Reviewed,
UniProtKB/Swiss-Prot P10415 (BCL2_HUMAN)
Last modified
March 2, 2010.
Version 144.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Apoptosis regulator Bcl-2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 239 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). |
| Subunit structure | Forms homodimers, and heterodimers with BAX, BAD, BAK and Bcl-X(L). Heterodimerization with BAX requires intact BH1 and BH2 motifs, and is necessary for anti-apoptotic activity By similarity. Also interacts with APAF1, RAF-1, TP53BP2, BBC3, BCL2L1, MRPL41 and BNIPL. Binding to FKBP8 seems to target BCL2 to the mitochondria and probably interferes with the binding of BCL2 to its targets. Interacts with BAG1 in an ATP-dependent manner. Ref.11 Ref.13 Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 |
| Subcellular location | Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein Ref.9. |
| Tissue specificity | Expressed in a variety of tissues. |
| Domain | The BH4 motif is required for anti-apoptotic activity and for interaction with RAF-1. |
| Post-translational modification | Phosphorylation/dephosphorylation on Ser-70 regulates anti-apoptotic activity. Growth factor-stimulated phosphorylation on Ser-70 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle. In the absence of growth factors, BCL2 appears to be phosphorylated by other protein kinases such as ERKs and stress-activated kinases. Dephosphorylated by protein phosphatase 2A (PP2A) By similarity. Ref.15 Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity, causes the release of cytochrome c into the cytosol promoting further caspase activity. Ref.12 |
| Involvement in disease | A chromosomal aberration involving BCL2 may be a cause of follicular lymphoma (FL) [MIM:151430]; also known as type II chronic lymphatic leukemia. Translocation t(14;18)(q32;q21) with immunoglobulin gene regions. BCL2 mutations found in non-Hodgkin lymphomas carrying the chromosomal translocation could be attributed to the Ig somatic hypermutation mechanism resulting in nucleotide transitions. |
| Sequence similarities | Belongs to the Bcl-2 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 2 | EBI-77694,EBI-77694 | ||
| BAD | Q92934 | 3 | EBI-77694,EBI-700771 | |
| Bad | Q61337 | 3 | EBI-77694,EBI-400328 | From a different organism. |
| BAK1 | Q16611 | 1 | EBI-77694,EBI-519866 | |
| BAX | Q07812 | 2 | EBI-77694,EBI-516580 | |
| Bax | Q07813 | 1 | EBI-77694,EBI-700711 | From a different organism. |
| BBC3 | Q9BXH1 | 3 | EBI-77694,EBI-519884 | |
| BBC3 | Q9BXH1-1 | 1 | EBI-77694,EBI-519891 | |
| BBC3 | Q9BXH1-2 | 1 | EBI-77694,EBI-519896 | |
| BCAP31 | P51572 | 2 | EBI-77694,EBI-77683 | |
| BCL2L1 | Q07817-1 | 1 | EBI-77694,EBI-287195 | |
| BCL2L11 | O43521 | 2 | EBI-77694,EBI-526406 | |
| BCL2L11 | O43521-1 | 1 | EBI-77694,EBI-526416 | |
| BCL2L11 | O43521-2 | 2 | EBI-77694,EBI-526420 | |
| Bcl2l11 | O54918 | 1 | EBI-77694,EBI-526067 | From a different organism. |
| BID | P55957 | 3 | EBI-77694,EBI-519672 | |
| BIK | Q13323 | 2 | EBI-77694,EBI-700794 | |
| Bmf | Q91ZE9 | 2 | EBI-77694,EBI-708032 | From a different organism. |
| BNIP3L | O60238 | 1 | EBI-77694,EBI-849893 | |
| NLRP1 | Q9C000 | 5 | EBI-77694,EBI-1220518 | |
| NR4A1 | P22736 | 3 | EBI-77694,EBI-721550 | |
| PPP1CA | P62136 | 1 | EBI-77694,EBI-357253 | |
| PPP1CB | P62140 | 1 | EBI-77694,EBI-352350 | |
| PPP1CC | P36873-1 | 1 | EBI-77694,EBI-356289 | |
| SIVA1 | O15304 | 1 | EBI-77694,EBI-520756 | |
| SPNS1 | Q9H2V7 | 1 | EBI-77694,EBI-1386527 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha (identifier: P10415-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Beta (identifier: P10415-2) The sequence of this isoform differs from the canonical sequence as follows: 196-239: DAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK → VGASGDVS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 239 | 239 | Apoptosis regulator Bcl-2 | PRO_0000143048 | ||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||
| Transmembrane | 212 – 233 | 22 | Potential | |||||||||||||||||||||||||||
| Motif | 10 – 30 | 21 | BH4 | |||||||||||||||||||||||||||
| Motif | 93 – 107 | 15 | BH3 | |||||||||||||||||||||||||||
| Motif | 136 – 155 | 20 | BH1 | |||||||||||||||||||||||||||
| Motif | 187 – 202 | 16 | BH2 | |||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||
| Site | 34 – 35 | 2 | Cleavage; by caspase-3 | |||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||
| Modified residue | 70 | 1 | Phosphoserine; by PKC By similarity | |||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||
| Alternative sequence | 196 – 239 | 44 | DAFVE…YLGHK → VGASGDVS in isoform Beta. | VSP_000512 | ||||||||||||||||||||||||||
| Natural variant | 7 | 1 | T → S | VAR_000827 | ||||||||||||||||||||||||||
| Natural variant | 43 | 1 | A → T: dbSNP rs1800477. Ref.6 | VAR_014716 | ||||||||||||||||||||||||||
| Natural variant | 59 | 1 | P → S in non-Hodgkin lymphoma; somatic mutation. Ref.8 | VAR_000828 | ||||||||||||||||||||||||||
| Natural variant | 93 | 1 | V → I in non-Hodgkin lymphoma; somatic mutation. Ref.8 | VAR_000829 | ||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||
| Mutagenesis | 34 | 1 | D → A: Abolishes cleavage by caspase-3. | |||||||||||||||||||||||||||
| Mutagenesis | 64 | 1 | D → A: No effect on cleavage by caspase-3. | |||||||||||||||||||||||||||
| Mutagenesis | 145 | 1 | G → A: No heterodimerization with BAX and loss of anti-apoptotic activity. | |||||||||||||||||||||||||||
| Mutagenesis | 188 | 1 | W → A: No heterodimerization with BAX and loss of anti-apoptotic activity. | |||||||||||||||||||||||||||
| Sequence conflict | 48 | 1 | I → F in CAA29778. Ref.4 | |||||||||||||||||||||||||||
| Sequence conflict | 59 | 1 | P → T in AAA35591. Ref.3 | |||||||||||||||||||||||||||
| Sequence conflict | 96 | 1 | T → A in AAD14111. Ref.8 | |||||||||||||||||||||||||||
| Sequence conflict | 110 | 1 | R → G in AAD14111. Ref.8 | |||||||||||||||||||||||||||
| Sequence conflict | 117 | 1 | S → R in AAA35591. Ref.3 | |||||||||||||||||||||||||||
| Sequence conflict | 129 | 1 | R → C in CAA29778. Ref.4 | |||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||
| Helix | 52 – 65 | 14 | ||||||||||||||||||||||||||||
| Turn | 73 – 75 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 88 – 92 | 5 | ||||||||||||||||||||||||||||
| Helix | 93 – 108 | 16 | ||||||||||||||||||||||||||||
| Beta strand | 110 – 112 | 3 | ||||||||||||||||||||||||||||
| Helix | 114 – 117 | 4 | ||||||||||||||||||||||||||||
| Helix | 123 – 137 | 15 | ||||||||||||||||||||||||||||
| Helix | 144 – 163 | 20 | ||||||||||||||||||||||||||||
| Helix | 167 – 183 | 17 | ||||||||||||||||||||||||||||
| Helix | 185 – 192 | 8 | ||||||||||||||||||||||||||||
| Helix | 195 – 202 | 8 | ||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Analysis of the structure, transcripts, and protein products of bcl-2, the gene involved in human follicular lymphoma." Tsujimoto Y., Croce C.M. Proc. Natl. Acad. Sci. U.S.A. 83:5214-5218(1986) [PubMed: 3523487] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND BETA). |
| [2] | "Isolation and characterization of the chicken bcl-2 gene: expression in a variety of tissues including lymphoid and neuronal organs in adult and embryo." Eguchi Y., Ewert D.L., Tsujimoto Y. Nucleic Acids Res. 20:4187-4192(1992) [PubMed: 1508712] [Abstract] Cited for: SEQUENCE REVISION TO 96; 110 AND 237. |
| [3] | "Cloning and structural analysis of cDNAs for bcl-2 and a hybrid bcl-2/immunoglobulin transcript resulting from the t(14;18) translocation." Cleary M.L., Smith S.D., Sklar J. Cell 47:19-28(1986) [PubMed: 2875799] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA). |
| [4] | "Alternative promoters and exons, somatic mutation and deregulation of the Bcl-2-Ig fusion gene in lymphoma." Seto M., Jaeger U., Hockett R.D., Graninger W., Bennett S., Goldman P., Korsmeyer S.J. EMBO J. 7:123-131(1988) [PubMed: 2834197] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), VARIANT SER-7. |
| [5] | "Consequences of the t(14;18) chromosomal translocation in follicular lymphoma: deregulated expression of a chimeric and mutated BCL-2 gene." Hua C., Zorn S., Jensen J.P., Coupland R.W., Ko H.S., Wright J.J., Bakhshi A. Oncogene Res. 2:263-275(1988) [PubMed: 3285301] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], VARIANT SER-7. |
| [6] | NIEHS SNPs program Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-43. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). Tissue: Testis. |
| [8] | "Frequent incidence of somatic mutations in translocated BCL2 oncogenes of non-Hodgkin's lymphomas." Tanaka S., Louie D.C., Kant J.A., Reed J.C. Blood 79:229-237(1992) [PubMed: 1339299] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-131 (ISOFORM ALPHA), VARIANTS NON-HODGKIN LYMPHOMA SER-59 AND ILE-93. |
| [9] | "Bcl-2 is an inner mitochondrial membrane protein that blocks programmed cell death." Hockenbery D., Nunez G., Milliman C., Schreiber R.D., Korsmeyer S.J. Nature 348:334-336(1990) [PubMed: 2250705] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [10] | "BH1 and BH2 domains of Bcl-2 are required for inhibition of apoptosis and heterodimerization with Bax." Yin X.-M., Oltvai Z.N., Korsmeyer S.J. Nature 369:321-323(1994) [PubMed: 8183370] [Abstract] Cited for: MUTAGENESIS. |
| [11] | "BAG-1 modulates the chaperone activity of Hsp70/Hsc70." Takayama S., Bimston D.N., Matsuzawa S.-I., Freeman B.C., Aime-Sempe C., Xie Z., Morimoto R.I., Reed J.C. EMBO J. 16:4887-4896(1997) [PubMed: 9305631] [Abstract] Cited for: INTERACTION WITH BAG1. |
| [12] | "Conversion of Bcl-2 to a Bax-like death effector by caspases." Cheng E.H.-Y., Kirsch D.G., Clem R.J., Ravi R., Kastan M.B., Bedi A., Ueno K., Hardwick J.M. Science 278:1966-1968(1997) [PubMed: 9395403] [Abstract] Cited for: CLEAVAGE BY CASPASES, MUTAGENESIS. |
| [13] | "The p53-binding protein 53BP2 also interacts with Bcl2 and impedes cell cycle progression at G2/M." Naumovski L., Cleary M.L. Mol. Cell. Biol. 16:3884-3892(1996) [PubMed: 8668206] [Abstract] Cited for: INTERACTION WITH TP53BP2. |
| [14] | "Phosphorylation of Bcl2 and regulation of apoptosis." Ruvolo P.P., Deng X., May W.S. Leukemia 15:515-522(2001) [PubMed: 11368354] [Abstract] Cited for: REVIEW ON PHOSPHORYLATION. |
| [15] | "BCL-2 is phosphorylated and inactivated by an ASK1/Jun N-terminal protein kinase pathway normally activated at G(2)/M." Yamamoto K., Ichijo H., Korsmeyer S.J. Mol. Cell. Biol. 19:8469-8478(1999) [PubMed: 10567572] [Abstract] Cited for: PHOSPHORYLATION BY ASK1/JNK1. |
| [16] | "PUMA induces the rapid apoptosis of colorectal cancer cells." Yu J., Zhang L., Hwang P.M., Kinzler K.W., Vogelstein B. Mol. Cell 7:673-682(2001) [PubMed: 11463391] [Abstract] Cited for: INTERACTION WITH BBC3 AND BCL2L1. |
| [17] | "BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP in apoptosis." Qin W., Hu J., Guo M., Xu J., Li J., Yao G., Zhou X., Jiang H., Zhang P., Shen L., Wan D., Gu J. Biochem. Biophys. Res. Commun. 308:379-385(2003) [PubMed: 12901880] [Abstract] Cited for: INTERACTION WITH BNIPL. |
| [18] | "The flexible loop of Bcl-2 is required for molecular interaction with immunosuppressant FK-506 binding protein 38 (FKBP38)." Kang C.B., Tai J., Chia J., Yoon H.S. FEBS Lett. 579:1469-1476(2005) [PubMed: 15733859] [Abstract] Cited for: INTERACTION WITH FKBP8. |
| [19] | "BMRP is a Bcl-2 binding protein that induces apoptosis." Chintharlapalli S.R., Jasti M., Malladi S., Parsa K.V.L., Ballestero R.P., Gonzalez-Garcia M. J. Cell. Biochem. 94:611-626(2005) [PubMed: 15547950] [Abstract] Cited for: INTERACTION WITH MRPL41. |
| [20] | "Bcl-2 localized at the nuclear compartment induces apoptosis after transient overexpression." Portier B.P., Taglialatela G. J. Biol. Chem. 281:40493-40502(2006) [PubMed: 17090549] [Abstract] Cited for: INTERACTION WITH FKBP8. |
| [21] | "Solution structure of the antiapoptotic protein bcl-2." Petros A.M., Medek A., Nettesheim D.G., Kim D.H., Yoon H.S., Swift K., Matayoshi E.D., Oltersdorf T., Fesik S.W. Proc. Natl. Acad. Sci. U.S.A. 98:3012-3017(2001) [PubMed: 11248023] [Abstract] Cited for: STRUCTURE BY NMR OF 1-207. |
| [22] | "An inhibitor of Bcl-2 family proteins induces regression of solid tumours." Oltersdorf T., Elmore S.W., Shoemaker A.R., Armstrong R.C., Augeri D.J., Belli B.A., Bruncko M., Deckwerth T.L., Dinges J., Hajduk P.J., Joseph M.K., Kitada S., Korsmeyer S.J., Kunzer A.R., Letai A., Li C., Mitten M.J., Nettesheim D.G. Rosenberg S.H.Nature 435:677-681(2005) [PubMed: 15902208] [Abstract] Cited for: STRUCTURE BY NMR OF 45-207. |
| [23] | "Studies leading to potent, dual inhibitors of Bcl-2 and Bcl-xL." Bruncko M., Oost T.K., Belli B.A., Ding H., Joseph M.K., Kunzer A., Martineau D., McClellan W.J., Mitten M., Ng S.-C., Nimmer P.M., Oltersdorf T., Park C.-M., Petros A.M., Shoemaker A.R., Song X., Wang X., Wendt M.D. Elmore S.W.J. Med. Chem. 50:641-662(2007) [PubMed: 17256834] [Abstract] Cited for: STRUCTURE BY NMR OF 44-207. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M13994 mRNA. Translation: AAA51813.1. Sequence problems. M13995 mRNA. Translation: AAA51814.1. Sequence problems. M14745 mRNA. Translation: AAA35591.1. X06487 mRNA. Translation: CAA29778.1. AY220759 Genomic DNA. Translation: AAO26045.1. BC027258 mRNA. Translation: AAH27258.1. S72602 Genomic DNA. Translation: AAD14111.1. Sequence problems. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00020961. IPI00217817. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | TVHUB1. B29409. TVHUA1. C37332. | ||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000624.2. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.150749 | ||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P10415. Positions 3-207. | ||||||||||||||||||||||||||||||||||||||||||||||||
| DisProt | DP00297. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-1043N. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P10415. 32 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P10415. | ||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P10415. | ||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P10415. | ||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000333681; ENSP00000329623; ENSG00000171791; Homo sapiens. [Genome view] ENST00000398117; ENSP00000381185; ENSG00000171791; Homo sapiens. [Genome view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 596. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:596. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002lit.1. human. uc002liv.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 596. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC18M058941. | ||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0014496. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:990. BCL2. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB000003. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 151430. gene+phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 545. Follicular lymphoma. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA25302. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG05190. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HBG717457. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG004472. | ||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P10415. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | MSGQLHL. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG9PP123. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P10415. | ||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. ceramidepathway. Ceramide signaling pathway. epopathway. EPO signaling pathway. faspathway. FAS signaling pathway (CD95). hivnefpathway. HIV-1 Nef: Negative effector of Fas and TNF-alpha. il2_pi3kpathway. IL2 signaling events mediated by PI3K. il2_stat5pathway. IL2 signaling events mediated by STAT5. il2_1pathway. IL2-mediated signaling events. nfat_3pathway. Role of Calcineurin-dependent NFAT signaling in lymphocytes. rxr_vdr_pathway. RXR and RAR hetrodimerization with other nuclear receptor. kitpathway. Signaling events mediated by Stem cell factor receptor (c-Kit). | ||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P10415. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P10415. | ||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_BCL2. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P10415. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000171791. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR013278. Apop_reg_Bcl2. IPR002475. BCL2_apoptsis. IPR000712. Bcl2_BH. IPR020717. Bcl2_BH1_motif_CS. IPR020726. Bcl2_BH2_motif_CS. IPR020728. Bcl2_BH3_motif_CS. IPR003093. Bcl2_BH4. IPR020731. Bcl2_BH4_motif_CS. IPR004725. Bcl2_reg. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00452. Bcl-2. 1 hit. PF02180. BH4. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR01863. APOPREGBCL2. PR01862. BCL2FAMILY. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00337. BCL. 1 hit. SM00265. BH4. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR00865. bcl-2. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50062. BCL2_FAMILY. 1 hit. PS01080. BH1. 1 hit. PS01258. BH2. 1 hit. PS01259. BH3. 1 hit. PS01260. BH4_1. 1 hit. PS50063. BH4_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB01248. Docetaxel. DB01073. Fludarabine. DB01065. Melatonin. DB01229. Paclitaxel. DB01367. Rasagiline. | ||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 2423. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P10415. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | BCL2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P10415 Secondary accession number(s): P10416, Q13842, Q16197 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


