSP_002495Add
    BLAST
    Alternative sequencei138 – 1392KH → EE in isoform 5. 1 PublicationVSP_002497
    Alternative sequencei140 – 22081Missing in isoform 5. 1 PublicationVSP_002498Add
    BLAST
    Alternative sequencei152 – 20756Missing in isoform 6. 1 PublicationVSP_002499Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    J02988 mRNA. Translation: AAA60581.1.
    M37815
    , M37812, M37813, M37814 Genomic DNA. Translation: AAA51944.1.
    M37815
    , M37812, M37813, M37814 Genomic DNA. Translation: AAA51945.1.
    AJ295273 mRNA. Translation: CAC29237.1.
    AF222341 mRNA. Translation: AAF33792.1.
    AF222342 mRNA. Translation: AAF33793.1.
    AF222343 mRNA. Translation: AAF33794.1.
    AJ517504 mRNA. Translation: CAD57003.1.
    EF064755 Genomic DNA. Translation: ABK41938.1.
    AK292986 mRNA. Translation: BAF85675.1.
    AK313313 mRNA. Translation: BAG36118.1.
    AC125238 Genomic DNA. Translation: AAY24123.1.
    CH471063 Genomic DNA. Translation: EAW70348.1.
    BC093698 mRNA. Translation: AAH93698.1.
    BC112085 mRNA. Translation: AAI12086.1.
    AF411057 Genomic DNA. Translation: AAL40931.1.
    CCDSiCCDS2361.1. [P10747-1]
    CCDS58749.1. [P10747-2]
    PIRiA39983. RWHU28.
    RefSeqiNP_001230006.1. NM_001243077.1. [P10747-4]
    NP_001230007.1. NM_001243078.1. [P10747-2]
    NP_006130.1. NM_006139.3. [P10747-1]
    UniGeneiHs.443123.

    Genome annotation databases

    EnsembliENST00000324106; ENSP00000324890; ENSG00000178562. [P10747-1]
    ENST00000374481; ENSP00000363605; ENSG00000178562. [P10747-3]
    ENST00000458610; ENSP00000393648; ENSG00000178562. [P10747-7]
    GeneIDi940.
    KEGGihsa:940.
    UCSCiuc002vah.4. human. [P10747-1]
    uc010ftx.3. human. [P10747-2]
    uc010zio.2. human. [P10747-4]

    Polymorphism databases

    DMDMi115973.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Wikipedia

    CD28 entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    J02988 mRNA. Translation: AAA60581.1 .
    M37815
    , M37812 , M37813 , M37814 Genomic DNA. Translation: AAA51944.1 .
    M37815
    , M37812 , M37813 , M37814 Genomic DNA. Translation: AAA51945.1 .
    AJ295273 mRNA. Translation: CAC29237.1 .
    AF222341 mRNA. Translation: AAF33792.1 .
    AF222342 mRNA. Translation: AAF33793.1 .
    AF222343 mRNA. Translation: AAF33794.1 .
    AJ517504 mRNA. Translation: CAD57003.1 .
    EF064755 Genomic DNA. Translation: ABK41938.1 .
    AK292986 mRNA. Translation: BAF85675.1 .
    AK313313 mRNA. Translation: BAG36118.1 .
    AC125238 Genomic DNA. Translation: AAY24123.1 .
    CH471063 Genomic DNA. Translation: EAW70348.1 .
    BC093698 mRNA. Translation: AAH93698.1 .
    BC112085 mRNA. Translation: AAI12086.1 .
    AF411057 Genomic DNA. Translation: AAL40931.1 .
    CCDSi CCDS2361.1. [P10747-1 ]
    CCDS58749.1. [P10747-2 ]
    PIRi A39983. RWHU28.
    RefSeqi NP_001230006.1. NM_001243077.1. [P10747-4 ]
    NP_001230007.1. NM_001243078.1. [P10747-2 ]
    NP_006130.1. NM_006139.3. [P10747-1 ]
    UniGenei Hs.443123.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1YJD X-ray 2.70 C 17-152 [» ]
    3WA4 X-ray 1.35 B 189-196 [» ]
    ProteinModelPortali P10747.
    SMRi P10747. Positions 19-136.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107378. 12 interactions.
    DIPi DIP-6043N.
    IntActi P10747. 7 interactions.
    MINTi MINT-4656075.

    Chemistry

    ChEMBLi CHEMBL5191.

    PTM databases

    PhosphoSitei P10747.

    Polymorphism databases

    DMDMi 115973.

    Proteomic databases

    MaxQBi P10747.
    PaxDbi P10747.
    PRIDEi P10747.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000324106 ; ENSP00000324890 ; ENSG00000178562 . [P10747-1 ]
    ENST00000374481 ; ENSP00000363605 ; ENSG00000178562 . [P10747-3 ]
    ENST00000458610 ; ENSP00000393648 ; ENSG00000178562 . [P10747-7 ]
    GeneIDi 940.
    KEGGi hsa:940.
    UCSCi uc002vah.4. human. [P10747-1 ]
    uc010ftx.3. human. [P10747-2 ]
    uc010zio.2. human. [P10747-4 ]

    Organism-specific databases

    CTDi 940.
    GeneCardsi GC02P204535.
    HGNCi HGNC:1653. CD28.
    MIMi 186760. gene.
    neXtProti NX_P10747.
    PharmGKBi PA26207.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG48152.
    HOVERGENi HBG004094.
    InParanoidi P10747.
    KOi K06470.
    OMAi APTYANS.
    OrthoDBi EOG7W6WMJ.
    PhylomeDBi P10747.
    TreeFami TF335679.

    Enzyme and pathway databases

    Reactomei REACT_11139. Nef mediated downregulation of CD28 cell surface expression.
    REACT_147727. Constitutive PI3K/AKT Signaling in Cancer.
    REACT_19183. CD28 co-stimulation.
    REACT_19238. CD28 dependent Vav1 pathway.
    REACT_19358. CD28 dependent PI3K/Akt signaling.
    REACT_75829. PIP3 activates AKT signaling.
    SignaLinki P10747.

    Miscellaneous databases

    ChiTaRSi CD28. human.
    EvolutionaryTracei P10747.
    GeneWikii CD28.
    GenomeRNAii 940.
    NextBioi 3894.
    PROi P10747.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P10747.
    Bgeei P10747.
    CleanExi HS_CD28.
    Genevestigatori P10747.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    InterProi IPR008093. CD28.
    IPR013783. Ig-like_fold.
    IPR013106. Ig_V-set.
    [Graphical view ]
    Pfami PF07686. V-set. 1 hit.
    [Graphical view ]
    PRINTSi PR01717. CD28ANTIGEN.
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of a CD28 cDNA by a high-efficiency COS cell expression system."
      Aruffo A., Seed B.
      Proc. Natl. Acad. Sci. U.S.A. 84:8573-8577(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "The genomic organization of the CD28 gene. Implications for the regulation of CD28 mRNA expression and heterogeneity."
      Lee K.P., Taylor C., Petryniak B., Turka L.A., June C.H., Thompson C.B.
      J. Immunol. 145:344-352(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 3), ALTERNATIVE SPLICING.
    3. "A novel CD28 mRNA variant and simultaneous presence of various CD28 mRNA isoforms in human T lymphocytes."
      Deshpande M., Venuprasad K., Parab P.B., Saha B., Mitra D.
      Hum. Immunol. 63:20-23(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
    4. "A novel costimulatory signaling in human T lymphocytes by a splice variant of CD28."
      Hanawa H., Ma Y., Mikolajczak S.A., Charles M.L., Yoshida T., Yoshida R., Strathdee C.A., Litchfield D.W., Ochi A.
      Blood 99:2138-2145(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 4 AND 6), CHARACTERIZATION (ISOFORM 3).
      Tissue: Peripheral blood T-cell.
    5. "New human CD28 isoforms generated by a novel splicing event in the 5'UTR."
      Gan S.U., Hare J., Krivoshchapov L., Hui K.M., Galea-Lauri J., Farzaneh F., Darling D.
      Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7).
    6. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Synovium and Trachea.
    8. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    11. "Assembly and annotation of human chromosome 2q33 sequence containing the CD28, CTLA4, and ICOS gene cluster: analysis by computational, comparative, and microarray approaches."
      Ling V., Wu P.W., Finnerty H.F., Agostino M.J., Graham J.R., Chen S., Jussiff J.M., Fisk G.J., Miller C.P., Collins M.
      Genomics 78:155-168(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-178 (ISOFORM 1).
    12. "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry."
      Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C.
      Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-209, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    13. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
      Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
      Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-71 AND ASN-129.
      Tissue: Leukemic T-cell.
    14. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-189 AND TYR-191, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    15. Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 17-152 IN COMPLEX WITH THE FAB FRAGMENT OF A MITOGENIC ANTIBODY, DISULFIDE BONDS, GLYCOSYLATION AT ASN-37 AND ASN-105.
    16. "High resolution crystal structure of the Grb2 SH2 domain with a phosphopeptide derived from CD28."
      Higo K., Ikura T., Oda M., Morii H., Takahashi J., Abe R., Ito N.
      PLoS ONE 8:E74482-E74482(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.35 ANGSTROMS) OF 189-196 IN COMPLEX WITH GRB2, INTERACTION WITH GRB2.

    Entry informationi

    Entry nameiCD28_HUMAN
    AccessioniPrimary (citable) accession number: P10747
    Secondary accession number(s): A8KAC1
    , Q13964, Q52M23, Q70WG0, Q8NI54, Q8NI55, Q8NI56, Q8WXJ2, Q9BYV0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 1, 1989
    Last sequence update: July 1, 1989
    Last modified: October 1, 2014
    This is version 157 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    3. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3