Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P10417 (BCL2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 152. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Apoptosis regulator Bcl-2
Gene names
Name:Bcl2
Synonyms:Bcl-2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length236 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).

Subunit structure

Forms homodimers, and heterodimers with BAX, BAD, BAK and Bcl-X(L). Heterodimerization with BAX requires intact BH1 and BH2 motifs, and is necessary for anti-apoptotic activity By similarity. Also interacts with APAF1, BBC3, BCL2L1, BNIPL, MRPL41 and TP53BP2. Binding to FKBP8 seems to target BCL2 to the mitochondria and probably interferes with the binding of BCL2 to its targets. Interacts with BAG1 in an ATP-dependent manner. Interacts with RAF1 (the 'Ser-338' and 'Ser-339' phosphorylated form). Interacts (via the BH4 domain) with EGLN3; the interaction prevents the formation of the BAX-BCL2 complex and inhibits the anti-apoptotic activity of BCL2 By similarity. Interacts with EI24. Interacts with G0S2; this interaction also prevents the formation of the anti-apoptotic BAX-BCL2 complex. Interacts with PPIF; the interaction is impaired by CsA By similarity. Interacts with BOP By similarity. Interacts with the SCF(FBXO10) complex By similarity. Ref.8

Subcellular location

Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.

Tissue specificity

Expressed in a variety of tissues.

Domain

The BH4 motif is required for anti-apoptotic activity and for interaction with RAF1 and EGLN3.

Post-translational modification

Phosphorylation/dephosphorylation on Ser-70 regulates anti-apoptotic activity. Growth factor-stimulated phosphorylation on Ser-70 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle. In the absence of growth factors, BCL2 appears to be phosphorylated by other protein kinases such as ERKs and stress-activated kinases. Phosphorylated by MAPK8/JNK1 at Thr-69, Ser-70 and Ser-84, wich stimulates starvation-induced autophagy By similarity. Dephosphorylated by protein phosphatase 2A (PP2A). Ref.6 Ref.7

Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity, causes the release of cytochrome c into the cytosol promoting further caspase activity.

Monoubiquitinated by PARK2, leading to increase its stability By similarity. Ubiquitinated by SCF(FBXO10), leading to its degradation by the proteasome By similarity.

Sequence similarities

Belongs to the Bcl-2 family.

Ontologies

Keywords
   Biological processApoptosis
   Cellular componentEndoplasmic reticulum
Membrane
Mitochondrion
Mitochondrion outer membrane
Nucleus
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   PTMPhosphoprotein
Ubl conjugation
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processB cell differentiation

Inferred from mutant phenotype PubMed 8170972PubMed 9028316. Source: MGI

B cell homeostasis

Inferred from mutant phenotype PubMed 7650488PubMed 8170972. Source: MGI

B cell lineage commitment

Inferred from mutant phenotype PubMed 8788039. Source: MGI

B cell proliferation

Inferred from sequence orthology PubMed 1373874. Source: MGI

B cell receptor signaling pathway

Inferred from electronic annotation. Source: Ensembl

CD8-positive, alpha-beta T cell lineage commitment

Inferred from mutant phenotype PubMed 8170972. Source: MGI

T cell differentiation

Inferred from mutant phenotype PubMed 8170972. Source: MGI

T cell differentiation in thymus

Inferred from mutant phenotype PubMed 8170972PubMed 9028316. Source: MGI

T cell homeostasis

Inferred from mutant phenotype PubMed 7650488PubMed 8170972. Source: MGI

T cell lineage commitment

Inferred from mutant phenotype PubMed 8788039. Source: MGI

actin filament organization

Inferred from mutant phenotype PubMed 9950951. Source: MGI

apoptotic mitochondrial changes

Inferred from direct assay PubMed 14707049. Source: MGI

axon regeneration

Inferred from direct assay PubMed 9009190. Source: MGI

axonogenesis

Inferred from mutant phenotype PubMed 9009190. Source: MGI

behavioral fear response

Inferred from mutant phenotype PubMed 16095731. Source: MGI

branching involved in ureteric bud morphogenesis

Inferred from direct assay PubMed 14699151. Source: MGI

cell aging

Inferred from mutant phenotype PubMed 8372353. Source: MGI

cell death

Inferred from mutant phenotype. Source: MGI

cell growth

Inferred from mutant phenotype PubMed 8084613. Source: MGI

cell morphogenesis

Inferred from mutant phenotype PubMed 10193316. Source: MGI

cell proliferation

Inferred from genetic interaction PubMed 10762311. Source: MGI

cellular calcium ion homeostasis

Inferred from direct assay PubMed 7945396. Source: MGI

cellular response to glucose starvation

Inferred from direct assay PubMed 7595537. Source: MGI

cellular response to hypoxia

Inferred from direct assay PubMed 7595537. Source: MGI

cellular response to organic substance

Inferred from direct assay PubMed 12606450. Source: MGI

cochlear nucleus development

Inferred from mutant phenotype PubMed 11027399. Source: MGI

defense response to virus

Inferred from electronic annotation. Source: Ensembl

developmental growth

Inferred from mutant phenotype PubMed 15818405. Source: MGI

developmental pigmentation

Inferred from mutant phenotype PubMed 11709185PubMed 8170972. Source: MGI

digestive tract morphogenesis

Inferred from mutant phenotype PubMed 7812968. Source: MGI

ear development

Inferred from mutant phenotype PubMed 11709185PubMed 8170972. Source: MGI

endoplasmic reticulum calcium ion homeostasis

Inferred from genetic interaction PubMed 15613488. Source: MGI

extrinsic apoptotic signaling pathway in absence of ligand

Inferred from genetic interaction PubMed 12082633. Source: MGI

extrinsic apoptotic signaling pathway via death domain receptors

Inferred from sequence orthology PubMed 10597216. Source: MGI

focal adhesion assembly

Inferred from mutant phenotype PubMed 15292044. Source: MGI

gland morphogenesis

Inferred from mutant phenotype PubMed 7812968. Source: MGI

glomerulus development

Inferred from mutant phenotype PubMed 8623928. Source: MGI

growth

Inferred from mutant phenotype PubMed 7812968PubMed 8170972. Source: MGI

hair follicle morphogenesis

Inferred from mutant phenotype PubMed 8402909. Source: UniProtKB

hemopoiesis

Inferred from mutant phenotype PubMed 7812968. Source: MGI

homeostasis of number of cells within a tissue

Inferred from mutant phenotype PubMed 16427619PubMed 9241272. Source: MGI

immune system development

Inferred from mutant phenotype PubMed 7812968PubMed 8372353. Source: MGI

intrinsic apoptotic signaling pathway in response to DNA damage

Inferred from Biological aspect of Ancestor. Source: RefGenome

intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress

Inferred from sequence or structural similarity PubMed 15776018. Source: MGI

intrinsic apoptotic signaling pathway in response to oxidative stress

Inferred from mutant phenotype PubMed 12855558. Source: MGI

kidney development

Inferred from mutant phenotype PubMed 11709185PubMed 15818405PubMed 16282979PubMed 7812968PubMed 7840250PubMed 8760259PubMed 9950951. Source: MGI

leukocyte homeostasis

Inferred from mutant phenotype PubMed 9028316. Source: MGI

lymphocyte homeostasis

Inferred from mutant phenotype PubMed 11709185PubMed 8170972. Source: MGI

lymphoid progenitor cell differentiation

Inferred from mutant phenotype PubMed 9028316. Source: MGI

male gonad development

Inferred from genetic interaction PubMed 9241272. Source: MGI

melanin metabolic process

Inferred from mutant phenotype PubMed 11709185. Source: MGI

melanocyte differentiation

Inferred from mutant phenotype PubMed 11709185PubMed 12086670PubMed 8758925. Source: MGI

mesenchymal cell development

Inferred from mutant phenotype PubMed 8623928. Source: MGI

metanephros development

Inferred from mutant phenotype PubMed 7840250PubMed 8623928. Source: MGI

negative regulation of G1/S transition of mitotic cell cycle

Inferred from direct assay PubMed 14660795. Source: MGI

negative regulation of anoikis

Inferred from electronic annotation. Source: Ensembl

negative regulation of apoptotic process

Inferred from direct assay PubMed 14551195PubMed 14660795PubMed 17267035PubMed 7751019PubMed 7834747PubMed 8313913PubMed 9560217. Source: MGI

negative regulation of apoptotic signaling pathway

Inferred from direct assay PubMed 11546872. Source: MGI

negative regulation of calcium ion transport into cytosol

Inferred from genetic interaction PubMed 15613488. Source: MGI

negative regulation of cell growth

Inferred from mutant phenotype PubMed 12855558. Source: MGI

negative regulation of cell migration

Inferred from mutant phenotype PubMed 15292044. Source: MGI

negative regulation of cell proliferation

Inferred from mutant phenotype PubMed 8663032. Source: MGI

negative regulation of cellular pH reduction

Inferred from electronic annotation. Source: Ensembl

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

Inferred from electronic annotation. Source: Ensembl

negative regulation of intrinsic apoptotic signaling pathway

Inferred from Biological aspect of Ancestor. Source: RefGenome

negative regulation of mitotic cell cycle

Inferred from direct assay PubMed 9241272. Source: MGI

negative regulation of myeloid cell apoptotic process

Inferred from direct assay PubMed 9202146. Source: MGI

negative regulation of neuron apoptotic process

Inferred from direct assay PubMed 7472523PubMed 8625820. Source: MGI

negative regulation of ossification

Inferred from mutant phenotype PubMed 9008714. Source: MGI

negative regulation of osteoblast proliferation

Inferred from mutant phenotype PubMed 10193316. Source: MGI

negative regulation of retinal cell programmed cell death

Inferred from mutant phenotype PubMed 10321489. Source: MGI

neuron apoptotic process

Inferred from mutant phenotype PubMed 7546744. Source: MGI

oocyte development

Inferred from mutant phenotype PubMed 7628407. Source: MGI

organ growth

Inferred from mutant phenotype PubMed 7812968PubMed 8623928. Source: MGI

organ morphogenesis

Inferred from mutant phenotype PubMed 8170972. Source: MGI

ossification

Inferred from mutant phenotype PubMed 10193316. Source: MGI

ovarian follicle development

Inferred from mutant phenotype PubMed 7628407. Source: MGI

peptidyl-serine phosphorylation

Inferred from direct assay PubMed 14660795. Source: MGI

peptidyl-threonine phosphorylation

Inferred from direct assay PubMed 14660795. Source: MGI

pigment granule organization

Inferred from mutant phenotype PubMed 8758925. Source: MGI

pigmentation

Inferred from mutant phenotype PubMed 8402909. Source: UniProtKB

positive regulation of B cell proliferation

Inferred from electronic annotation. Source: Ensembl

positive regulation of catalytic activity

Inferred from mutant phenotype PubMed 17382917. Source: MGI

positive regulation of cell growth

Inferred from sequence orthology PubMed 8022822. Source: MGI

positive regulation of cell proliferation

Inferred from direct assay PubMed 11983915. Source: UniProtKB

positive regulation of developmental pigmentation

Inferred from mutant phenotype PubMed 10674380. Source: MGI

positive regulation of melanocyte differentiation

Inferred from mutant phenotype PubMed 16427619. Source: MGI

positive regulation of multicellular organism growth

Inferred from mutant phenotype PubMed 11709185. Source: MGI

positive regulation of neuron maturation

Inferred from mutant phenotype PubMed 9547242. Source: MGI

positive regulation of peptidyl-serine phosphorylation

Inferred from genetic interaction PubMed 15613488. Source: MGI

positive regulation of skeletal muscle fiber development

Inferred from mutant phenotype PubMed 11146504. Source: MGI

positive regulation of smooth muscle cell migration

Inferred from mutant phenotype PubMed 17382917. Source: MGI

post-embryonic development

Inferred from mutant phenotype PubMed 10674380PubMed 11709185PubMed 7812968PubMed 8170972PubMed 8755480. Source: MGI

protein dephosphorylation

Inferred from direct assay PubMed 16717086. Source: MGI

protein polyubiquitination

Inferred from sequence orthology PubMed 16717086. Source: MGI

reactive oxygen species metabolic process

Inferred from mutant phenotype PubMed 10726970PubMed 12855558PubMed 9681465. Source: MGI

regulation of apoptotic process

Inferred from genetic interaction PubMed 15818405. Source: MGI

regulation of calcium ion transport

Inferred from sequence orthology PubMed 8022822. Source: MGI

regulation of catalytic activity

Inferred from mutant phenotype PubMed 9681465. Source: MGI

regulation of cell cycle

Inferred from mutant phenotype PubMed 10200548. Source: MGI

regulation of cell-matrix adhesion

Inferred from mutant phenotype PubMed 15292044. Source: MGI

regulation of developmental pigmentation

Inferred from genetic interaction PubMed 15818405. Source: MGI

regulation of gene expression

Inferred from mutant phenotype PubMed 12855558PubMed 15292044. Source: MGI

regulation of glycoprotein biosynthetic process

Inferred from mutant phenotype PubMed 15292044. Source: MGI

regulation of mitochondrial membrane permeability

Inferred from direct assay PubMed 9843949. Source: HGNC

regulation of mitochondrial membrane potential

Inferred from direct assay PubMed 9843949. Source: HGNC

regulation of nitrogen utilization

Inferred from genetic interaction PubMed 9241272. Source: MGI

regulation of programmed cell death

Inferred from genetic interaction PubMed 16672320. Source: MGI

regulation of protein heterodimerization activity

Inferred from electronic annotation. Source: Ensembl

regulation of protein homodimerization activity

Inferred from electronic annotation. Source: Ensembl

regulation of protein localization

Inferred from mutant phenotype PubMed 9950951. Source: MGI

regulation of protein stability

Inferred from mutant phenotype PubMed 14660795. Source: MGI

regulation of transmembrane transporter activity

Inferred from electronic annotation. Source: Ensembl

regulation of viral genome replication

Inferred from direct assay PubMed 16950491. Source: UniProtKB

release of cytochrome c from mitochondria

Inferred from direct assay PubMed 9843949. Source: HGNC

renal system process

Inferred from mutant phenotype PubMed 8760259. Source: MGI

response to UV-B

Inferred from mutant phenotype PubMed 10200548. Source: MGI

response to acid

Inferred from direct assay PubMed 7675327. Source: MGI

response to cytokine

Inferred from mutant phenotype PubMed 12855558. Source: MGI

response to drug

Inferred from direct assay PubMed 9098922. Source: MGI

response to gamma radiation

Inferred from mutant phenotype PubMed 10815637PubMed 17068116PubMed 8170972PubMed 8372353. Source: MGI

response to glucocorticoid

Inferred from direct assay PubMed 8313913. Source: MGI

response to hydrogen peroxide

Inferred from mutant phenotype PubMed 12855558. Source: MGI

response to iron ion

Inferred from electronic annotation. Source: Ensembl

response to ischemia

Inferred from mutant phenotype PubMed 10488913. Source: MGI

response to nicotine

Inferred from electronic annotation. Source: Ensembl

response to oxidative stress

Inferred from mutant phenotype PubMed 12855558. Source: MGI

response to steroid hormone

Inferred from mutant phenotype PubMed 8170972. Source: MGI

response to toxic substance

Inferred from mutant phenotype PubMed 10602483. Source: MGI

single organismal cell-cell adhesion

Inferred from mutant phenotype PubMed 15292044. Source: MGI

spleen development

Inferred from mutant phenotype PubMed 15818405. Source: MGI

thymus development

Inferred from mutant phenotype PubMed 15818405PubMed 9241272. Source: MGI

ureteric bud development

Inferred from mutant phenotype PubMed 8623928. Source: MGI

   Cellular_componentcytoplasm

Inferred from direct assay PubMed 7563251PubMed 7675327PubMed 8030757. Source: MGI

cytosol

Inferred from direct assay PubMed 12050152PubMed 14551195PubMed 8030757. Source: MGI

endoplasmic reticulum

Inferred from direct assay PubMed 8030757. Source: MGI

endoplasmic reticulum membrane

Inferred from direct assay PubMed 15613488. Source: MGI

intracellular

Inferred from direct assay PubMed 11146504PubMed 9008714PubMed 9252127. Source: MGI

membrane

Inferred from direct assay PubMed 8030757. Source: MGI

mitochondrial membrane

Inferred from direct assay PubMed 11980919. Source: MGI

mitochondrial outer membrane

Inferred from Biological aspect of Ancestor. Source: RefGenome

mitochondrion

Inferred from direct assay PubMed 12420306PubMed 14651853PubMed 18614015PubMed 7945396PubMed 7953633. Source: MGI

myelin sheath

Inferred from direct assay PubMed 7953633. Source: MGI

nuclear membrane

Inferred from direct assay PubMed 8030757. Source: MGI

nucleus

Inferred from direct assay PubMed 7945396PubMed 7953633PubMed 8030757. Source: MGI

pore complex

Inferred from electronic annotation. Source: Ensembl

   Molecular_functionchannel activity

Inferred from electronic annotation. Source: Ensembl

channel inhibitor activity

Inferred from electronic annotation. Source: Ensembl

protein binding

Inferred from physical interaction PubMed 18223655. Source: UniProtKB

protein heterodimerization activity

Inferred from physical interaction PubMed 10582606PubMed 11226327PubMed 7834748. Source: MGI

protein homodimerization activity

Inferred from Biological aspect of Ancestor. Source: RefGenome

protein phosphatase 2A binding

Inferred from direct assay PubMed 16717086. Source: MGI

protein phosphatase binding

Inferred from direct assay PubMed 12617961. Source: MGI

sequence-specific DNA binding

Inferred from electronic annotation. Source: Ensembl

transcription factor binding

Inferred from physical interaction PubMed 17382917. Source: MGI

Complete GO annotation...

Binary interactions

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform Alpha (identifier: P10417-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Beta (identifier: P10417-2)

The sequence of this isoform differs from the canonical sequence as follows:
     193-236: DAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK → VGACLVE

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 236236Apoptosis regulator Bcl-2
PRO_0000143049

Regions

Transmembrane209 – 23022Helical; Potential
Motif10 – 3021BH4
Motif90 – 10415BH3
Motif133 – 15220BH1
Motif184 – 19916BH2

Sites

Site34 – 352Cleavage; by caspases By similarity

Amino acid modifications

Modified residue691Phosphothreonine; by MAPK8 By similarity
Modified residue701Phosphoserine; by MAPK8 and PKC Ref.6
Modified residue841Phosphoserine; by MAPK8 By similarity

Natural variations

Alternative sequence193 – 23644DAFVE…YLGHK → VGACLVE in isoform Beta.
VSP_000513

Experimental info

Mutagenesis701S → A: Loss of phosphorylation. Unable to suppress apoptosis. Ref.6
Sequence conflict641D → E in AAA37281. Ref.1
Sequence conflict641D → E in AAA37282. Ref.1
Sequence conflict891V → C in AAA37281. Ref.1
Sequence conflict891V → C in AAA37282. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform Alpha [UniParc].

Last modified October 3, 2012. Version 3.
Checksum: 80FDCFE78C735092

FASTA23626,407
        10         20         30         40         50         60 
MAQAGRTGYD NREIVMKYIH YKLSQRGYEW DAGDADAAPL GAAPTPGIFS FQPESNPMPA 

        70         80         90        100        110        120 
VHRDMAARTS PLRPLVATAG PALSPVPPVV HLTLRRAGDD FSRRYRRDFA EMSSQLHLTP 

       130        140        150        160        170        180 
FTARGRFATV VEELFRDGVN WGRIVAFFEF GGVMCVESVN REMSPLVDNI ALWMTEYLNR 

       190        200        210        220        230 
HLHTWIQDNG GWDAFVELYG PSMRPLFDFS WLSLKTLLSL ALVGACITLG AYLGHK 

« Hide

Isoform Beta [UniParc].

Checksum: F13C8037262BA955
Show »

FASTA19922,281

References

« Hide 'large scale' references
[1]"Molecular analysis of mbcl-2: structure and expression of the murine gene homologous to the human gene involved in follicular lymphoma."
Negrini M., Silini E., Kozak C., Tsujimoto Y., Croce C.M.
Cell 49:455-463(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS ALPHA AND BETA).
Strain: BALB/c.
Tissue: Liver.
[2]"Isolation and characterization of the chicken bcl-2 gene: expression in a variety of tissues including lymphoid and neuronal organs in adult and embryo."
Eguchi Y., Ewert D.L., Tsujimoto Y.
Nucleic Acids Res. 20:4187-4192(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION TO 221-222.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Tissue: Olfactory epithelium.
[6]"Bcl-2 phosphorylation required for anti-apoptosis function."
Ito T., Deng X., Carr B., May W.S. Jr.
J. Biol. Chem. 272:11671-11673(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION AT SER-70 BY PKC, MUTAGENESIS OF SER-70.
[7]"Reversible phosphorylation of Bcl2 following interleukin 3 or bryostatin 1 is mediated by direct interaction with protein phosphatase 2A."
Deng X., Ito T., Carr B., Mumby M., May W.S. Jr.
J. Biol. Chem. 273:34157-34163(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: DEPHOSPHORYLATION BY PP2A.
[8]"Apoptosis factor EI24/PIG8 is a novel endoplasmic reticulum-localized Bcl-2-binding protein which is associated with suppression of breast cancer invasiveness."
Zhao X., Ayer R.E., Davis S.L., Ames S.J., Florence B., Torchinsky C., Liou J.S., Shen L., Spanjaard R.A.
Cancer Res. 65:2125-2129(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH EI24.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L31532, M16506 Genomic DNA. Translation: AAA37282.1.
M16506 Genomic DNA. Translation: AAA37281.1.
AC122842 Genomic DNA. No translation available.
AC162916 Genomic DNA. No translation available.
CH466520 Genomic DNA. Translation: EDL39862.1.
BC095964 mRNA. Translation: AAH95964.1.
CCDSCCDS15209.1. [P10417-1]
PIRTVMSA1. A25960.
TVMSB1. B25960.
RefSeqNP_033871.2. NM_009741.4. [P10417-1]
UniGeneMm.257460.

3D structure databases

ProteinModelPortalP10417.
SMRP10417. Positions 3-204.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

DIPDIP-1065N.
IntActP10417. 6 interactions.
MINTMINT-209615.

PTM databases

PhosphoSiteP10417.

Proteomic databases

PaxDbP10417.
PRIDEP10417.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000112751; ENSMUSP00000108371; ENSMUSG00000057329. [P10417-1]
GeneID12043.
KEGGmmu:12043.
UCSCuc007cgw.1. mouse.

Organism-specific databases

CTD596.
MGIMGI:88138. Bcl2.

Phylogenomic databases

eggNOGNOG275924.
GeneTreeENSGT00530000062935.
HOGENOMHOG000056452.
HOVERGENHBG004472.
InParanoidP10417.
KOK02161.
OMAIVLKYIH.
OrthoDBEOG70GMGD.
TreeFamTF315834.

Gene expression databases

CleanExMM_BCL2.
GenevestigatorP10417.

Family and domain databases

InterProIPR013278. Apop_reg_Bcl2.
IPR002475. Bcl2-like.
IPR004725. Bcl2/BclX.
IPR020717. Bcl2_BH1_motif_CS.
IPR020726. Bcl2_BH2_motif_CS.
IPR020728. Bcl2_BH3_motif_CS.
IPR003093. Bcl2_BH4.
IPR020731. Bcl2_BH4_motif_CS.
IPR026298. Blc2_fam.
[Graphical view]
PANTHERPTHR11256. PTHR11256. 1 hit.
PTHR11256:SF11. PTHR11256:SF11. 1 hit.
PfamPF00452. Bcl-2. 1 hit.
PF02180. BH4. 1 hit.
[Graphical view]
PRINTSPR01863. APOPREGBCL2.
PR01862. BCL2FAMILY.
SMARTSM00265. BH4. 1 hit.
[Graphical view]
TIGRFAMsTIGR00865. bcl-2. 1 hit.
PROSITEPS50062. BCL2_FAMILY. 1 hit.
PS01080. BH1. 1 hit.
PS01258. BH2. 1 hit.
PS01259. BH3. 1 hit.
PS01260. BH4_1. 1 hit.
PS50063. BH4_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSBCL2. mouse.
NextBio280313.
PROP10417.
SOURCESearch...

Entry information

Entry nameBCL2_MOUSE
AccessionPrimary (citable) accession number: P10417
Secondary accession number(s): P10418, Q4VBF6
Entry history
Integrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: October 3, 2012
Last modified: July 9, 2014
This is version 152 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot