P10242 (MYB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 139.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transcriptional activator Myb Alternative name(s): Proto-oncogene c-Myb | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 640 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells. |
| Subunit structure | Binds MYBBP1A. Interacts with HIPK2, MAF and NLK By similarity. Binds to HIPK1. Ref.15 Ref.16 |
| Subcellular location | |
| Domain | Comprised of 3 domains; an N-terminal DNA-binding domain, a centrally located transcriptional activation domain and a C-terminal domain involved in transcriptional repression. Ref.14 |
| Post-translational modification | Ubiquitinated; mediated by SIAH1 and leading to its subsequent proteasomal degradation Probable. Ref.15 Phosphorylated by NLK on multiple sites, which induces proteasomal degradation By similarity. Ref.16 Phosphorylated by HIPK1. This phosphorylation reduces MYB transcription factor activity but not MYB protein levels. Ref.16 |
| Sequence similarities | Contains 3 HTH myb-type DNA-binding domains. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ERC2 | O15083 | 2 | EBI-298355,EBI-2684336 | |
| SUMO1 | P63165 | 3 | EBI-298355,EBI-80140 | |
| SUMO2 | P61956 | 3 | EBI-298355,EBI-473220 | |
| ZFC3H1 | O60293 | 2 | EBI-298355,EBI-746701 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P10242-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P10242-2) The sequence of this isoform differs from the canonical sequence as follows: 314-316: Missing. | ||||||
| Isoform 3 (identifier: P10242-3) The sequence of this isoform differs from the canonical sequence as follows: 317-350: TQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGE → LCGPLLNSDIFSDWAANWDGSLCFATYIVNQQRQ 351-640: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: P10242-4) The sequence of this isoform differs from the canonical sequence as follows: 401-401: S → SDSSSWCDLS...VKSLPFSPSQ | ||||||
| Isoform 5 (identifier: P10242-5) The sequence of this isoform differs from the canonical sequence as follows: 402-402: F → M 403-640: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 6 (identifier: P10242-6) The sequence of this isoform differs from the canonical sequence as follows: 567-640: NILTSSVLMA...NAFSARTLVM → TGVQWHDFGS...LRFNGTSIRR | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 7 (identifier: P10242-7) The sequence of this isoform differs from the canonical sequence as follows: 314-316: Missing. 401-401: S → SDSSSWCDLS...VKSLPFSPSQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 640 | 640 | Transcriptional activator Myb | PRO_0000197048 | |||||
Regions | |||||||||
| Domain | 35 – 86 | 52 | HTH myb-type 1 | ||||||
| Domain | 87 – 142 | 56 | HTH myb-type 2 | ||||||
| Domain | 143 – 193 | 51 | HTH myb-type 3 | ||||||
| DNA binding | 63 – 86 | 24 | H-T-H motif By similarity | ||||||
| DNA binding | 115 – 138 | 24 | H-T-H motif By similarity | ||||||
| DNA binding | 166 – 189 | 24 | H-T-H motif By similarity | ||||||
| Region | 90 – 193 | 104 | Interaction with HIPK2 and NLK By similarity | ||||||
| Region | 275 – 327 | 53 | Transcriptional activation domain | ||||||
| Region | 328 – 465 | 138 | Negative regulatory domain By similarity | ||||||
| Region | 376 – 397 | 22 | Leucine-zipper | ||||||
Amino acid modifications | |||||||||
| Modified residue | 471 | 1 | N6-acetyllysine Ref.17 | ||||||
| Modified residue | 480 | 1 | N6-acetyllysine Ref.17 | ||||||
Natural variations | |||||||||
| Alternative sequence | 314 – 316 | 3 | Missing in isoform 2 and isoform 7. | VSP_003293 | |||||
| Alternative sequence | 317 – 350 | 34 | TQNHT…SCLGE → LCGPLLNSDIFSDWAANWDG SLCFATYIVNQQRQ in isoform 3. | VSP_003294 | |||||
| Alternative sequence | 351 – 640 | 290 | Missing in isoform 3. | VSP_003295 | |||||
| Alternative sequence | 401 | 1 | S → SDSSSWCDLSSFEFFEEADF SPSQHHTGKALQLQQREGNG TKPAGEPSPRVNKRMLSESS LDPPKVLPPARHSTIPLVIL RKKRGQASPLATGDCSSFIF ADVSSSTPKRSPVKSLPFSP SQ in isoform 4 and isoform 7. | VSP_003296 | |||||
| Alternative sequence | 402 | 1 | F → M in isoform 5. | VSP_003297 | |||||
| Alternative sequence | 403 – 640 | 238 | Missing in isoform 5. | VSP_003298 | |||||
| Alternative sequence | 567 – 640 | 74 | NILTS…RTLVM → TGVQWHDFGSLQPLPPGFKR FSCLSLPRSWDYRHPPPRPA NFEFLVETGFLHVGQAGLEL LTSGDLPASASQSARITGVS HRARPEYSYKLRFNGTSIRR in isoform 6. | VSP_003299 | |||||
| Natural variant | 336 | 1 | T → I. Corresponds to variant rs2229999 [ dbSNP | Ensembl ]. | VAR_050188 | |||||
| Natural variant | 422 | 1 | T → N. Corresponds to variant rs2230000 [ dbSNP | Ensembl ]. | VAR_050189 | |||||
Experimental info | |||||||||
| Sequence conflict | 511 | 1 | I → F in AAA52032. Ref.1 | ||||||
| Sequence conflict | 563 | 1 | A → R in AAA52032. Ref.1 | ||||||
| Isoform 4: | |||||||||
| Sequence conflict | 433 | 1 | L → F in CAA35503. Ref.8 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human c-myb protooncogene: nucleotide sequence of cDNA and organization of the genomic locus." Majello B., Kenyon L.C., Dalla-Favera R. Proc. Natl. Acad. Sci. U.S.A. 83:9636-9640(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Alternative splicing of the human c-myb gene." Westin E.H., Gorse K.M., Clarke M.F. Oncogene 5:1117-1124(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Genome annotation of a 1.5 Mb region of human chromosome 6q23 encompassing a quantitative trait locus for fetal hemoglobin expression in adults." Close J.P., Game L., Clark B., Bergounioux J., Gerovassili A., Thein S.L. BMC Genomics 5:33-33(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4). |
| [4] | "Characterization of the complete sequence structure of the human c-myb gene." Westin E.H., Gorse K.M. Submitted (MAR-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 3; 4; 5 AND 6). Tissue: Liver and Placenta. |
| [5] | Gaillard C., Perbal B. Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [6] | "Complex RNA splicing produces multiple forms of c-Myb with distinct transcriptional activities." O'Rourke J.P. Jr., Ness S.A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7), ALTERNATIVE SPLICING. |
| [7] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [10] | "Identification of a second promoter in the human c-myb proto-oncogene." Jacobs S.M., Gorse K.M., Westin E.H. Oncogene 9:227-235(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 1-47. |
| [11] | "Positive autoregulation of c-myb expression via Myb binding sites in the 5' flanking region of the human c-myb gene." Nicolaides N.C., Gualdi R., Casadevall C., Manzella L., Calabretta B. Mol. Cell. Biol. 11:6166-6176(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-7. |
| [12] | "Studies of the human c-myb gene and its product in human acute leukemias." Slamon D.J., Boone T.C., Murdock D.C., Keith D.E., Press M.F., Larson R.A., Souza L.M. Science 233:347-351(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 47-640 (ISOFORM 1). |
| [13] | "Identification of alternatively spliced transcripts for human c-myb: molecular cloning and sequence analysis of human c-myb exon 9A sequences." Dasgupta P., Reddy E.P. Oncogene 4:1419-1423(1989) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [14] | "Transcriptional activation by human c-myb and v-myb genes." Kalkbrenner F., Guehmann S., Moelling K. Oncogene 5:657-661(1990) [PubMed] [Europe PMC] [Abstract] Cited for: TRANSCRIPTION ACTIVATION DOMAIN. |
| [15] | "p53 suppresses the c-Myb-induced activation of heat shock transcription factor 3." Tanikawa J., Ichikawa-Iwata E., Kanei-Ishii C., Nakai A., Matsuzawa S., Reed J.C., Ishii S. J. Biol. Chem. 275:15578-15585(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SIAH1, DEGRADATION. |
| [16] | "HIPK1 interacts with c-Myb and modulates its activity through phosphorylation." Matre V., Nordgaard O., Alm-Kristiansen A.H., Ledsaak M., Gabrielsen O.S. Biochem. Biophys. Res. Commun. 388:150-154(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION BY HIPK1, INTERACTION WITH HIPK1, SUBCELLULAR LOCATION. |
| [17] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-471 AND LYS-480, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M15024 mRNA. Translation: AAA52032.1. X52125 mRNA. Translation: CAA36371.1. AJ606319 mRNA. Translation: CAE55170.1. AJ606320 mRNA. Translation: CAE55171.1. AJ616791 mRNA. Translation: CAF04482.1. AJ616791 mRNA. Translation: CAF04479.1. U22376 Genomic DNA. Translation: AAB49034.1. U22376 Genomic DNA. Translation: AAB49035.1. U22376 Genomic DNA. Translation: AAB49036.1. U22376 Genomic DNA. Translation: AAB49037.1. U22376 Genomic DNA. Translation: AAB49038.1. U22376 Genomic DNA. Translation: AAB49039.1. AF104863 mRNA. Translation: AAC96326.1. AY787461 mRNA. No translation available. AL023693 Genomic DNA. No translation available. CH471051 Genomic DNA. Translation: EAW47969.1. CH471051 Genomic DNA. Translation: EAW47973.1. BC064955 mRNA. Translation: AAH64955.1. M13665 mRNA. Translation: AAA52030.1. M13666 mRNA. Translation: AAA52031.1. Sequence problems. X17469 mRNA. Translation: CAA35503.1. |
| IPI | IPI00219496. IPI00219497. IPI00420046. IPI00471985. IPI00749442. IPI00930645. IPI00983514. |
| PIR | TVHUMB. A26661. |
| RefSeq | NP_001123644.1. NM_001130172.1. NP_001123645.1. NM_001130173.1. NP_001155128.1. NM_001161656.1. NP_005366.2. NM_005375.2. |
| UniGene | Hs.606320. |
3D structure databases | |
| ProteinModelPortal | P10242. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-1057N. |
| IntAct | P10242. 28 interactions. |
| MINT | MINT-6772664. |
| STRING | 9606.ENSP00000339992. |
PTM databases | |
| PhosphoSite | P10242. |
Polymorphism databases | |
| DMDM | 2815504. |
Proteomic databases | |
| PaxDb | P10242. |
| PRIDE | P10242. |
Protocols and materials databases | |
| DNASU | 4602. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000341911; ENSP00000339992; ENSG00000118513. ENST00000367812; ENSP00000356786; ENSG00000118513. ENST00000367814; ENSP00000356788; ENSG00000118513. ENST00000430686; ENSP00000390460; ENSG00000118513. ENST00000442647; ENSP00000410825; ENSG00000118513. ENST00000525477; ENSP00000437081; ENSG00000118513. ENST00000525514; ENSP00000435578; ENSG00000118513. ENST00000528774; ENSP00000434723; ENSG00000118513. ENST00000529586; ENSP00000437264; ENSG00000118513. ENST00000533384; ENSP00000432811; ENSG00000118513. ENST00000533808; ENSP00000435293; ENSG00000118513. ENST00000533837; ENSP00000434639; ENSG00000118513. |
| GeneID | 4602. |
| KEGG | hsa:4602. |
| UCSC | uc003qfc.3. human. uc003qfh.3. human. uc003qfu.3. human. |
Organism-specific databases | |
| CTD | 4602. |
| GeneCards | GC06P135503. |
| HGNC | HGNC:7545. MYB. |
| HPA | CAB017704. |
| MIM | 189990. gene. |
| neXtProt | NX_P10242. |
| Orphanet | 86849. Acute basophilic leukemia. 99861. Precursor T-cell acute lymphoblastic leukemia. |
| PharmGKB | PA31345. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5147. |
| HOVERGEN | HBG007964. |
| KO | K09420. |
| OMA | HLMGFAH. |
| OrthoDB | EOG4H9XKD. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | il2_pi3kpathway. IL2 signaling events mediated by PI3K. il4_2pathway. IL4-mediated signaling events. |
| Reactome | REACT_604. Hemostasis. |
Gene expression databases | |
| ArrayExpress | P10242. |
| Bgee | P10242. |
| CleanEx | HS_MYB. |
| Genevestigator | P10242. |
| GermOnline | ENSG00000118513. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.10.60. 3 hits. |
| InterPro | IPR015395. C-myb_C. IPR009057. Homeodomain-like. IPR017930. Myb_dom. IPR001005. SANT/Myb. IPR012642. Tscrpt_reg_Wos2-domain. [Graphical view] |
| Pfam | PF09316. Cmyb_C. 1 hit. PF07988. LMSTEN. 1 hit. PF00249. Myb_DNA-binding. 1 hit. [Graphical view] |
| SMART | SM00717. SANT. 3 hits. [Graphical view] |
| SUPFAM | SSF46689. Homeodomain_like. 2 hits. |
| PROSITE | PS51294. HTH_MYB. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MYB. human. |
| GenomeRNAi | 4602. |
| NextBio | 17700. |
| SOURCE | Search... |
Entry information
| Entry name | MYB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P10242 Secondary accession number(s): E9PNL6 Q9UE83 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
