Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P10417

- BCL2_MOUSE

UniProt

P10417 - BCL2_MOUSE

Protein

Apoptosis regulator Bcl-2

Gene

Bcl2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 154 (01 Oct 2014)
      Sequence version 3 (03 Oct 2012)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei34 – 352Cleavage; by caspasesBy similarity

    GO - Molecular functioni

    1. channel activity Source: Ensembl
    2. channel inhibitor activity Source: Ensembl
    3. protein binding Source: UniProtKB
    4. protein heterodimerization activity Source: MGI
    5. protein homodimerization activity Source: RefGenome
    6. protein phosphatase 2A binding Source: MGI
    7. protein phosphatase binding Source: MGI
    8. sequence-specific DNA binding Source: Ensembl
    9. transcription factor binding Source: MGI

    GO - Biological processi

    1. actin filament organization Source: MGI
    2. apoptotic mitochondrial changes Source: MGI
    3. apoptotic process Source: MGI
    4. axonogenesis Source: MGI
    5. axon regeneration Source: MGI
    6. B cell differentiation Source: MGI
    7. B cell homeostasis Source: MGI
    8. B cell lineage commitment Source: MGI
    9. B cell proliferation Source: MGI
    10. B cell receptor signaling pathway Source: Ensembl
    11. behavioral fear response Source: MGI
    12. branching involved in ureteric bud morphogenesis Source: MGI
    13. CD8-positive, alpha-beta T cell lineage commitment Source: MGI
    14. cell aging Source: MGI
    15. cell growth Source: MGI
    16. cell morphogenesis Source: MGI
    17. cell proliferation Source: MGI
    18. cellular calcium ion homeostasis Source: MGI
    19. cellular response to glucose starvation Source: MGI
    20. cellular response to hypoxia Source: MGI
    21. cellular response to organic substance Source: MGI
    22. cochlear nucleus development Source: MGI
    23. defense response to virus Source: Ensembl
    24. developmental growth Source: MGI
    25. developmental pigmentation Source: MGI
    26. digestive tract morphogenesis Source: MGI
    27. ear development Source: MGI
    28. endoplasmic reticulum calcium ion homeostasis Source: MGI
    29. extrinsic apoptotic signaling pathway in absence of ligand Source: MGI
    30. extrinsic apoptotic signaling pathway via death domain receptors Source: MGI
    31. focal adhesion assembly Source: MGI
    32. gland morphogenesis Source: MGI
    33. glomerulus development Source: MGI
    34. growth Source: MGI
    35. hair follicle morphogenesis Source: UniProtKB
    36. hemopoiesis Source: MGI
    37. homeostasis of number of cells within a tissue Source: MGI
    38. immune system development Source: MGI
    39. intrinsic apoptotic signaling pathway in response to DNA damage Source: RefGenome
    40. intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress Source: MGI
    41. intrinsic apoptotic signaling pathway in response to oxidative stress Source: MGI
    42. kidney development Source: MGI
    43. leukocyte homeostasis Source: MGI
    44. lymphocyte homeostasis Source: MGI
    45. lymphoid progenitor cell differentiation Source: MGI
    46. male gonad development Source: MGI
    47. melanin metabolic process Source: MGI
    48. melanocyte differentiation Source: MGI
    49. mesenchymal cell development Source: MGI
    50. metanephros development Source: MGI
    51. negative regulation of anoikis Source: Ensembl
    52. negative regulation of apoptotic process Source: MGI
    53. negative regulation of apoptotic signaling pathway Source: MGI
    54. negative regulation of calcium ion transport into cytosol Source: MGI
    55. negative regulation of cell growth Source: MGI
    56. negative regulation of cell migration Source: MGI
    57. negative regulation of cell proliferation Source: MGI
    58. negative regulation of cellular pH reduction Source: Ensembl
    59. negative regulation of extrinsic apoptotic signaling pathway in absence of ligand Source: Ensembl
    60. negative regulation of G1/S transition of mitotic cell cycle Source: MGI
    61. negative regulation of intrinsic apoptotic signaling pathway Source: RefGenome
    62. negative regulation of mitotic cell cycle Source: MGI
    63. negative regulation of myeloid cell apoptotic process Source: MGI
    64. negative regulation of neuron apoptotic process Source: MGI
    65. negative regulation of ossification Source: MGI
    66. negative regulation of osteoblast proliferation Source: MGI
    67. negative regulation of retinal cell programmed cell death Source: MGI
    68. neuron apoptotic process Source: MGI
    69. oocyte development Source: MGI
    70. organ growth Source: MGI
    71. organ morphogenesis Source: MGI
    72. ossification Source: MGI
    73. ovarian follicle development Source: MGI
    74. peptidyl-serine phosphorylation Source: MGI
    75. peptidyl-threonine phosphorylation Source: MGI
    76. pigmentation Source: UniProtKB
    77. pigment granule organization Source: MGI
    78. positive regulation of B cell proliferation Source: Ensembl
    79. positive regulation of catalytic activity Source: MGI
    80. positive regulation of cell growth Source: MGI
    81. positive regulation of cell proliferation Source: UniProtKB
    82. positive regulation of developmental pigmentation Source: MGI
    83. positive regulation of melanocyte differentiation Source: MGI
    84. positive regulation of multicellular organism growth Source: MGI
    85. positive regulation of neuron maturation Source: MGI
    86. positive regulation of peptidyl-serine phosphorylation Source: MGI
    87. positive regulation of skeletal muscle fiber development Source: MGI
    88. positive regulation of smooth muscle cell migration Source: MGI
    89. post-embryonic development Source: MGI
    90. protein dephosphorylation Source: MGI
    91. protein polyubiquitination Source: MGI
    92. reactive oxygen species metabolic process Source: MGI
    93. regulation of apoptotic process Source: MGI
    94. regulation of calcium ion transport Source: MGI
    95. regulation of catalytic activity Source: MGI
    96. regulation of cell cycle Source: MGI
    97. regulation of cell-matrix adhesion Source: MGI
    98. regulation of developmental pigmentation Source: MGI
    99. regulation of gene expression Source: MGI
    100. regulation of glycoprotein biosynthetic process Source: MGI
    101. regulation of mitochondrial membrane permeability Source: HGNC
    102. regulation of mitochondrial membrane potential Source: HGNC
    103. regulation of nitrogen utilization Source: MGI
    104. regulation of programmed cell death Source: MGI
    105. regulation of protein heterodimerization activity Source: Ensembl
    106. regulation of protein homodimerization activity Source: Ensembl
    107. regulation of protein localization Source: MGI
    108. regulation of protein stability Source: MGI
    109. regulation of transmembrane transporter activity Source: Ensembl
    110. regulation of viral genome replication Source: UniProtKB
    111. release of cytochrome c from mitochondria Source: HGNC
    112. renal system process Source: MGI
    113. response to acid chemical Source: MGI
    114. response to cytokine Source: MGI
    115. response to drug Source: MGI
    116. response to gamma radiation Source: MGI
    117. response to glucocorticoid Source: MGI
    118. response to hydrogen peroxide Source: MGI
    119. response to iron ion Source: Ensembl
    120. response to ischemia Source: MGI
    121. response to nicotine Source: Ensembl
    122. response to oxidative stress Source: MGI
    123. response to steroid hormone Source: MGI
    124. response to toxic substance Source: MGI
    125. response to UV-B Source: MGI
    126. single organismal cell-cell adhesion Source: MGI
    127. spleen development Source: MGI
    128. T cell differentiation Source: MGI
    129. T cell differentiation in thymus Source: MGI
    130. T cell homeostasis Source: MGI
    131. T cell lineage commitment Source: MGI
    132. thymus development Source: MGI
    133. ureteric bud development Source: MGI

    Keywords - Biological processi

    Apoptosis

    Enzyme and pathway databases

    ReactomeiREACT_198658. The NLRP1 inflammasome.
    REACT_223399. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Apoptosis regulator Bcl-2
    Gene namesi
    Name:Bcl2
    Synonyms:Bcl-2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 1

    Organism-specific databases

    MGIiMGI:88138. Bcl2.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: MGI
    2. cytosol Source: MGI
    3. endoplasmic reticulum Source: MGI
    4. endoplasmic reticulum membrane Source: MGI
    5. intracellular Source: MGI
    6. membrane Source: MGI
    7. mitochondrial membrane Source: MGI
    8. mitochondrial outer membrane Source: RefGenome
    9. mitochondrion Source: MGI
    10. myelin sheath Source: MGI
    11. nuclear membrane Source: MGI
    12. nucleus Source: MGI
    13. pore complex Source: Ensembl

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Mitochondrion, Mitochondrion outer membrane, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi70 – 701S → A: Loss of phosphorylation. Unable to suppress apoptosis. 1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 236236Apoptosis regulator Bcl-2PRO_0000143049Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei69 – 691Phosphothreonine; by MAPK8By similarity
    Modified residuei70 – 701Phosphoserine; by MAPK8 and PKC1 Publication
    Modified residuei84 – 841Phosphoserine; by MAPK8By similarity

    Post-translational modificationi

    Phosphorylation/dephosphorylation on Ser-70 regulates anti-apoptotic activity. Growth factor-stimulated phosphorylation on Ser-70 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle. In the absence of growth factors, BCL2 appears to be phosphorylated by other protein kinases such as ERKs and stress-activated kinases. Phosphorylated by MAPK8/JNK1 at Thr-69, Ser-70 and Ser-84, wich stimulates starvation-induced autophagy By similarity. Dephosphorylated by protein phosphatase 2A (PP2A).By similarity1 Publication
    Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity, causes the release of cytochrome c into the cytosol promoting further caspase activity.
    Monoubiquitinated by PARK2, leading to increase its stability. Ubiquitinated by SCF(FBXO10), leading to its degradation by the proteasome.By similarity

    Keywords - PTMi

    Phosphoprotein, Ubl conjugation

    Proteomic databases

    PaxDbiP10417.
    PRIDEiP10417.

    PTM databases

    PhosphoSiteiP10417.

    Expressioni

    Tissue specificityi

    Expressed in a variety of tissues.

    Gene expression databases

    CleanExiMM_BCL2.
    GenevestigatoriP10417.

    Interactioni

    Subunit structurei

    Forms homodimers, and heterodimers with BAX, BAD, BAK and Bcl-X(L). Heterodimerization with BAX requires intact BH1 and BH2 motifs, and is necessary for anti-apoptotic activity By similarity. Also interacts with APAF1, BBC3, BCL2L1, BNIPL, MRPL41 and TP53BP2. Binding to FKBP8 seems to target BCL2 to the mitochondria and probably interferes with the binding of BCL2 to its targets. Interacts with BAG1 in an ATP-dependent manner. Interacts with RAF1 (the 'Ser-338' and 'Ser-339' phosphorylated form). Interacts (via the BH4 domain) with EGLN3; the interaction prevents the formation of the BAX-BCL2 complex and inhibits the anti-apoptotic activity of BCL2 By similarity. Interacts with EI24. Interacts with G0S2; this interaction also prevents the formation of the anti-apoptotic BAX-BCL2 complex. Interacts with PPIF; the interaction is impaired by CsA By similarity. Interacts with BOP By similarity. Interacts with the SCF(FBXO10) complex By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    BaxQ078132EBI-526314,EBI-700711
    Bcl2l11O54918-12EBI-526314,EBI-526076

    Protein-protein interaction databases

    DIPiDIP-1065N.
    IntActiP10417. 6 interactions.
    MINTiMINT-209615.

    Structurei

    3D structure databases

    ProteinModelPortaliP10417.
    SMRiP10417. Positions 3-204.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei209 – 23022HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi10 – 3021BH4Add
    BLAST
    Motifi90 – 10415BH3Add
    BLAST
    Motifi133 – 15220BH1Add
    BLAST
    Motifi184 – 19916BH2Add
    BLAST

    Domaini

    The BH4 motif is required for anti-apoptotic activity and for interaction with RAF1 and EGLN3.

    Sequence similaritiesi

    Belongs to the Bcl-2 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG275924.
    GeneTreeiENSGT00530000062935.
    HOGENOMiHOG000056452.
    HOVERGENiHBG004472.
    InParanoidiP10417.
    KOiK02161.
    OMAiIVLKYIH.
    OrthoDBiEOG70GMGD.
    TreeFamiTF315834.

    Family and domain databases

    InterProiIPR013278. Apop_reg_Bcl2.
    IPR002475. Bcl2-like.
    IPR004725. Bcl2/BclX.
    IPR020717. Bcl2_BH1_motif_CS.
    IPR020726. Bcl2_BH2_motif_CS.
    IPR020728. Bcl2_BH3_motif_CS.
    IPR003093. Bcl2_BH4.
    IPR020731. Bcl2_BH4_motif_CS.
    IPR026298. Blc2_fam.
    [Graphical view]
    PANTHERiPTHR11256. PTHR11256. 1 hit.
    PTHR11256:SF11. PTHR11256:SF11. 1 hit.
    PfamiPF00452. Bcl-2. 1 hit.
    PF02180. BH4. 1 hit.
    [Graphical view]
    PRINTSiPR01863. APOPREGBCL2.
    PR01862. BCL2FAMILY.
    SMARTiSM00265. BH4. 1 hit.
    [Graphical view]
    TIGRFAMsiTIGR00865. bcl-2. 1 hit.
    PROSITEiPS50062. BCL2_FAMILY. 1 hit.
    PS01080. BH1. 1 hit.
    PS01258. BH2. 1 hit.
    PS01259. BH3. 1 hit.
    PS01260. BH4_1. 1 hit.
    PS50063. BH4_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform Alpha (identifier: P10417-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAQAGRTGYD NREIVMKYIH YKLSQRGYEW DAGDADAAPL GAAPTPGIFS    50
    FQPESNPMPA VHRDMAARTS PLRPLVATAG PALSPVPPVV HLTLRRAGDD 100
    FSRRYRRDFA EMSSQLHLTP FTARGRFATV VEELFRDGVN WGRIVAFFEF 150
    GGVMCVESVN REMSPLVDNI ALWMTEYLNR HLHTWIQDNG GWDAFVELYG 200
    PSMRPLFDFS WLSLKTLLSL ALVGACITLG AYLGHK 236
    Length:236
    Mass (Da):26,407
    Last modified:October 3, 2012 - v3
    Checksum:i80FDCFE78C735092
    GO
    Isoform Beta (identifier: P10417-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         193-236: DAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK → VGACLVE

    Show »
    Length:199
    Mass (Da):22,281
    Checksum:iF13C8037262BA955
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti64 – 641D → E in AAA37281. (PubMed:3032455)Curated
    Sequence conflicti64 – 641D → E in AAA37282. (PubMed:3032455)Curated
    Sequence conflicti89 – 891V → C in AAA37281. (PubMed:3032455)Curated
    Sequence conflicti89 – 891V → C in AAA37282. (PubMed:3032455)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei193 – 23644DAFVE…YLGHK → VGACLVE in isoform Beta. CuratedVSP_000513Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L31532, M16506 Genomic DNA. Translation: AAA37282.1.
    M16506 Genomic DNA. Translation: AAA37281.1.
    AC122842 Genomic DNA. No translation available.
    AC162916 Genomic DNA. No translation available.
    CH466520 Genomic DNA. Translation: EDL39862.1.
    BC095964 mRNA. Translation: AAH95964.1.
    CCDSiCCDS15209.1. [P10417-1]
    PIRiA25960. TVMSA1.
    B25960. TVMSB1.
    RefSeqiNP_033871.2. NM_009741.4. [P10417-1]
    UniGeneiMm.257460.

    Genome annotation databases

    EnsembliENSMUST00000112751; ENSMUSP00000108371; ENSMUSG00000057329. [P10417-1]
    GeneIDi12043.
    KEGGimmu:12043.
    UCSCiuc007cgw.1. mouse.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L31532 , M16506 Genomic DNA. Translation: AAA37282.1 .
    M16506 Genomic DNA. Translation: AAA37281.1 .
    AC122842 Genomic DNA. No translation available.
    AC162916 Genomic DNA. No translation available.
    CH466520 Genomic DNA. Translation: EDL39862.1 .
    BC095964 mRNA. Translation: AAH95964.1 .
    CCDSi CCDS15209.1. [P10417-1 ]
    PIRi A25960. TVMSA1.
    B25960. TVMSB1.
    RefSeqi NP_033871.2. NM_009741.4. [P10417-1 ]
    UniGenei Mm.257460.

    3D structure databases

    ProteinModelPortali P10417.
    SMRi P10417. Positions 3-204.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    DIPi DIP-1065N.
    IntActi P10417. 6 interactions.
    MINTi MINT-209615.

    PTM databases

    PhosphoSitei P10417.

    Proteomic databases

    PaxDbi P10417.
    PRIDEi P10417.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000112751 ; ENSMUSP00000108371 ; ENSMUSG00000057329 . [P10417-1 ]
    GeneIDi 12043.
    KEGGi mmu:12043.
    UCSCi uc007cgw.1. mouse.

    Organism-specific databases

    CTDi 596.
    MGIi MGI:88138. Bcl2.

    Phylogenomic databases

    eggNOGi NOG275924.
    GeneTreei ENSGT00530000062935.
    HOGENOMi HOG000056452.
    HOVERGENi HBG004472.
    InParanoidi P10417.
    KOi K02161.
    OMAi IVLKYIH.
    OrthoDBi EOG70GMGD.
    TreeFami TF315834.

    Enzyme and pathway databases

    Reactomei REACT_198658. The NLRP1 inflammasome.
    REACT_223399. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.

    Miscellaneous databases

    ChiTaRSi BCL2. mouse.
    NextBioi 280313.
    PROi P10417.
    SOURCEi Search...

    Gene expression databases

    CleanExi MM_BCL2.
    Genevestigatori P10417.

    Family and domain databases

    InterProi IPR013278. Apop_reg_Bcl2.
    IPR002475. Bcl2-like.
    IPR004725. Bcl2/BclX.
    IPR020717. Bcl2_BH1_motif_CS.
    IPR020726. Bcl2_BH2_motif_CS.
    IPR020728. Bcl2_BH3_motif_CS.
    IPR003093. Bcl2_BH4.
    IPR020731. Bcl2_BH4_motif_CS.
    IPR026298. Blc2_fam.
    [Graphical view ]
    PANTHERi PTHR11256. PTHR11256. 1 hit.
    PTHR11256:SF11. PTHR11256:SF11. 1 hit.
    Pfami PF00452. Bcl-2. 1 hit.
    PF02180. BH4. 1 hit.
    [Graphical view ]
    PRINTSi PR01863. APOPREGBCL2.
    PR01862. BCL2FAMILY.
    SMARTi SM00265. BH4. 1 hit.
    [Graphical view ]
    TIGRFAMsi TIGR00865. bcl-2. 1 hit.
    PROSITEi PS50062. BCL2_FAMILY. 1 hit.
    PS01080. BH1. 1 hit.
    PS01258. BH2. 1 hit.
    PS01259. BH3. 1 hit.
    PS01260. BH4_1. 1 hit.
    PS50063. BH4_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular analysis of mbcl-2: structure and expression of the murine gene homologous to the human gene involved in follicular lymphoma."
      Negrini M., Silini E., Kozak C., Tsujimoto Y., Croce C.M.
      Cell 49:455-463(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS ALPHA AND BETA).
      Strain: BALB/c.
      Tissue: Liver.
    2. "Isolation and characterization of the chicken bcl-2 gene: expression in a variety of tissues including lymphoid and neuronal organs in adult and embryo."
      Eguchi Y., Ewert D.L., Tsujimoto Y.
      Nucleic Acids Res. 20:4187-4192(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION TO 221-222.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Tissue: Olfactory epithelium.
    6. "Bcl-2 phosphorylation required for anti-apoptosis function."
      Ito T., Deng X., Carr B., May W.S. Jr.
      J. Biol. Chem. 272:11671-11673(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT SER-70 BY PKC, MUTAGENESIS OF SER-70.
    7. "Reversible phosphorylation of Bcl2 following interleukin 3 or bryostatin 1 is mediated by direct interaction with protein phosphatase 2A."
      Deng X., Ito T., Carr B., Mumby M., May W.S. Jr.
      J. Biol. Chem. 273:34157-34163(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: DEPHOSPHORYLATION BY PP2A.
    8. "Apoptosis factor EI24/PIG8 is a novel endoplasmic reticulum-localized Bcl-2-binding protein which is associated with suppression of breast cancer invasiveness."
      Zhao X., Ayer R.E., Davis S.L., Ames S.J., Florence B., Torchinsky C., Liou J.S., Shen L., Spanjaard R.A.
      Cancer Res. 65:2125-2129(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH EI24.

    Entry informationi

    Entry nameiBCL2_MOUSE
    AccessioniPrimary (citable) accession number: P10417
    Secondary accession number(s): P10418, Q4VBF6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 1, 1989
    Last sequence update: October 3, 2012
    Last modified: October 1, 2014
    This is version 154 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3