Reviewed,
UniProtKB/Swiss-Prot P10242 (MYB_HUMAN)
Last modified
November 25, 2008.
Version 90.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Myb proto-oncogene protein Alternative name(s): C-myb | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 640 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells. |
| Subunit structure | Binds MYBBP1A. Interacts with HIPK2 and NLK By similarity. |
| Subcellular location | |
| Domain | Comprised of 3 domains; an N-terminal DNA-binding domain, a centrally located transcriptional activation domain and a C-terminal domain involved in transcriptional repression. |
| Post-translational modification | Ubiquitinated; mediated by SIAH1 and leading to its subsequent proteasomal degradation Probable. Phosphorylated by NLK on multiple sites, which induces proteasomal degradation By similarity. |
| Sequence similarities | Contains 3 HTH myb-type DNA-binding domains. |
Ontologies
Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Disease | Proto-oncogene |
| Domain | Repeat |
| Ligand | DNA-binding |
| Molecular function | Activator |
| PTM | Ubl conjugation |
Gene Ontology (GO) | |
| Biological process | regulation of transcription, DNA-dependent Ref.10 Non-traceable author statement. Source: UniProtKB |
| Cellular component | nuclear matrix Ref.9 Non-traceable author statement. Source: UniProtKB |
| Molecular function | DNA binding Inferred from electronic annotation. Source: InterPro protein bindingInferred from physical interaction. Source: IntAct transcription activator activity Ref.10Non-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Crebbp | P45481 | 1 | EBI-298355,EBI-296306 | From a different organism. |
| HIPK2 | Q9H2X6 | 1 | EBI-298355,EBI-348345 | |
| MED15 | Q96RN5 | 1 | EBI-298355,EBI-394506 | |
| NLK | Q9UBE8 | 1 | EBI-298355,EBI-366978 |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: P10242-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: P10242-2) The sequence of this isoform differs from the canonical sequence as follows: 314-316: Missing. | |||||||||
| Isoform 3 (identifier: P10242-3) The sequence of this isoform differs from the canonical sequence as follows: 317-350: TQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGE → LCGPLLNSDIFSDWAANWDGSLCFATYIVNQQRQ 351-640: Missing. | |||||||||
| Isoform 4 (identifier: P10242-4) The sequence of this isoform differs from the canonical sequence as follows: 401-401: S → SDSSSWCDLS...VKSLPFSPSQ | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 433 | 1 | L → F in CAA35503. Ref.5 | ||||||
| Isoform 5 (identifier: P10242-5) The sequence of this isoform differs from the canonical sequence as follows: 402-402: F → M 403-640: Missing. | |||||||||
| Isoform 6 (identifier: P10242-6) The sequence of this isoform differs from the canonical sequence as follows: 567-640: NILTSSVLMA...NAFSARTLVM → TGVQWHDFGS...LRFNGTSIRR | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 640 | 640 | Myb proto-oncogene protein | PRO_0000197048 | |||||
Regions | |||||||||
| Domain | 35 – 86 | 52 | HTH myb-type 1 | ||||||
| Domain | 87 – 142 | 56 | HTH myb-type 2 | ||||||
| Domain | 143 – 193 | 51 | HTH myb-type 3 | ||||||
| Domain | 376 – 397 | 22 | Leucine-zipper | ||||||
| DNA binding | 63 – 86 | 24 | H-T-H motif By similarity | ||||||
| DNA binding | 115 – 138 | 24 | H-T-H motif By similarity | ||||||
| DNA binding | 166 – 189 | 24 | H-T-H motif By similarity | ||||||
| Region | 90 – 193 | 104 | Interaction with HIPK2 and NLK By similarity | ||||||
| Region | 275 – 327 | 53 | Transcriptional activation domain | ||||||
| Region | 328 – 465 | 138 | Negative regulatory domain By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 314 – 316 | 3 | Missing in isoform 2. | VSP_003293 | |||||
| Alternative sequence | 317 – 350 | 34 | TQNHT…SCLGE → LCGPLLNSDIFSDWAANWDG SLCFATYIVNQQRQ in isoform 3. | VSP_003294 | |||||
| Alternative sequence | 351 – 640 | 290 | Missing in isoform 3. | VSP_003295 | |||||
| Alternative sequence | 401 | 1 | S → SDSSSWCDLSSFEFFEEADF SPSQHHTGKALQLQQREGNG TKPAGEPSPRVNKRMLSESS LDPPKVLPPARHSTIPLVIL RKKRGQASPLATGDCSSFIF ADVSSSTPKRSPVKSLPFSP SQ in isoform 4. | VSP_003296 | |||||
| Alternative sequence | 402 | 1 | F → M in isoform 5. | VSP_003297 | |||||
| Alternative sequence | 403 – 640 | 238 | Missing in isoform 5. | VSP_003298 | |||||
| Alternative sequence | 567 – 640 | 74 | NILTS…RTLVM → TGVQWHDFGSLQPLPPGFKR FSCLSLPRSWDYRHPPPRPA NFEFLVETGFLHVGQAGLEL LTSGDLPASASQSARITGVS HRARPEYSYKLRFNGTSIRR in isoform 6. | VSP_003299 | |||||
Experimental info | |||||||||
| Sequence conflict | 511 | 1 | I → F in AAA52032. Ref.1 | ||||||
| Sequence conflict | 563 | 1 | A → R in AAA52032. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human c-myb protooncogene: nucleotide sequence of cDNA and organization of the genomic locus." Majello B., Kenyon L.C., Dalla-Favera R. Proc. Natl. Acad. Sci. U.S.A. 83:9636-9640(1986) [PubMed: 3540945] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Alternative splicing of the human c-myb gene." Westin E.H., Gorse K.M., Clarke M.F. Oncogene 5:1117-1124(1990) [PubMed: 2202948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Characterization of the complete sequence structure of the human c-myb gene." Westin E.H., Gorse K.M. Submitted (MAR-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 3; 4; 5 AND 6). Tissue: Liver and Placenta. |
| [4] | Gaillard C., Perbal B. Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [5] | "Identification of alternatively spliced transcripts for human c-myb: molecular cloning and sequence analysis of human c-myb exon 9A sequences." Dasgupta P., Reddy E.P. Oncogene 4:1419-1423(1989) [PubMed: 2687764] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [7] | "Identification of a second promoter in the human c-myb proto-oncogene." Jacobs S.M., Gorse K.M., Westin E.H. Oncogene 9:227-235(1994) [PubMed: 8302584] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 1-47. |
| [8] | "Positive autoregulation of c-myb expression via Myb binding sites in the 5' flanking region of the human c-myb gene." Nicolaides N.C., Gualdi R., Casadevall C., Manzella L., Calabretta B. Mol. Cell. Biol. 11:6166-6176(1991) [PubMed: 1944282] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-7. |
| [9] | "Studies of the human c-myb gene and its product in human acute leukemias." Slamon D.J., Boone T.C., Murdock D.C., Keith D.E., Press M.F., Larson R.A., Souza L.M. Science 233:347-351(1986) [PubMed: 3014652] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 47-640 (ISOFORM 1). |
| [10] | "Transcriptional activation by human c-myb and v-myb genes." Kalkbrenner F., Guehmann S., Moelling K. Oncogene 5:657-661(1990) [PubMed: 2189102] [Abstract] Cited for: TRANSCRIPTION ACTIVATION DOMAIN. |
| [11] | "p53 suppresses the c-Myb-induced activation of heat shock transcription factor 3." Tanikawa J., Ichikawa-Iwata E., Kanei-Ishii C., Nakai A., Matsuzawa S., Reed J.C., Ishii S. J. Biol. Chem. 275:15578-15585(2000) [PubMed: 10747903] [Abstract] Cited for: INTERACTION WITH SIAH1, DEGRADATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| M15024 mRNA. Translation: AAA52032.1. X52125 mRNA. Translation: CAA36371.1. U22376 Genomic DNA. Translation: AAB49034.1. U22376 Genomic DNA. Translation: AAB49035.1. U22376 Genomic DNA. Translation: AAB49036.1. U22376 Genomic DNA. Translation: AAB49037.1. U22376 Genomic DNA. Translation: AAB49038.1. U22376 Genomic DNA. Translation: AAB49039.1. AF104863 mRNA. Translation: AAC96326.1. X17469 mRNA. Translation: CAA35503.1. BC064955 mRNA. Translation: AAH64955.1. M13665 mRNA. Translation: AAA52030.1. M13666 mRNA. Translation: AAA52031.1. Sequence problems. | |
| PIR | TVHUMB. A26661. |
| RefSeq | NP_005366.2. |
| UniGene | Hs.654446 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1MBE based on UniProtKB P06876. |
| SMR | P10242. Positions 39-190. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP:1057N. |
| IntAct | P10242. |
PTM databases | |
| PhosphoSite | P10242. |
Genome annotation databases | |
| Ensembl | ENSG00000118513. Homo sapiens. [Contig view] |
| GeneID | 4602. |
| KEGG | hsa:4602. |
Organism-specific databases | |
| H-InvDB | HIX0032777. |
| HGNC | HGNC:7545. MYB. |
| HPA | CAB017704. |
| MIM | 189990. gene. |
| PharmGKB | PA31345. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOVERGEN | P10242. |
Gene expression databases | |
| ArrayExpress | P10242. |
| CleanEx | HS_MYB. |
| GermOnline | ENSG00000118513. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR015395. C-myb_C. IPR012287. Homeodomain-rel. IPR014778. Myb_DNA-bd. IPR015495. Myb_trans_fac. IPR001005. SANT_DNA-bd. IPR012642. Wos2. [Graphical view] |
| Gene3D | G3DSA:1.10.10.60. Homeodomain-rel. 3 hits. |
| PANTHER | PTHR10641. Myb_transfac. 1 hit. |
| Pfam | PF09316. Cmyb_C. 1 hit. PF00249. Myb_DNA-binding. 3 hits. PF07988. Wos2. 1 hit. [Graphical view] |
| SMART | SM00717. SANT. 3 hits. [Graphical view] |
| PROSITE | PS51294. HTH_MYB. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| LinkHub | P10242. |
| NextBio | 17700. |
| SOURCE | Search... |
Entry information
| Entry name | MYB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P10242 Secondary accession number(s): P78391 Q9UE83 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |

Clusters with


