Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P10747 (CD28_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 155. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
T-cell-specific surface glycoprotein CD28
Alternative name(s):
TP44
CD_antigen=CD28
Gene names
Name:CD28
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length220 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.

Subunit structure

Homodimer; disulfide-linked. Interacts with DUSP14. Binds to CD80/B7-1 and CD86/B7-2/B70. Interacts with GRB2. Ref.15 Ref.16

Subcellular location

Membrane; Single-pass type I membrane protein.

Tissue specificity

Expressed in T-cells and plasma cells, but not in less mature B-cells.

Sequence similarities

Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Ontologies

Keywords
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainImmunoglobulin domain
Signal
Transmembrane
Transmembrane helix
   PTMDisulfide bond
Glycoprotein
Phosphoprotein
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processFc-epsilon receptor signaling pathway

Traceable author statement. Source: Reactome

T cell costimulation

Traceable author statement. Source: Reactome

apoptotic signaling pathway

Inferred from electronic annotation. Source: Ensembl

cell surface receptor signaling pathway

Traceable author statement PubMed 9784967. Source: UniProtKB

cytokine biosynthetic process

Traceable author statement PubMed 8717514. Source: UniProtKB

epidermal growth factor receptor signaling pathway

Traceable author statement. Source: Reactome

fibroblast growth factor receptor signaling pathway

Traceable author statement. Source: Reactome

humoral immune response

Traceable author statement PubMed 8717514. Source: UniProtKB

innate immune response

Traceable author statement. Source: Reactome

negative thymic T cell selection

Inferred from electronic annotation. Source: Ensembl

neurotrophin TRK receptor signaling pathway

Traceable author statement. Source: Reactome

phosphatidylinositol-mediated signaling

Traceable author statement. Source: Reactome

positive regulation of T cell proliferation

Inferred from direct assay PubMed 3159820. Source: UniProtKB

positive regulation of alpha-beta T cell proliferation

Inferred from electronic annotation. Source: Ensembl

positive regulation of inflammatory response to antigenic stimulus

Inferred from electronic annotation. Source: Ensembl

positive regulation of interleukin-2 biosynthetic process

Inferred from direct assay PubMed 3875683. Source: UniProtKB

positive regulation of isotype switching to IgG isotypes

Inferred from electronic annotation. Source: Ensembl

positive regulation of mitosis

Inferred from direct assay PubMed 3159820. Source: UniProtKB

positive regulation of signal transduction

Inferred from direct assay PubMed 19641626. Source: GOC

positive regulation of transcription from RNA polymerase II promoter

Inferred from electronic annotation. Source: Ensembl

positive regulation of translation

Non-traceable author statement PubMed 12028592. Source: UniProtKB

positive regulation of viral genome replication

Non-traceable author statement PubMed 7492435. Source: UniProtKB

regulation of defense response to virus by virus

Traceable author statement. Source: Reactome

regulatory T cell differentiation

Inferred from direct assay PubMed 18641304. Source: BHF-UCL

viral process

Traceable author statement. Source: Reactome

   Cellular_componentcytosol

Traceable author statement. Source: Reactome

external side of plasma membrane

Inferred from direct assay PubMed 11390434. Source: MGI

integral component of plasma membrane

Traceable author statement PubMed 9784967. Source: UniProtKB

plasma membrane

Inferred from direct assay PubMed 11390434. Source: MGI

   Molecular_functionSH3/SH2 adaptor activity

Inferred from direct assay PubMed 19641626. Source: UniProtKB

coreceptor activity

Traceable author statement PubMed 9784967. Source: UniProtKB

identical protein binding

Non-traceable author statement PubMed 3159820. Source: UniProtKB

protease binding

Inferred from physical interaction PubMed 12777399. Source: BHF-UCL

protein binding

Inferred from physical interaction PubMed 11285224PubMed 15554700PubMed 9784967. Source: UniProtKB

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

PIK3R1P279868EBI-4314301,EBI-79464

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P10747-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P10747-2)

Also known as: CD28-S2;

The sequence of this isoform differs from the canonical sequence as follows:
     19-137: Missing.
Isoform 3 (identifier: P10747-3)

Also known as: CD28i;

The sequence of this isoform differs from the canonical sequence as follows:
     40-124: CKYSYNLFSR...EVMYPPPYLD → Y
Isoform 4 (identifier: P10747-4)

Also known as: CD28-S1;

The sequence of this isoform differs from the canonical sequence as follows:
     40-137: CKYSYNLFSR...SNGTIIHVKG → W
Isoform 5 (identifier: P10747-5)

The sequence of this isoform differs from the canonical sequence as follows:
     40-124: CKYSYNLFSR...EVMYPPPYLD → Y
     138-139: KH → EE
     140-220: Missing.
Isoform 6 (identifier: P10747-6)

Also known as: CD28-S3;

The sequence of this isoform differs from the canonical sequence as follows:
     40-124: CKYSYNLFSR...EVMYPPPYLD → Y
     152-207: Missing.
Isoform 7 (identifier: P10747-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MLRLLLALNLFPSIQVT → MPCGLSALIMCPKGMVAVVVAVDDGDSQALA

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1818
Chain19 – 220202T-cell-specific surface glycoprotein CD28
PRO_0000014652

Regions

Topological domain19 – 152134Extracellular Potential
Transmembrane153 – 17927Helical; Potential
Topological domain180 – 22041Cytoplasmic Potential
Domain28 – 137110Ig-like V-type

Amino acid modifications

Modified residue1891Phosphoserine Ref.14
Modified residue1911Phosphotyrosine Ref.14
Modified residue2091Phosphotyrosine Ref.12
Glycosylation371N-linked (GlcNAc...) Ref.15
Glycosylation711N-linked (GlcNAc...) Ref.13
Glycosylation921N-linked (GlcNAc...) Potential
Glycosylation1051N-linked (GlcNAc...) Ref.15
Glycosylation1291N-linked (GlcNAc...) Ref.13
Disulfide bond40 ↔ 112 Ref.15
Disulfide bond66 ↔ 86 Ref.15

Natural variations

Alternative sequence1 – 1717MLRLL…SIQVT → MPCGLSALIMCPKGMVAVVV AVDDGDSQALA in isoform 7.
VSP_047701
Alternative sequence19 – 137119Missing in isoform 2.
VSP_002494
Alternative sequence40 – 13798CKYSY…IHVKG → W in isoform 4.
VSP_002496
Alternative sequence40 – 12485CKYSY…PPYLD → Y in isoform 3, isoform 5 and isoform 6.
VSP_002495
Alternative sequence138 – 1392KH → EE in isoform 5.
VSP_002497
Alternative sequence140 – 22081Missing in isoform 5.
VSP_002498
Alternative sequence152 – 20756Missing in isoform 6.
VSP_002499

Secondary structure

......................... 220
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 1, 1989. Version 1.
Checksum: 1D9B6552A5878D0F

FASTA22025,066
        10         20         30         40         50         60 
MLRLLLALNL FPSIQVTGNK ILVKQSPMLV AYDNAVNLSC KYSYNLFSRE FRASLHKGLD 

        70         80         90        100        110        120 
SAVEVCVVYG NYSQQLQVYS KTGFNCDGKL GNESVTFYLQ NLYVNQTDIY FCKIEVMYPP 

       130        140        150        160        170        180 
PYLDNEKSNG TIIHVKGKHL CPSPLFPGPS KPFWVLVVVG GVLACYSLLV TVAFIIFWVR 

       190        200        210        220 
SKRSRLLHSD YMNMTPRRPG PTRKHYQPYA PPRDFAAYRS 

« Hide

Isoform 2 (CD28-S2) [UniParc].

Checksum: F9B205F1D1BBFDC9
Show »

FASTA10111,528
Isoform 3 (CD28i) [UniParc].

Checksum: C9AF33467706D2BE
Show »

FASTA13615,369
Isoform 4 (CD28-S1) [UniParc].

Checksum: 3DE54211F2642520
Show »

FASTA12314,014
Isoform 5 [UniParc].

Checksum: A2F24E0CFBD16D90
Show »

FASTA556,099
Isoform 6 (CD28-S3) [UniParc].

Checksum: C09D0EC41F748AFC
Show »

FASTA808,823
Isoform 7 [UniParc].

Checksum: 02AD85397834E57E
Show »

FASTA23426,186

References

« Hide 'large scale' references
[1]"Molecular cloning of a CD28 cDNA by a high-efficiency COS cell expression system."
Aruffo A., Seed B.
Proc. Natl. Acad. Sci. U.S.A. 84:8573-8577(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"The genomic organization of the CD28 gene. Implications for the regulation of CD28 mRNA expression and heterogeneity."
Lee K.P., Taylor C., Petryniak B., Turka L.A., June C.H., Thompson C.B.
J. Immunol. 145:344-352(1990) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 3), ALTERNATIVE SPLICING.
[3]"A novel CD28 mRNA variant and simultaneous presence of various CD28 mRNA isoforms in human T lymphocytes."
Deshpande M., Venuprasad K., Parab P.B., Saha B., Mitra D.
Hum. Immunol. 63:20-23(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
[4]"A novel costimulatory signaling in human T lymphocytes by a splice variant of CD28."
Hanawa H., Ma Y., Mikolajczak S.A., Charles M.L., Yoshida T., Yoshida R., Strathdee C.A., Litchfield D.W., Ochi A.
Blood 99:2138-2145(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 4 AND 6), CHARACTERIZATION (ISOFORM 3).
Tissue: Peripheral blood T-cell.
[5]"New human CD28 isoforms generated by a novel splicing event in the 5'UTR."
Gan S.U., Hare J., Krivoshchapov L., Hui K.M., Galea-Lauri J., Farzaneh F., Darling D.
Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7).
[6]Livingston R.J., Shaffer T., McFarland I., Nguyen C.P., Stanaway I.B., Rajkumar N., Johnson E.J., da Ponte S.H., Willa H., Ahearn M.O., Bertucci C., Acklestad J., Carroll A., Swanson J., Gildersleeve H.I., Nickerson D.A.
Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[7]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Synovium and Trachea.
[8]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
[11]"Assembly and annotation of human chromosome 2q33 sequence containing the CD28, CTLA4, and ICOS gene cluster: analysis by computational, comparative, and microarray approaches."
Ling V., Wu P.W., Finnerty H.F., Agostino M.J., Graham J.R., Chen S., Jussiff J.M., Fisk G.J., Miller C.P., Collins M.
Genomics 78:155-168(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-178 (ISOFORM 1).
[12]"Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry."
Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C.
Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-209, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[13]"Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-71 AND ASN-129.
Tissue: Leukemic T-cell.
[14]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-189 AND TYR-191, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[15]"Crystal structure of a soluble CD28-Fab complex."
Evans E.J., Esnouf R.M., Manso-Sancho R., Gilbert R.J., James J.R., Yu C., Fennelly J.A., Vowles C., Hanke T., Walse B., Hunig T., Sorensen P., Stuart D.I., Davis S.J.
Nat. Immunol. 6:271-279(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 17-152 IN COMPLEX WITH THE FAB FRAGMENT OF A MITOGENIC ANTIBODY, DISULFIDE BONDS, GLYCOSYLATION AT ASN-37 AND ASN-105.
[16]"High resolution crystal structure of the Grb2 SH2 domain with a phosphopeptide derived from CD28."
Higo K., Ikura T., Oda M., Morii H., Takahashi J., Abe R., Ito N.
PLoS ONE 8:E74482-E74482(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.35 ANGSTROMS) OF 189-196 IN COMPLEX WITH GRB2, INTERACTION WITH GRB2.
+Additional computationally mapped references.

Web resources

Wikipedia

CD28 entry

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
J02988 mRNA. Translation: AAA60581.1.
M37815 expand/collapse EMBL AC list , M37812, M37813, M37814 Genomic DNA. Translation: AAA51944.1.
M37815 expand/collapse EMBL AC list , M37812, M37813, M37814 Genomic DNA. Translation: AAA51945.1.
AJ295273 mRNA. Translation: CAC29237.1.
AF222341 mRNA. Translation: AAF33792.1.
AF222342 mRNA. Translation: AAF33793.1.
AF222343 mRNA. Translation: AAF33794.1.
AJ517504 mRNA. Translation: CAD57003.1.
EF064755 Genomic DNA. Translation: ABK41938.1.
AK292986 mRNA. Translation: BAF85675.1.
AK313313 mRNA. Translation: BAG36118.1.
AC125238 Genomic DNA. Translation: AAY24123.1.
CH471063 Genomic DNA. Translation: EAW70348.1.
BC093698 mRNA. Translation: AAH93698.1.
BC112085 mRNA. Translation: AAI12086.1.
AF411057 Genomic DNA. Translation: AAL40931.1.
CCDSCCDS2361.1. [P10747-1]
CCDS58749.1. [P10747-2]
PIRRWHU28. A39983.
RefSeqNP_001230006.1. NM_001243077.1. [P10747-4]
NP_001230007.1. NM_001243078.1. [P10747-2]
NP_006130.1. NM_006139.3. [P10747-1]
UniGeneHs.443123.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1YJDX-ray2.70C17-152[»]
3WA4X-ray1.35B189-196[»]
ProteinModelPortalP10747.
SMRP10747. Positions 19-136.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107378. 12 interactions.
DIPDIP-6043N.
IntActP10747. 7 interactions.
MINTMINT-4656075.

Chemistry

ChEMBLCHEMBL5191.

PTM databases

PhosphoSiteP10747.

Polymorphism databases

DMDM115973.

Proteomic databases

MaxQBP10747.
PaxDbP10747.
PRIDEP10747.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000324106; ENSP00000324890; ENSG00000178562. [P10747-1]
ENST00000374478; ENSP00000363602; ENSG00000178562. [P10747-2]
ENST00000374481; ENSP00000363605; ENSG00000178562. [P10747-3]
ENST00000458610; ENSP00000393648; ENSG00000178562. [P10747-7]
GeneID940.
KEGGhsa:940.
UCSCuc002vah.4. human. [P10747-1]
uc010ftx.3. human. [P10747-2]
uc010zio.2. human. [P10747-4]

Organism-specific databases

CTD940.
GeneCardsGC02P204535.
HGNCHGNC:1653. CD28.
MIM186760. gene.
neXtProtNX_P10747.
PharmGKBPA26207.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG48152.
HOVERGENHBG004094.
InParanoidP10747.
KOK06470.
OMAAPTYANS.
OrthoDBEOG7W6WMJ.
PhylomeDBP10747.
TreeFamTF335679.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.
REACT_116125. Disease.
REACT_6900. Immune System.
SignaLinkP10747.

Gene expression databases

ArrayExpressP10747.
BgeeP10747.
CleanExHS_CD28.
GenevestigatorP10747.

Family and domain databases

Gene3D2.60.40.10. 1 hit.
InterProIPR008093. CD28.
IPR013783. Ig-like_fold.
IPR013106. Ig_V-set.
[Graphical view]
PfamPF07686. V-set. 1 hit.
[Graphical view]
PRINTSPR01717. CD28ANTIGEN.
ProtoNetSearch...

Other

ChiTaRSCD28. human.
EvolutionaryTraceP10747.
GeneWikiCD28.
GenomeRNAi940.
NextBio3894.
PROP10747.
SOURCESearch...

Entry information

Entry nameCD28_HUMAN
AccessionPrimary (citable) accession number: P10747
Secondary accession number(s): A8KAC1 expand/collapse secondary AC list , Q13964, Q52M23, Q70WG0, Q8NI54, Q8NI55, Q8NI56, Q8WXJ2, Q9BYV0
Entry history
Integrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: July 1, 1989
Last modified: July 9, 2014
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries