Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcriptional activator Myb

Gene

MYB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi63 – 86H-T-H motifPROSITE-ProRule annotationAdd BLAST24
DNA bindingi115 – 138H-T-H motifPROSITE-ProRule annotationAdd BLAST24
DNA bindingi166 – 189H-T-H motifPROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

GO - Biological processi

  • chromatin remodeling Source: UniProtKB
  • mitotic cell cycle Source: GO_Central
  • negative regulation of transcription, DNA-templated Source: BHF-UCL
  • negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  • positive regulation of histone H3-K4 methylation Source: UniProtKB
  • positive regulation of histone H3-K9 methylation Source: UniProtKB
  • positive regulation of T-helper cell differentiation Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • regulation of transcription, DNA-templated Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000118513-MONOMER.
ReactomeiR-HSA-983231. Factors involved in megakaryocyte development and platelet production.
SignaLinkiP10242.
SIGNORiP10242.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcriptional activator Myb
Alternative name(s):
Proto-oncogene c-Myb
Gene namesi
Name:MYB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:7545. MYB.

Subcellular locationi

GO - Cellular componenti

  • nuclear matrix Source: UniProtKB
  • nucleus Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNETi4602.
MalaCardsiMYB.
OpenTargetsiENSG00000118513.
Orphaneti86849. Acute basophilic leukemia.
99861. Precursor T-cell acute lymphoblastic leukemia.
PharmGKBiPA31345.

Polymorphism and mutation databases

BioMutaiMYB.
DMDMi2815504.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001970481 – 640Transcriptional activator MybAdd BLAST640

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei471N6-acetyllysineCombined sources1
Modified residuei480N6-acetyllysineCombined sources1
Modified residuei532PhosphoserineCombined sources1
Modified residuei534PhosphothreonineCombined sources1

Post-translational modificationi

Ubiquitinated; mediated by SIAH1 and leading to its subsequent proteasomal degradation.Curated
Phosphorylated by NLK on multiple sites, which induces proteasomal degradation.By similarity
Phosphorylated by HIPK1. This phosphorylation reduces MYB transcription factor activity but not MYB protein levels.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiP10242.
PeptideAtlasiP10242.
PRIDEiP10242.

PTM databases

iPTMnetiP10242.
PhosphoSitePlusiP10242.

Expressioni

Inductioni

Negatively regulated by microRNA-155 (miR-155).1 Publication

Gene expression databases

BgeeiENSG00000118513.
CleanExiHS_MYB.
ExpressionAtlasiP10242. baseline and differential.
GenevisibleiP10242. HS.

Organism-specific databases

HPAiCAB017704.

Interactioni

Subunit structurei

Binds MYBBP1A. Interacts with HIPK2, MAF and NLK (By similarity). Binds to HIPK1.By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CLTCQ006104EBI-298355,EBI-354967
ERC2O150832EBI-298355,EBI-2684336
SUMO1P631653EBI-298355,EBI-80140
SUMO2P619563EBI-298355,EBI-473220
ZFC3H1O602932EBI-298355,EBI-746701

Protein-protein interaction databases

BioGridi110687. 49 interactors.
DIPiDIP-1057N.
IntActiP10242. 34 interactors.
MINTiMINT-6772664.
STRINGi9606.ENSP00000339992.

Structurei

3D structure databases

ProteinModelPortaliP10242.
SMRiP10242.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini35 – 86HTH myb-type 1PROSITE-ProRule annotationAdd BLAST52
Domaini87 – 142HTH myb-type 2PROSITE-ProRule annotationAdd BLAST56
Domaini143 – 193HTH myb-type 3PROSITE-ProRule annotationAdd BLAST51

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni90 – 193Interaction with HIPK2 and NLKBy similarityAdd BLAST104
Regioni275 – 327Transcription activation domain (PubMed:2189102)1 PublicationAdd BLAST53
Regioni328 – 465Negative regulatory domainBy similarityAdd BLAST138
Regioni376 – 397Leucine-zipperAdd BLAST22

Domaini

Comprised of 3 domains; an N-terminal DNA-binding domain, a centrally located transcriptional activation domain and a C-terminal domain involved in transcriptional repression.1 Publication

Sequence similaritiesi

Contains 3 HTH myb-type DNA-binding domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0048. Eukaryota.
COG5147. LUCA.
GeneTreeiENSGT00390000001038.
HOVERGENiHBG007964.
InParanoidiP10242.
KOiK09420.
OMAiPLQPCSG.
OrthoDBiEOG091G0I6P.
PhylomeDBiP10242.
TreeFamiTF326257.

Family and domain databases

Gene3Di1.10.10.60. 3 hits.
InterProiIPR015395. C-myb_C.
IPR009057. Homeodomain-like.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
IPR012642. Tscrpt_reg_Wos2-domain.
[Graphical view]
PfamiPF09316. Cmyb_C. 1 hit.
PF07988. LMSTEN. 1 hit.
PF00249. Myb_DNA-binding. 3 hits.
[Graphical view]
SMARTiSM00717. SANT. 3 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 2 hits.
PROSITEiPS51294. HTH_MYB. 3 hits.
[Graphical view]

Sequences (12)i

Sequence statusi: Complete.

This entry describes 12 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P10242-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MARRPRHSIY SSDEDDEDFE MCDHDYDGLL PKSGKRHLGK TRWTREEDEK
60 70 80 90 100
LKKLVEQNGT DDWKVIANYL PNRTDVQCQH RWQKVLNPEL IKGPWTKEED
110 120 130 140 150
QRVIELVQKY GPKRWSVIAK HLKGRIGKQC RERWHNHLNP EVKKTSWTEE
160 170 180 190 200
EDRIIYQAHK RLGNRWAEIA KLLPGRTDNA IKNHWNSTMR RKVEQEGYLQ
210 220 230 240 250
ESSKASQPAV ATSFQKNSHL MGFAQAPPTA QLPATGQPTV NNDYSYYHIS
260 270 280 290 300
EAQNVSSHVP YPVALHVNIV NVPQPAAAAI QRHYNDEDPE KEKRIKELEL
310 320 330 340 350
LLMSTENELK GQQVLPTQNH TCSYPGWHST TIADHTRPHG DSAPVSCLGE
360 370 380 390 400
HHSTPSLPAD PGSLPEESAS PARCMIVHQG TILDNVKNLL EFAETLQFID
410 420 430 440 450
SFLNTSSNHE NSDLEMPSLT STPLIGHKLT VTTPFHRDQT VKTQKENTVF
460 470 480 490 500
RTPAIKRSIL ESSPRTPTPF KHALAAQEIK YGPLKMLPQT PSHLVEDLQD
510 520 530 540 550
VIKQESDESG IVAEFQENGP PLLKKIKQEV ESPTDKSGNF FCSHHWEGDS
560 570 580 590 600
LNTQLFTQTS PVADAPNILT SSVLMAPASE DEDNVLKAFT VPKNRSLASP
610 620 630 640
LQPCSSTWEP ASCGKMEEQM TSSSQARKYV NAFSARTLVM
Length:640
Mass (Da):72,341
Last modified:November 1, 1997 - v2
Checksum:iFD5E6694020426ED
GO
Isoform 2 (identifier: P10242-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     314-316: Missing.

Show »
Length:637
Mass (Da):72,032
Checksum:i75D8144FEEC381C5
GO
Isoform 3 (identifier: P10242-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     317-350: TQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGE → LCGPLLNSDIFSDWAANWDGSLCFATYIVNQQRQ
     351-640: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:350
Mass (Da):40,620
Checksum:i60632631CFEE51FF
GO
Isoform 4 (identifier: P10242-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-401: S → SDSSSWCDLS...VKSLPFSPSQ

Show »
Length:761
Mass (Da):85,475
Checksum:i9D11661393B1A85B
GO
Isoform 5 (identifier: P10242-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     402-402: F → M
     403-640: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:402
Mass (Da):46,065
Checksum:i331FC406EC1C335C
GO
Isoform 6 (identifier: P10242-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     567-640: NILTSSVLMA...NAFSARTLVM → TGVQWHDFGS...LRFNGTSIRR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:666
Mass (Da):75,526
Checksum:iBF91C8F858EA12DF
GO
Isoform 7 (identifier: P10242-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     314-316: Missing.
     401-401: S → SDSSSWCDLS...VKSLPFSPSQ

Show »
Length:758
Mass (Da):85,166
Checksum:i0F2142F19B9D4E48
GO
Isoform 8 (identifier: P10242-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     386-401: VKNLLEFAETLQFIDS → DSSSWCDLSS...VKSLPFSPSQ

Show »
Length:745
Mass (Da):83,626
Checksum:i9B6C4EBD083ED7CF
GO
Isoform 9 (identifier: P10242-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     282-316: Missing.

Show »
Length:605
Mass (Da):68,135
Checksum:i6078B295869F3BDA
GO
Isoform 10 (identifier: P10242-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     530-566: Missing.

Show »
Length:603
Mass (Da):68,308
Checksum:i560AF3F759C690F1
GO
Isoform 11 (identifier: P10242-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     317-401: Missing.

Show »
Length:555
Mass (Da):63,198
Checksum:iD29BCA8DD3CDA8FE
GO
Isoform 12 (identifier: P10242-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     317-640: TQNHTCSYPG...NAFSARTLVM → VRLSSCA

Note: No experimental confirmation available.
Show »
Length:323
Mass (Da):37,507
Checksum:i52D7B7EA3EDB98E1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti511I → F in AAA52032 (PubMed:3540945).Curated1
Sequence conflicti511I → F in AY787447 (Ref. 6) Curated1
Sequence conflicti511I → F in AY787448 (Ref. 6) Curated1
Sequence conflicti563A → R in AAA52032 (PubMed:3540945).Curated1
Sequence conflicti563A → R in AY787447 (Ref. 6) Curated1
Sequence conflicti563A → R in AY787448 (Ref. 6) Curated1
Isoform 4 (identifier: P10242-4)
Sequence conflicti433L → F in CAA35503 (Ref. 8) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_050188336T → I.Corresponds to variant rs2229999dbSNPEnsembl.1
Natural variantiVAR_050189422T → N.Corresponds to variant rs2230000dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_046658282 – 316Missing in isoform 9. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_003293314 – 316Missing in isoform 2 and isoform 7. 3 Publications3
Alternative sequenceiVSP_053389317 – 640TQNHT…RTLVM → VRLSSCA in isoform 12. 1 PublicationAdd BLAST324
Alternative sequenceiVSP_046659317 – 401Missing in isoform 11. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_003294317 – 350TQNHT…SCLGE → LCGPLLNSDIFSDWAANWDG SLCFATYIVNQQRQ in isoform 3. CuratedAdd BLAST34
Alternative sequenceiVSP_003295351 – 640Missing in isoform 3. CuratedAdd BLAST290
Alternative sequenceiVSP_046660386 – 401VKNLL…QFIDS → DSSSWCDLSSFEFFEEADFS PSQHHTGKALQLQQREGNGT KPAGEPSPRVNKRMLSESSL DPPKVLPPARHSTIPLVILR KKRGQASPLATGDCSSFIFA DVSSSTPKRSPVKSLPFSPS Q in isoform 8. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_003296401S → SDSSSWCDLSSFEFFEEADF SPSQHHTGKALQLQQREGNG TKPAGEPSPRVNKRMLSESS LDPPKVLPPARHSTIPLVIL RKKRGQASPLATGDCSSFIF ADVSSSTPKRSPVKSLPFSP SQ in isoform 4 and isoform 7. 2 Publications1
Alternative sequenceiVSP_003297402F → M in isoform 5. Curated1
Alternative sequenceiVSP_003298403 – 640Missing in isoform 5. CuratedAdd BLAST238
Alternative sequenceiVSP_046661530 – 566Missing in isoform 10. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_003299567 – 640NILTS…RTLVM → TGVQWHDFGSLQPLPPGFKR FSCLSLPRSWDYRHPPPRPA NFEFLVETGFLHVGQAGLEL LTSGDLPASASQSARITGVS HRARPEYSYKLRFNGTSIRR in isoform 6. CuratedAdd BLAST74

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M15024 mRNA. Translation: AAA52032.1.
X52125 mRNA. Translation: CAA36371.1.
AJ606319 mRNA. Translation: CAE55170.1.
AJ606320 mRNA. Translation: CAE55171.1.
AJ616791 mRNA. Translation: CAF04482.1.
AJ616791 mRNA. Translation: CAF04479.1.
U22376 Genomic DNA. Translation: AAB49034.1.
U22376 Genomic DNA. Translation: AAB49035.1.
U22376 Genomic DNA. Translation: AAB49036.1.
U22376 Genomic DNA. Translation: AAB49037.1.
U22376 Genomic DNA. Translation: AAB49038.1.
U22376 Genomic DNA. Translation: AAB49039.1.
AF104863 mRNA. Translation: AAC96326.1.
AY787443 mRNA. No translation available.
AY787447 mRNA. No translation available.
AY787448 mRNA. No translation available.
AY787461 mRNA. No translation available.
AY787468 mRNA. No translation available.
AL023693 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW47969.1.
CH471051 Genomic DNA. Translation: EAW47973.1.
BC064955 mRNA. Translation: AAH64955.1.
M13665 mRNA. Translation: AAA52030.1.
M13666 mRNA. Translation: AAA52031.1.
X17469 mRNA. Translation: CAA35503.1.
CCDSiCCDS47481.1. [P10242-4]
CCDS47482.1. [P10242-2]
CCDS5174.1. [P10242-1]
CCDS55058.1. [P10242-7]
CCDS55059.1. [P10242-8]
CCDS55060.1. [P10242-10]
CCDS55061.1. [P10242-11]
CCDS55062.1. [P10242-9]
PIRiA26661. TVHUMB.
RefSeqiNP_001123644.1. NM_001130172.1. [P10242-2]
NP_001123645.1. NM_001130173.1. [P10242-4]
NP_001155128.1. NM_001161656.1. [P10242-7]
NP_001155129.1. NM_001161657.1. [P10242-11]
NP_001155130.1. NM_001161658.1. [P10242-8]
NP_001155131.1. NM_001161659.1. [P10242-10]
NP_001155132.1. NM_001161660.1. [P10242-9]
NP_005366.2. NM_005375.3. [P10242-1]
UniGeneiHs.606320.
Hs.626299.

Genome annotation databases

EnsembliENST00000341911; ENSP00000339992; ENSG00000118513. [P10242-4]
ENST00000367812; ENSP00000356786; ENSG00000118513. [P10242-6]
ENST00000367814; ENSP00000356788; ENSG00000118513. [P10242-1]
ENST00000442647; ENSP00000410825; ENSG00000118513. [P10242-2]
ENST00000525369; ENSP00000435938; ENSG00000118513. [P10242-11]
ENST00000525477; ENSP00000437081; ENSG00000118513. [P10242-3]
ENST00000525514; ENSP00000435578; ENSG00000118513. [P10242-3]
ENST00000528774; ENSP00000434723; ENSG00000118513. [P10242-7]
ENST00000529586; ENSP00000437264; ENSG00000118513. [P10242-3]
ENST00000533384; ENSP00000432811; ENSG00000118513. [P10242-5]
ENST00000533624; ENSP00000436605; ENSG00000118513. [P10242-9]
ENST00000533808; ENSP00000435293; ENSG00000118513. [P10242-5]
ENST00000533837; ENSP00000434639; ENSG00000118513. [P10242-5]
ENST00000534044; ENSP00000435055; ENSG00000118513. [P10242-10]
ENST00000534121; ENSP00000432851; ENSG00000118513. [P10242-8]
GeneIDi4602.
KEGGihsa:4602.
UCSCiuc003qfh.4. human. [P10242-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M15024 mRNA. Translation: AAA52032.1.
X52125 mRNA. Translation: CAA36371.1.
AJ606319 mRNA. Translation: CAE55170.1.
AJ606320 mRNA. Translation: CAE55171.1.
AJ616791 mRNA. Translation: CAF04482.1.
AJ616791 mRNA. Translation: CAF04479.1.
U22376 Genomic DNA. Translation: AAB49034.1.
U22376 Genomic DNA. Translation: AAB49035.1.
U22376 Genomic DNA. Translation: AAB49036.1.
U22376 Genomic DNA. Translation: AAB49037.1.
U22376 Genomic DNA. Translation: AAB49038.1.
U22376 Genomic DNA. Translation: AAB49039.1.
AF104863 mRNA. Translation: AAC96326.1.
AY787443 mRNA. No translation available.
AY787447 mRNA. No translation available.
AY787448 mRNA. No translation available.
AY787461 mRNA. No translation available.
AY787468 mRNA. No translation available.
AL023693 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW47969.1.
CH471051 Genomic DNA. Translation: EAW47973.1.
BC064955 mRNA. Translation: AAH64955.1.
M13665 mRNA. Translation: AAA52030.1.
M13666 mRNA. Translation: AAA52031.1.
X17469 mRNA. Translation: CAA35503.1.
CCDSiCCDS47481.1. [P10242-4]
CCDS47482.1. [P10242-2]
CCDS5174.1. [P10242-1]
CCDS55058.1. [P10242-7]
CCDS55059.1. [P10242-8]
CCDS55060.1. [P10242-10]
CCDS55061.1. [P10242-11]
CCDS55062.1. [P10242-9]
PIRiA26661. TVHUMB.
RefSeqiNP_001123644.1. NM_001130172.1. [P10242-2]
NP_001123645.1. NM_001130173.1. [P10242-4]
NP_001155128.1. NM_001161656.1. [P10242-7]
NP_001155129.1. NM_001161657.1. [P10242-11]
NP_001155130.1. NM_001161658.1. [P10242-8]
NP_001155131.1. NM_001161659.1. [P10242-10]
NP_001155132.1. NM_001161660.1. [P10242-9]
NP_005366.2. NM_005375.3. [P10242-1]
UniGeneiHs.606320.
Hs.626299.

3D structure databases

ProteinModelPortaliP10242.
SMRiP10242.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110687. 49 interactors.
DIPiDIP-1057N.
IntActiP10242. 34 interactors.
MINTiMINT-6772664.
STRINGi9606.ENSP00000339992.

PTM databases

iPTMnetiP10242.
PhosphoSitePlusiP10242.

Polymorphism and mutation databases

BioMutaiMYB.
DMDMi2815504.

Proteomic databases

PaxDbiP10242.
PeptideAtlasiP10242.
PRIDEiP10242.

Protocols and materials databases

DNASUi4602.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341911; ENSP00000339992; ENSG00000118513. [P10242-4]
ENST00000367812; ENSP00000356786; ENSG00000118513. [P10242-6]
ENST00000367814; ENSP00000356788; ENSG00000118513. [P10242-1]
ENST00000442647; ENSP00000410825; ENSG00000118513. [P10242-2]
ENST00000525369; ENSP00000435938; ENSG00000118513. [P10242-11]
ENST00000525477; ENSP00000437081; ENSG00000118513. [P10242-3]
ENST00000525514; ENSP00000435578; ENSG00000118513. [P10242-3]
ENST00000528774; ENSP00000434723; ENSG00000118513. [P10242-7]
ENST00000529586; ENSP00000437264; ENSG00000118513. [P10242-3]
ENST00000533384; ENSP00000432811; ENSG00000118513. [P10242-5]
ENST00000533624; ENSP00000436605; ENSG00000118513. [P10242-9]
ENST00000533808; ENSP00000435293; ENSG00000118513. [P10242-5]
ENST00000533837; ENSP00000434639; ENSG00000118513. [P10242-5]
ENST00000534044; ENSP00000435055; ENSG00000118513. [P10242-10]
ENST00000534121; ENSP00000432851; ENSG00000118513. [P10242-8]
GeneIDi4602.
KEGGihsa:4602.
UCSCiuc003qfh.4. human. [P10242-1]

Organism-specific databases

CTDi4602.
DisGeNETi4602.
GeneCardsiMYB.
HGNCiHGNC:7545. MYB.
HPAiCAB017704.
MalaCardsiMYB.
MIMi189990. gene.
neXtProtiNX_P10242.
OpenTargetsiENSG00000118513.
Orphaneti86849. Acute basophilic leukemia.
99861. Precursor T-cell acute lymphoblastic leukemia.
PharmGKBiPA31345.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0048. Eukaryota.
COG5147. LUCA.
GeneTreeiENSGT00390000001038.
HOVERGENiHBG007964.
InParanoidiP10242.
KOiK09420.
OMAiPLQPCSG.
OrthoDBiEOG091G0I6P.
PhylomeDBiP10242.
TreeFamiTF326257.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000118513-MONOMER.
ReactomeiR-HSA-983231. Factors involved in megakaryocyte development and platelet production.
SignaLinkiP10242.
SIGNORiP10242.

Miscellaneous databases

ChiTaRSiMYB. human.
GeneWikiiMYB_(gene).
GenomeRNAii4602.
PROiP10242.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000118513.
CleanExiHS_MYB.
ExpressionAtlasiP10242. baseline and differential.
GenevisibleiP10242. HS.

Family and domain databases

Gene3Di1.10.10.60. 3 hits.
InterProiIPR015395. C-myb_C.
IPR009057. Homeodomain-like.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
IPR012642. Tscrpt_reg_Wos2-domain.
[Graphical view]
PfamiPF09316. Cmyb_C. 1 hit.
PF07988. LMSTEN. 1 hit.
PF00249. Myb_DNA-binding. 3 hits.
[Graphical view]
SMARTiSM00717. SANT. 3 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 2 hits.
PROSITEiPS51294. HTH_MYB. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMYB_HUMAN
AccessioniPrimary (citable) accession number: P10242
Secondary accession number(s): E9PI07
, E9PLZ5, E9PNA4, E9PNL6, E9PRS2, P78391, P78392, P78525, P78526, Q14023, Q14024, Q708E4, Q708E7, Q9UE83
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: November 1, 1997
Last modified: November 30, 2016
This is version 174 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.