Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P10417

- BCL2_MOUSE

UniProt

P10417 - BCL2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Apoptosis regulator Bcl-2

Gene

Bcl2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei34 – 352Cleavage; by caspasesBy similarity

GO - Molecular functioni

  1. channel activity Source: Ensembl
  2. channel inhibitor activity Source: Ensembl
  3. protein heterodimerization activity Source: MGI
  4. protein homodimerization activity Source: RefGenome
  5. protein phosphatase 2A binding Source: MGI
  6. protein phosphatase binding Source: MGI
  7. sequence-specific DNA binding Source: Ensembl
  8. transcription factor binding Source: MGI

GO - Biological processi

  1. actin filament organization Source: MGI
  2. apoptotic mitochondrial changes Source: MGI
  3. apoptotic process Source: MGI
  4. axonogenesis Source: MGI
  5. axon regeneration Source: MGI
  6. B cell differentiation Source: MGI
  7. B cell homeostasis Source: MGI
  8. B cell lineage commitment Source: MGI
  9. B cell proliferation Source: MGI
  10. B cell receptor signaling pathway Source: Ensembl
  11. behavioral fear response Source: MGI
  12. branching involved in ureteric bud morphogenesis Source: MGI
  13. CD8-positive, alpha-beta T cell lineage commitment Source: MGI
  14. cell aging Source: MGI
  15. cell growth Source: MGI
  16. cell morphogenesis Source: MGI
  17. cell proliferation Source: MGI
  18. cellular calcium ion homeostasis Source: MGI
  19. cellular response to glucose starvation Source: MGI
  20. cellular response to hypoxia Source: MGI
  21. cellular response to organic substance Source: MGI
  22. cochlear nucleus development Source: MGI
  23. defense response to virus Source: Ensembl
  24. developmental growth Source: MGI
  25. developmental pigmentation Source: MGI
  26. digestive tract morphogenesis Source: MGI
  27. ear development Source: MGI
  28. endoplasmic reticulum calcium ion homeostasis Source: MGI
  29. extrinsic apoptotic signaling pathway in absence of ligand Source: MGI
  30. extrinsic apoptotic signaling pathway via death domain receptors Source: MGI
  31. focal adhesion assembly Source: MGI
  32. gland morphogenesis Source: MGI
  33. glomerulus development Source: MGI
  34. growth Source: MGI
  35. hair follicle morphogenesis Source: UniProtKB
  36. hemopoiesis Source: MGI
  37. homeostasis of number of cells within a tissue Source: MGI
  38. immune system development Source: MGI
  39. intrinsic apoptotic signaling pathway in response to DNA damage Source: RefGenome
  40. intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress Source: MGI
  41. intrinsic apoptotic signaling pathway in response to oxidative stress Source: MGI
  42. kidney development Source: MGI
  43. leukocyte homeostasis Source: MGI
  44. lymphocyte homeostasis Source: MGI
  45. lymphoid progenitor cell differentiation Source: MGI
  46. male gonad development Source: MGI
  47. melanin metabolic process Source: MGI
  48. melanocyte differentiation Source: MGI
  49. mesenchymal cell development Source: MGI
  50. metanephros development Source: MGI
  51. negative regulation of anoikis Source: Ensembl
  52. negative regulation of apoptotic process Source: MGI
  53. negative regulation of apoptotic signaling pathway Source: MGI
  54. negative regulation of calcium ion transport into cytosol Source: MGI
  55. negative regulation of cell growth Source: MGI
  56. negative regulation of cell migration Source: MGI
  57. negative regulation of cell proliferation Source: MGI
  58. negative regulation of cellular pH reduction Source: Ensembl
  59. negative regulation of extrinsic apoptotic signaling pathway in absence of ligand Source: Ensembl
  60. negative regulation of G1/S transition of mitotic cell cycle Source: MGI
  61. negative regulation of intrinsic apoptotic signaling pathway Source: RefGenome
  62. negative regulation of mitotic cell cycle Source: MGI
  63. negative regulation of myeloid cell apoptotic process Source: MGI
  64. negative regulation of neuron apoptotic process Source: MGI
  65. negative regulation of ossification Source: MGI
  66. negative regulation of osteoblast proliferation Source: MGI
  67. negative regulation of retinal cell programmed cell death Source: MGI
  68. neuron apoptotic process Source: MGI
  69. oocyte development Source: MGI
  70. organ growth Source: MGI
  71. organ morphogenesis Source: MGI
  72. ossification Source: MGI
  73. ovarian follicle development Source: MGI
  74. peptidyl-serine phosphorylation Source: MGI
  75. peptidyl-threonine phosphorylation Source: MGI
  76. pigmentation Source: UniProtKB
  77. pigment granule organization Source: MGI
  78. positive regulation of B cell proliferation Source: Ensembl
  79. positive regulation of catalytic activity Source: MGI
  80. positive regulation of cell growth Source: MGI
  81. positive regulation of cell proliferation Source: UniProtKB
  82. positive regulation of developmental pigmentation Source: MGI
  83. positive regulation of melanocyte differentiation Source: MGI
  84. positive regulation of multicellular organism growth Source: MGI
  85. positive regulation of neuron maturation Source: MGI
  86. positive regulation of peptidyl-serine phosphorylation Source: MGI
  87. positive regulation of skeletal muscle fiber development Source: MGI
  88. positive regulation of smooth muscle cell migration Source: MGI
  89. post-embryonic development Source: MGI
  90. protein dephosphorylation Source: MGI
  91. protein polyubiquitination Source: MGI
  92. reactive oxygen species metabolic process Source: MGI
  93. regulation of apoptotic process Source: MGI
  94. regulation of calcium ion transport Source: MGI
  95. regulation of catalytic activity Source: MGI
  96. regulation of cell cycle Source: MGI
  97. regulation of cell-matrix adhesion Source: MGI
  98. regulation of developmental pigmentation Source: MGI
  99. regulation of gene expression Source: MGI
  100. regulation of glycoprotein biosynthetic process Source: MGI
  101. regulation of mitochondrial membrane permeability Source: HGNC
  102. regulation of mitochondrial membrane potential Source: HGNC
  103. regulation of nitrogen utilization Source: MGI
  104. regulation of programmed cell death Source: MGI
  105. regulation of protein heterodimerization activity Source: Ensembl
  106. regulation of protein homodimerization activity Source: Ensembl
  107. regulation of protein localization Source: MGI
  108. regulation of protein stability Source: MGI
  109. regulation of transmembrane transporter activity Source: Ensembl
  110. regulation of viral genome replication Source: UniProtKB
  111. release of cytochrome c from mitochondria Source: HGNC
  112. renal system process Source: MGI
  113. response to cytokine Source: MGI
  114. response to drug Source: MGI
  115. response to gamma radiation Source: MGI
  116. response to glucocorticoid Source: MGI
  117. response to hydrogen peroxide Source: MGI
  118. response to iron ion Source: Ensembl
  119. response to ischemia Source: MGI
  120. response to nicotine Source: Ensembl
  121. response to oxidative stress Source: MGI
  122. response to steroid hormone Source: MGI
  123. response to toxic substance Source: MGI
  124. response to UV-B Source: MGI
  125. single organismal cell-cell adhesion Source: MGI
  126. spleen development Source: MGI
  127. T cell differentiation Source: MGI
  128. T cell differentiation in thymus Source: MGI
  129. T cell homeostasis Source: MGI
  130. T cell lineage commitment Source: MGI
  131. thymus development Source: MGI
  132. ureteric bud development Source: MGI
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

ReactomeiREACT_198658. The NLRP1 inflammasome.
REACT_223399. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.

Names & Taxonomyi

Protein namesi
Recommended name:
Apoptosis regulator Bcl-2
Gene namesi
Name:Bcl2
Synonyms:Bcl-2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 1

Organism-specific databases

MGIiMGI:88138. Bcl2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei209 – 23022HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cytoplasm Source: MGI
  2. cytosol Source: MGI
  3. endoplasmic reticulum Source: MGI
  4. endoplasmic reticulum membrane Source: MGI
  5. intracellular Source: MGI
  6. membrane Source: MGI
  7. mitochondrial membrane Source: MGI
  8. mitochondrial outer membrane Source: RefGenome
  9. mitochondrion Source: MGI
  10. myelin sheath Source: MGI
  11. nuclear membrane Source: MGI
  12. nucleus Source: MGI
  13. pore complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Mitochondrion, Mitochondrion outer membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi70 – 701S → A: Loss of phosphorylation. Unable to suppress apoptosis. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 236236Apoptosis regulator Bcl-2PRO_0000143049Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei69 – 691Phosphothreonine; by MAPK8By similarity
Modified residuei70 – 701Phosphoserine; by MAPK8 and PKC1 Publication
Modified residuei84 – 841Phosphoserine; by MAPK8By similarity

Post-translational modificationi

Phosphorylation/dephosphorylation on Ser-70 regulates anti-apoptotic activity. Growth factor-stimulated phosphorylation on Ser-70 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle. In the absence of growth factors, BCL2 appears to be phosphorylated by other protein kinases such as ERKs and stress-activated kinases. Phosphorylated by MAPK8/JNK1 at Thr-69, Ser-70 and Ser-84, wich stimulates starvation-induced autophagy (By similarity). Dephosphorylated by protein phosphatase 2A (PP2A).By similarity1 Publication
Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity, causes the release of cytochrome c into the cytosol promoting further caspase activity.
Monoubiquitinated by PARK2, leading to increase its stability. Ubiquitinated by SCF(FBXO10), leading to its degradation by the proteasome.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiP10417.
PRIDEiP10417.

PTM databases

PhosphoSiteiP10417.

Expressioni

Tissue specificityi

Expressed in a variety of tissues.

Gene expression databases

CleanExiMM_BCL2.
ExpressionAtlasiP10417. baseline and differential.
GenevestigatoriP10417.

Interactioni

Subunit structurei

Forms homodimers, and heterodimers with BAX, BAD, BAK and Bcl-X(L). Heterodimerization with BAX requires intact BH1 and BH2 motifs, and is necessary for anti-apoptotic activity (By similarity). Also interacts with APAF1, BBC3, BCL2L1, BNIPL, MRPL41 and TP53BP2. Binding to FKBP8 seems to target BCL2 to the mitochondria and probably interferes with the binding of BCL2 to its targets. Interacts with BAG1 in an ATP-dependent manner. Interacts with RAF1 (the 'Ser-338' and 'Ser-339' phosphorylated form). Interacts (via the BH4 domain) with EGLN3; the interaction prevents the formation of the BAX-BCL2 complex and inhibits the anti-apoptotic activity of BCL2 (By similarity). Interacts with EI24. Interacts with G0S2; this interaction also prevents the formation of the anti-apoptotic BAX-BCL2 complex. Interacts with PPIF; the interaction is impaired by CsA (By similarity). Interacts with BOP (By similarity). Interacts with the SCF(FBXO10) complex (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
BaxQ078132EBI-526314,EBI-700711
Bcl2l11O54918-12EBI-526314,EBI-526076

Protein-protein interaction databases

DIPiDIP-1065N.
IntActiP10417. 6 interactions.
MINTiMINT-209615.

Structurei

3D structure databases

ProteinModelPortaliP10417.
SMRiP10417. Positions 3-204.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi10 – 3021BH4Add
BLAST
Motifi90 – 10415BH3Add
BLAST
Motifi133 – 15220BH1Add
BLAST
Motifi184 – 19916BH2Add
BLAST

Domaini

The BH4 motif is required for anti-apoptotic activity and for interaction with RAF1 and EGLN3.

Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG275924.
GeneTreeiENSGT00530000062935.
HOGENOMiHOG000056452.
HOVERGENiHBG004472.
InParanoidiP10417.
KOiK02161.
OMAiIVLKYIH.
OrthoDBiEOG70GMGD.
TreeFamiTF315834.

Family and domain databases

InterProiIPR013278. Apop_reg_Bcl2.
IPR002475. Bcl2-like.
IPR004725. Bcl2/BclX.
IPR020717. Bcl2_BH1_motif_CS.
IPR020726. Bcl2_BH2_motif_CS.
IPR020728. Bcl2_BH3_motif_CS.
IPR003093. Bcl2_BH4.
IPR020731. Bcl2_BH4_motif_CS.
IPR026298. Blc2_fam.
[Graphical view]
PANTHERiPTHR11256. PTHR11256. 1 hit.
PTHR11256:SF11. PTHR11256:SF11. 1 hit.
PfamiPF00452. Bcl-2. 1 hit.
PF02180. BH4. 1 hit.
[Graphical view]
PRINTSiPR01863. APOPREGBCL2.
PR01862. BCL2FAMILY.
SMARTiSM00265. BH4. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00865. bcl-2. 1 hit.
PROSITEiPS50062. BCL2_FAMILY. 1 hit.
PS01080. BH1. 1 hit.
PS01258. BH2. 1 hit.
PS01259. BH3. 1 hit.
PS01260. BH4_1. 1 hit.
PS50063. BH4_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform Alpha (identifier: P10417-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQAGRTGYD NREIVMKYIH YKLSQRGYEW DAGDADAAPL GAAPTPGIFS
60 70 80 90 100
FQPESNPMPA VHRDMAARTS PLRPLVATAG PALSPVPPVV HLTLRRAGDD
110 120 130 140 150
FSRRYRRDFA EMSSQLHLTP FTARGRFATV VEELFRDGVN WGRIVAFFEF
160 170 180 190 200
GGVMCVESVN REMSPLVDNI ALWMTEYLNR HLHTWIQDNG GWDAFVELYG
210 220 230
PSMRPLFDFS WLSLKTLLSL ALVGACITLG AYLGHK
Length:236
Mass (Da):26,407
Last modified:October 3, 2012 - v3
Checksum:i80FDCFE78C735092
GO
Isoform Beta (identifier: P10417-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     193-236: DAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK → VGACLVE

Show »
Length:199
Mass (Da):22,281
Checksum:iF13C8037262BA955
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti64 – 641D → E in AAA37281. (PubMed:3032455)Curated
Sequence conflicti64 – 641D → E in AAA37282. (PubMed:3032455)Curated
Sequence conflicti89 – 891V → C in AAA37281. (PubMed:3032455)Curated
Sequence conflicti89 – 891V → C in AAA37282. (PubMed:3032455)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei193 – 23644DAFVE…YLGHK → VGACLVE in isoform Beta. CuratedVSP_000513Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L31532, M16506 Genomic DNA. Translation: AAA37282.1.
M16506 Genomic DNA. Translation: AAA37281.1.
AC122842 Genomic DNA. No translation available.
AC162916 Genomic DNA. No translation available.
CH466520 Genomic DNA. Translation: EDL39862.1.
BC095964 mRNA. Translation: AAH95964.1.
CCDSiCCDS15209.1. [P10417-1]
PIRiA25960. TVMSA1.
B25960. TVMSB1.
RefSeqiNP_033871.2. NM_009741.4. [P10417-1]
UniGeneiMm.257460.

Genome annotation databases

EnsembliENSMUST00000112751; ENSMUSP00000108371; ENSMUSG00000057329. [P10417-1]
ENSMUST00000189999; ENSMUSP00000139856; ENSMUSG00000057329. [P10417-2]
GeneIDi12043.
KEGGimmu:12043.
UCSCiuc007cgw.1. mouse.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L31532 , M16506 Genomic DNA. Translation: AAA37282.1 .
M16506 Genomic DNA. Translation: AAA37281.1 .
AC122842 Genomic DNA. No translation available.
AC162916 Genomic DNA. No translation available.
CH466520 Genomic DNA. Translation: EDL39862.1 .
BC095964 mRNA. Translation: AAH95964.1 .
CCDSi CCDS15209.1. [P10417-1 ]
PIRi A25960. TVMSA1.
B25960. TVMSB1.
RefSeqi NP_033871.2. NM_009741.4. [P10417-1 ]
UniGenei Mm.257460.

3D structure databases

ProteinModelPortali P10417.
SMRi P10417. Positions 3-204.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

DIPi DIP-1065N.
IntActi P10417. 6 interactions.
MINTi MINT-209615.

PTM databases

PhosphoSitei P10417.

Proteomic databases

PaxDbi P10417.
PRIDEi P10417.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000112751 ; ENSMUSP00000108371 ; ENSMUSG00000057329 . [P10417-1 ]
ENSMUST00000189999 ; ENSMUSP00000139856 ; ENSMUSG00000057329 . [P10417-2 ]
GeneIDi 12043.
KEGGi mmu:12043.
UCSCi uc007cgw.1. mouse.

Organism-specific databases

CTDi 596.
MGIi MGI:88138. Bcl2.

Phylogenomic databases

eggNOGi NOG275924.
GeneTreei ENSGT00530000062935.
HOGENOMi HOG000056452.
HOVERGENi HBG004472.
InParanoidi P10417.
KOi K02161.
OMAi IVLKYIH.
OrthoDBi EOG70GMGD.
TreeFami TF315834.

Enzyme and pathway databases

Reactomei REACT_198658. The NLRP1 inflammasome.
REACT_223399. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.

Miscellaneous databases

ChiTaRSi Bcl2. mouse.
NextBioi 280313.
PROi P10417.
SOURCEi Search...

Gene expression databases

CleanExi MM_BCL2.
ExpressionAtlasi P10417. baseline and differential.
Genevestigatori P10417.

Family and domain databases

InterProi IPR013278. Apop_reg_Bcl2.
IPR002475. Bcl2-like.
IPR004725. Bcl2/BclX.
IPR020717. Bcl2_BH1_motif_CS.
IPR020726. Bcl2_BH2_motif_CS.
IPR020728. Bcl2_BH3_motif_CS.
IPR003093. Bcl2_BH4.
IPR020731. Bcl2_BH4_motif_CS.
IPR026298. Blc2_fam.
[Graphical view ]
PANTHERi PTHR11256. PTHR11256. 1 hit.
PTHR11256:SF11. PTHR11256:SF11. 1 hit.
Pfami PF00452. Bcl-2. 1 hit.
PF02180. BH4. 1 hit.
[Graphical view ]
PRINTSi PR01863. APOPREGBCL2.
PR01862. BCL2FAMILY.
SMARTi SM00265. BH4. 1 hit.
[Graphical view ]
TIGRFAMsi TIGR00865. bcl-2. 1 hit.
PROSITEi PS50062. BCL2_FAMILY. 1 hit.
PS01080. BH1. 1 hit.
PS01258. BH2. 1 hit.
PS01259. BH3. 1 hit.
PS01260. BH4_1. 1 hit.
PS50063. BH4_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular analysis of mbcl-2: structure and expression of the murine gene homologous to the human gene involved in follicular lymphoma."
    Negrini M., Silini E., Kozak C., Tsujimoto Y., Croce C.M.
    Cell 49:455-463(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS ALPHA AND BETA).
    Strain: BALB/c.
    Tissue: Liver.
  2. "Isolation and characterization of the chicken bcl-2 gene: expression in a variety of tissues including lymphoid and neuronal organs in adult and embryo."
    Eguchi Y., Ewert D.L., Tsujimoto Y.
    Nucleic Acids Res. 20:4187-4192(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION TO 221-222.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Olfactory epithelium.
  6. "Bcl-2 phosphorylation required for anti-apoptosis function."
    Ito T., Deng X., Carr B., May W.S. Jr.
    J. Biol. Chem. 272:11671-11673(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-70 BY PKC, MUTAGENESIS OF SER-70.
  7. "Reversible phosphorylation of Bcl2 following interleukin 3 or bryostatin 1 is mediated by direct interaction with protein phosphatase 2A."
    Deng X., Ito T., Carr B., Mumby M., May W.S. Jr.
    J. Biol. Chem. 273:34157-34163(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: DEPHOSPHORYLATION BY PP2A.
  8. "Apoptosis factor EI24/PIG8 is a novel endoplasmic reticulum-localized Bcl-2-binding protein which is associated with suppression of breast cancer invasiveness."
    Zhao X., Ayer R.E., Davis S.L., Ames S.J., Florence B., Torchinsky C., Liou J.S., Shen L., Spanjaard R.A.
    Cancer Res. 65:2125-2129(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH EI24.

Entry informationi

Entry nameiBCL2_MOUSE
AccessioniPrimary (citable) accession number: P10417
Secondary accession number(s): P10418, Q4VBF6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: October 3, 2012
Last modified: November 26, 2014
This is version 156 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3