SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P10242

- MYB_HUMAN

UniProt

P10242 - MYB_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Transcriptional activator Myb
Gene
MYB
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi63 – 8624H-T-H motif By similarity
Add
BLAST
DNA bindingi115 – 13824H-T-H motif By similarity
Add
BLAST
DNA bindingi166 – 18924H-T-H motif By similarity
Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. chromatin binding Source: InterPro
  3. protein binding Source: UniProtKB
  4. sequence-specific DNA binding transcription factor activity Source: Ensembl

GO - Biological processi

  1. B cell differentiation Source: Ensembl
  2. G1/S transition of mitotic cell cycle Source: Ensembl
  3. blood coagulation Source: Reactome
  4. calcium ion transport Source: Ensembl
  5. chromatin remodeling Source: UniProtKB
  6. embryonic digestive tract development Source: Ensembl
  7. homeostasis of number of cells Source: Ensembl
  8. in utero embryonic development Source: Ensembl
  9. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  10. negative regulation of transcription, DNA-templated Source: BHF-UCL
  11. positive regulation of T-helper cell differentiation Source: UniProtKB
  12. positive regulation of histone H3-K4 methylation Source: UniProtKB
  13. positive regulation of histone H3-K9 methylation Source: UniProtKB
  14. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  15. positive regulation of transcription, DNA-templated Source: UniProtKB
  16. regulation of transcription, DNA-templated Source: UniProtKB
  17. thymus development Source: Ensembl
  18. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiREACT_24970. Factors involved in megakaryocyte development and platelet production.
SignaLinkiP10242.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcriptional activator Myb
Alternative name(s):
Proto-oncogene c-Myb
Gene namesi
Name:MYB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:7545. MYB.

Subcellular locationi

Nucleus 1 Publication

GO - Cellular componenti

  1. nuclear matrix Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

Orphaneti86849. Acute basophilic leukemia.
99861. Precursor T-cell acute lymphoblastic leukemia.
PharmGKBiPA31345.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 640640Transcriptional activator Myb
PRO_0000197048Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei471 – 4711N6-acetyllysine1 Publication
Modified residuei480 – 4801N6-acetyllysine1 Publication

Post-translational modificationi

Ubiquitinated; mediated by SIAH1 and leading to its subsequent proteasomal degradation Inferred.1 Publication
Phosphorylated by NLK on multiple sites, which induces proteasomal degradation By similarity.1 Publication
Phosphorylated by HIPK1. This phosphorylation reduces MYB transcription factor activity but not MYB protein levels.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiP10242.
PaxDbiP10242.
PRIDEiP10242.

PTM databases

PhosphoSiteiP10242.

Expressioni

Inductioni

Negatively regulated by microRNA-155 (miR-155).1 Publication

Gene expression databases

ArrayExpressiP10242.
BgeeiP10242.
CleanExiHS_MYB.
GenevestigatoriP10242.

Organism-specific databases

HPAiCAB017704.

Interactioni

Subunit structurei

Binds MYBBP1A. Interacts with HIPK2, MAF and NLK By similarity. Binds to HIPK1.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CLTCQ006104EBI-298355,EBI-354967
ERC2O150832EBI-298355,EBI-2684336
SUMO1P631653EBI-298355,EBI-80140
SUMO2P619563EBI-298355,EBI-473220
ZFC3H1O602932EBI-298355,EBI-746701

Protein-protein interaction databases

BioGridi110687. 50 interactions.
DIPiDIP-1057N.
IntActiP10242. 33 interactions.
MINTiMINT-6772664.
STRINGi9606.ENSP00000339992.

Structurei

3D structure databases

ProteinModelPortaliP10242.
SMRiP10242. Positions 38-193.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 8652HTH myb-type 1
Add
BLAST
Domaini87 – 14256HTH myb-type 2
Add
BLAST
Domaini143 – 19351HTH myb-type 3
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni90 – 193104Interaction with HIPK2 and NLK By similarity
Add
BLAST
Regioni275 – 32753Transcription activation domain (PubMed:2189102)
Add
BLAST
Regioni328 – 465138Negative regulatory domain By similarity
Add
BLAST
Regioni376 – 39722Leucine-zipper
Add
BLAST

Domaini

Comprised of 3 domains; an N-terminal DNA-binding domain, a centrally located transcriptional activation domain and a C-terminal domain involved in transcriptional repression (1 Publication).1 Publication

Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiCOG5147.
HOVERGENiHBG007964.
KOiK09420.
OMAiHGCLPEE.
OrthoDBiEOG7H791P.
PhylomeDBiP10242.
TreeFamiTF326257.

Family and domain databases

Gene3Di1.10.10.60. 3 hits.
InterProiIPR015395. C-myb_C.
IPR009057. Homeodomain-like.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
IPR012642. Tscrpt_reg_Wos2-domain.
[Graphical view]
PfamiPF09316. Cmyb_C. 1 hit.
PF07988. LMSTEN. 1 hit.
PF00249. Myb_DNA-binding. 1 hit.
[Graphical view]
SMARTiSM00717. SANT. 3 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 2 hits.
PROSITEiPS51294. HTH_MYB. 3 hits.
[Graphical view]

Sequences (12)i

Sequence statusi: Complete.

This entry describes 12 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P10242-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MARRPRHSIY SSDEDDEDFE MCDHDYDGLL PKSGKRHLGK TRWTREEDEK    50
LKKLVEQNGT DDWKVIANYL PNRTDVQCQH RWQKVLNPEL IKGPWTKEED 100
QRVIELVQKY GPKRWSVIAK HLKGRIGKQC RERWHNHLNP EVKKTSWTEE 150
EDRIIYQAHK RLGNRWAEIA KLLPGRTDNA IKNHWNSTMR RKVEQEGYLQ 200
ESSKASQPAV ATSFQKNSHL MGFAQAPPTA QLPATGQPTV NNDYSYYHIS 250
EAQNVSSHVP YPVALHVNIV NVPQPAAAAI QRHYNDEDPE KEKRIKELEL 300
LLMSTENELK GQQVLPTQNH TCSYPGWHST TIADHTRPHG DSAPVSCLGE 350
HHSTPSLPAD PGSLPEESAS PARCMIVHQG TILDNVKNLL EFAETLQFID 400
SFLNTSSNHE NSDLEMPSLT STPLIGHKLT VTTPFHRDQT VKTQKENTVF 450
RTPAIKRSIL ESSPRTPTPF KHALAAQEIK YGPLKMLPQT PSHLVEDLQD 500
VIKQESDESG IVAEFQENGP PLLKKIKQEV ESPTDKSGNF FCSHHWEGDS 550
LNTQLFTQTS PVADAPNILT SSVLMAPASE DEDNVLKAFT VPKNRSLASP 600
LQPCSSTWEP ASCGKMEEQM TSSSQARKYV NAFSARTLVM 640
Length:640
Mass (Da):72,341
Last modified:November 1, 1997 - v2
Checksum:iFD5E6694020426ED
GO
Isoform 2 (identifier: P10242-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     314-316: Missing.

Show »
Length:637
Mass (Da):72,032
Checksum:i75D8144FEEC381C5
GO
Isoform 3 (identifier: P10242-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     317-350: TQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGE → LCGPLLNSDIFSDWAANWDGSLCFATYIVNQQRQ
     351-640: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:350
Mass (Da):40,620
Checksum:i60632631CFEE51FF
GO
Isoform 4 (identifier: P10242-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-401: S → SDSSSWCDLS...VKSLPFSPSQ

Show »
Length:761
Mass (Da):85,475
Checksum:i9D11661393B1A85B
GO
Isoform 5 (identifier: P10242-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     402-402: F → M
     403-640: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:402
Mass (Da):46,065
Checksum:i331FC406EC1C335C
GO
Isoform 6 (identifier: P10242-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     567-640: NILTSSVLMA...NAFSARTLVM → TGVQWHDFGS...LRFNGTSIRR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:666
Mass (Da):75,526
Checksum:iBF91C8F858EA12DF
GO
Isoform 7 (identifier: P10242-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     314-316: Missing.
     401-401: S → SDSSSWCDLS...VKSLPFSPSQ

Show »
Length:758
Mass (Da):85,166
Checksum:i0F2142F19B9D4E48
GO
Isoform 8 (identifier: P10242-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     386-401: VKNLLEFAETLQFIDS → DSSSWCDLSS...VKSLPFSPSQ

Show »
Length:745
Mass (Da):83,626
Checksum:i9B6C4EBD083ED7CF
GO
Isoform 9 (identifier: P10242-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     282-316: Missing.

Show »
Length:605
Mass (Da):68,135
Checksum:i6078B295869F3BDA
GO
Isoform 10 (identifier: P10242-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     530-566: Missing.

Show »
Length:603
Mass (Da):68,308
Checksum:i560AF3F759C690F1
GO
Isoform 11 (identifier: P10242-11) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     317-401: Missing.

Show »
Length:555
Mass (Da):63,198
Checksum:iD29BCA8DD3CDA8FE
GO
Isoform 12 (identifier: P10242-12) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     317-640: TQNHTCSYPG...NAFSARTLVM → VRLSSCA

Note: No experimental confirmation available.

Show »
Length:323
Mass (Da):37,507
Checksum:i52D7B7EA3EDB98E1
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti336 – 3361T → I.
Corresponds to variant rs2229999 [ dbSNP | Ensembl ].
VAR_050188
Natural varianti422 – 4221T → N.
Corresponds to variant rs2230000 [ dbSNP | Ensembl ].
VAR_050189

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei282 – 31635Missing in isoform 9.
VSP_046658Add
BLAST
Alternative sequencei314 – 3163Missing in isoform 2 and isoform 7.
VSP_003293
Alternative sequencei317 – 640324TQNHT…RTLVM → VRLSSCA in isoform 12.
VSP_053389Add
BLAST
Alternative sequencei317 – 40185Missing in isoform 11.
VSP_046659Add
BLAST
Alternative sequencei317 – 35034TQNHT…SCLGE → LCGPLLNSDIFSDWAANWDG SLCFATYIVNQQRQ in isoform 3.
VSP_003294Add
BLAST
Alternative sequencei351 – 640290Missing in isoform 3.
VSP_003295Add
BLAST
Alternative sequencei386 – 40116VKNLL…QFIDS → DSSSWCDLSSFEFFEEADFS PSQHHTGKALQLQQREGNGT KPAGEPSPRVNKRMLSESSL DPPKVLPPARHSTIPLVILR KKRGQASPLATGDCSSFIFA DVSSSTPKRSPVKSLPFSPS Q in isoform 8.
VSP_046660Add
BLAST
Alternative sequencei401 – 4011S → SDSSSWCDLSSFEFFEEADF SPSQHHTGKALQLQQREGNG TKPAGEPSPRVNKRMLSESS LDPPKVLPPARHSTIPLVIL RKKRGQASPLATGDCSSFIF ADVSSSTPKRSPVKSLPFSP SQ in isoform 4 and isoform 7.
VSP_003296
Alternative sequencei402 – 4021F → M in isoform 5.
VSP_003297
Alternative sequencei403 – 640238Missing in isoform 5.
VSP_003298Add
BLAST
Alternative sequencei530 – 56637Missing in isoform 10.
VSP_046661Add
BLAST
Alternative sequencei567 – 64074NILTS…RTLVM → TGVQWHDFGSLQPLPPGFKR FSCLSLPRSWDYRHPPPRPA NFEFLVETGFLHVGQAGLEL LTSGDLPASASQSARITGVS HRARPEYSYKLRFNGTSIRR in isoform 6.
VSP_003299Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti511 – 5111I → F in AAA52032. 1 Publication
Sequence conflicti511 – 5111I → F in AY787447. 1 Publication
Sequence conflicti511 – 5111I → F in AY787448. 1 Publication
Sequence conflicti563 – 5631A → R in AAA52032. 1 Publication
Sequence conflicti563 – 5631A → R in AY787447. 1 Publication
Sequence conflicti563 – 5631A → R in AY787448. 1 Publication
Isoform 4 (identifier: P10242-4)
Sequence conflicti433 – 4331L → F in CAA35503. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M15024 mRNA. Translation: AAA52032.1.
X52125 mRNA. Translation: CAA36371.1.
AJ606319 mRNA. Translation: CAE55170.1.
AJ606320 mRNA. Translation: CAE55171.1.
AJ616791 mRNA. Translation: CAF04482.1.
AJ616791 mRNA. Translation: CAF04479.1.
U22376 Genomic DNA. Translation: AAB49034.1.
U22376 Genomic DNA. Translation: AAB49035.1.
U22376 Genomic DNA. Translation: AAB49036.1.
U22376 Genomic DNA. Translation: AAB49037.1.
U22376 Genomic DNA. Translation: AAB49038.1.
U22376 Genomic DNA. Translation: AAB49039.1.
AF104863 mRNA. Translation: AAC96326.1.
AY787443 mRNA. No translation available.
AY787447 mRNA. No translation available.
AY787448 mRNA. No translation available.
AY787461 mRNA. No translation available.
AY787468 mRNA. No translation available.
AL023693 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW47969.1.
CH471051 Genomic DNA. Translation: EAW47973.1.
BC064955 mRNA. Translation: AAH64955.1.
M13665 mRNA. Translation: AAA52030.1.
M13666 mRNA. Translation: AAA52031.1.
X17469 mRNA. Translation: CAA35503.1.
CCDSiCCDS47481.1. [P10242-4]
CCDS47482.1. [P10242-2]
CCDS5174.1. [P10242-1]
CCDS55058.1. [P10242-7]
CCDS55059.1. [P10242-8]
CCDS55060.1. [P10242-10]
CCDS55061.1. [P10242-11]
CCDS55062.1. [P10242-9]
PIRiA26661. TVHUMB.
RefSeqiNP_001123644.1. NM_001130172.1. [P10242-2]
NP_001123645.1. NM_001130173.1. [P10242-4]
NP_001155128.1. NM_001161656.1. [P10242-7]
NP_001155129.1. NM_001161657.1. [P10242-11]
NP_001155130.1. NM_001161658.1. [P10242-8]
NP_001155131.1. NM_001161659.1. [P10242-10]
NP_001155132.1. NM_001161660.1. [P10242-9]
NP_005366.2. NM_005375.2. [P10242-1]
XP_006715558.1. XM_006715495.1.
UniGeneiHs.606320.

Genome annotation databases

EnsembliENST00000341911; ENSP00000339992; ENSG00000118513. [P10242-4]
ENST00000367812; ENSP00000356786; ENSG00000118513. [P10242-6]
ENST00000367814; ENSP00000356788; ENSG00000118513. [P10242-1]
ENST00000430686; ENSP00000390460; ENSG00000118513.
ENST00000442647; ENSP00000410825; ENSG00000118513. [P10242-2]
ENST00000525369; ENSP00000435938; ENSG00000118513. [P10242-11]
ENST00000525477; ENSP00000437081; ENSG00000118513. [P10242-3]
ENST00000525514; ENSP00000435578; ENSG00000118513. [P10242-3]
ENST00000528774; ENSP00000434723; ENSG00000118513. [P10242-7]
ENST00000529586; ENSP00000437264; ENSG00000118513. [P10242-3]
ENST00000533384; ENSP00000432811; ENSG00000118513. [P10242-5]
ENST00000533624; ENSP00000436605; ENSG00000118513. [P10242-9]
ENST00000533808; ENSP00000435293; ENSG00000118513. [P10242-5]
ENST00000533837; ENSP00000434639; ENSG00000118513. [P10242-5]
ENST00000534044; ENSP00000435055; ENSG00000118513. [P10242-10]
ENST00000534121; ENSP00000432851; ENSG00000118513. [P10242-8]
GeneIDi4602.
KEGGihsa:4602.
UCSCiuc003qfc.3. human. [P10242-1]
uc003qfh.3. human. [P10242-4]
uc003qfu.3. human. [P10242-2]

Polymorphism databases

DMDMi2815504.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M15024 mRNA. Translation: AAA52032.1 .
X52125 mRNA. Translation: CAA36371.1 .
AJ606319 mRNA. Translation: CAE55170.1 .
AJ606320 mRNA. Translation: CAE55171.1 .
AJ616791 mRNA. Translation: CAF04482.1 .
AJ616791 mRNA. Translation: CAF04479.1 .
U22376 Genomic DNA. Translation: AAB49034.1 .
U22376 Genomic DNA. Translation: AAB49035.1 .
U22376 Genomic DNA. Translation: AAB49036.1 .
U22376 Genomic DNA. Translation: AAB49037.1 .
U22376 Genomic DNA. Translation: AAB49038.1 .
U22376 Genomic DNA. Translation: AAB49039.1 .
AF104863 mRNA. Translation: AAC96326.1 .
AY787443 mRNA. No translation available.
AY787447 mRNA. No translation available.
AY787448 mRNA. No translation available.
AY787461 mRNA. No translation available.
AY787468 mRNA. No translation available.
AL023693 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW47969.1 .
CH471051 Genomic DNA. Translation: EAW47973.1 .
BC064955 mRNA. Translation: AAH64955.1 .
M13665 mRNA. Translation: AAA52030.1 .
M13666 mRNA. Translation: AAA52031.1 .
X17469 mRNA. Translation: CAA35503.1 .
CCDSi CCDS47481.1. [P10242-4 ]
CCDS47482.1. [P10242-2 ]
CCDS5174.1. [P10242-1 ]
CCDS55058.1. [P10242-7 ]
CCDS55059.1. [P10242-8 ]
CCDS55060.1. [P10242-10 ]
CCDS55061.1. [P10242-11 ]
CCDS55062.1. [P10242-9 ]
PIRi A26661. TVHUMB.
RefSeqi NP_001123644.1. NM_001130172.1. [P10242-2 ]
NP_001123645.1. NM_001130173.1. [P10242-4 ]
NP_001155128.1. NM_001161656.1. [P10242-7 ]
NP_001155129.1. NM_001161657.1. [P10242-11 ]
NP_001155130.1. NM_001161658.1. [P10242-8 ]
NP_001155131.1. NM_001161659.1. [P10242-10 ]
NP_001155132.1. NM_001161660.1. [P10242-9 ]
NP_005366.2. NM_005375.2. [P10242-1 ]
XP_006715558.1. XM_006715495.1.
UniGenei Hs.606320.

3D structure databases

ProteinModelPortali P10242.
SMRi P10242. Positions 38-193.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110687. 50 interactions.
DIPi DIP-1057N.
IntActi P10242. 33 interactions.
MINTi MINT-6772664.
STRINGi 9606.ENSP00000339992.

PTM databases

PhosphoSitei P10242.

Polymorphism databases

DMDMi 2815504.

Proteomic databases

MaxQBi P10242.
PaxDbi P10242.
PRIDEi P10242.

Protocols and materials databases

DNASUi 4602.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000341911 ; ENSP00000339992 ; ENSG00000118513 . [P10242-4 ]
ENST00000367812 ; ENSP00000356786 ; ENSG00000118513 . [P10242-6 ]
ENST00000367814 ; ENSP00000356788 ; ENSG00000118513 . [P10242-1 ]
ENST00000430686 ; ENSP00000390460 ; ENSG00000118513 .
ENST00000442647 ; ENSP00000410825 ; ENSG00000118513 . [P10242-2 ]
ENST00000525369 ; ENSP00000435938 ; ENSG00000118513 . [P10242-11 ]
ENST00000525477 ; ENSP00000437081 ; ENSG00000118513 . [P10242-3 ]
ENST00000525514 ; ENSP00000435578 ; ENSG00000118513 . [P10242-3 ]
ENST00000528774 ; ENSP00000434723 ; ENSG00000118513 . [P10242-7 ]
ENST00000529586 ; ENSP00000437264 ; ENSG00000118513 . [P10242-3 ]
ENST00000533384 ; ENSP00000432811 ; ENSG00000118513 . [P10242-5 ]
ENST00000533624 ; ENSP00000436605 ; ENSG00000118513 . [P10242-9 ]
ENST00000533808 ; ENSP00000435293 ; ENSG00000118513 . [P10242-5 ]
ENST00000533837 ; ENSP00000434639 ; ENSG00000118513 . [P10242-5 ]
ENST00000534044 ; ENSP00000435055 ; ENSG00000118513 . [P10242-10 ]
ENST00000534121 ; ENSP00000432851 ; ENSG00000118513 . [P10242-8 ]
GeneIDi 4602.
KEGGi hsa:4602.
UCSCi uc003qfc.3. human. [P10242-1 ]
uc003qfh.3. human. [P10242-4 ]
uc003qfu.3. human. [P10242-2 ]

Organism-specific databases

CTDi 4602.
GeneCardsi GC06P135503.
HGNCi HGNC:7545. MYB.
HPAi CAB017704.
MIMi 189990. gene.
neXtProti NX_P10242.
Orphaneti 86849. Acute basophilic leukemia.
99861. Precursor T-cell acute lymphoblastic leukemia.
PharmGKBi PA31345.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5147.
HOVERGENi HBG007964.
KOi K09420.
OMAi HGCLPEE.
OrthoDBi EOG7H791P.
PhylomeDBi P10242.
TreeFami TF326257.

Enzyme and pathway databases

Reactomei REACT_24970. Factors involved in megakaryocyte development and platelet production.
SignaLinki P10242.

Miscellaneous databases

ChiTaRSi MYB. human.
GeneWikii MYB_(gene).
GenomeRNAii 4602.
NextBioi 17700.
PROi P10242.
SOURCEi Search...

Gene expression databases

ArrayExpressi P10242.
Bgeei P10242.
CleanExi HS_MYB.
Genevestigatori P10242.

Family and domain databases

Gene3Di 1.10.10.60. 3 hits.
InterProi IPR015395. C-myb_C.
IPR009057. Homeodomain-like.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
IPR012642. Tscrpt_reg_Wos2-domain.
[Graphical view ]
Pfami PF09316. Cmyb_C. 1 hit.
PF07988. LMSTEN. 1 hit.
PF00249. Myb_DNA-binding. 1 hit.
[Graphical view ]
SMARTi SM00717. SANT. 3 hits.
[Graphical view ]
SUPFAMi SSF46689. SSF46689. 2 hits.
PROSITEi PS51294. HTH_MYB. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human c-myb protooncogene: nucleotide sequence of cDNA and organization of the genomic locus."
    Majello B., Kenyon L.C., Dalla-Favera R.
    Proc. Natl. Acad. Sci. U.S.A. 83:9636-9640(1986) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Alternative splicing of the human c-myb gene."
    Westin E.H., Gorse K.M., Clarke M.F.
    Oncogene 5:1117-1124(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  3. "Genome annotation of a 1.5 Mb region of human chromosome 6q23 encompassing a quantitative trait locus for fetal hemoglobin expression in adults."
    Close J.P., Game L., Clark B., Bergounioux J., Gerovassili A., Thein S.L.
    BMC Genomics 5:33-33(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4).
  4. "Characterization of the complete sequence structure of the human c-myb gene."
    Westin E.H., Gorse K.M.
    Submitted (MAR-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 3; 4; 5 AND 6).
    Tissue: Liver and Placenta.
  5. Gaillard C., Perbal B.
    Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  6. "Complex RNA splicing produces multiple forms of c-Myb with distinct transcriptional activities."
    O'Rourke J.P. Jr., Ness S.A.
    Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 7; 8; 9; 10 AND 11), ALTERNATIVE SPLICING.
  7. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  10. "Identification of a second promoter in the human c-myb proto-oncogene."
    Jacobs S.M., Gorse K.M., Westin E.H.
    Oncogene 9:227-235(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-47 (ISOFORM 1).
  11. "Positive autoregulation of c-myb expression via Myb binding sites in the 5' flanking region of the human c-myb gene."
    Nicolaides N.C., Gualdi R., Casadevall C., Manzella L., Calabretta B.
    Mol. Cell. Biol. 11:6166-6176(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-7.
  12. "Studies of the human c-myb gene and its product in human acute leukemias."
    Slamon D.J., Boone T.C., Murdock D.C., Keith D.E., Press M.F., Larson R.A., Souza L.M.
    Science 233:347-351(1986) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 47-640 (ISOFORMS 1 AND 12).
  13. "Identification of alternatively spliced transcripts for human c-myb: molecular cloning and sequence analysis of human c-myb exon 9A sequences."
    Dasgupta P., Reddy E.P.
    Oncogene 4:1419-1423(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
  14. "Transcriptional activation by human c-myb and v-myb genes."
    Kalkbrenner F., Guehmann S., Moelling K.
    Oncogene 5:657-661(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: DOMAIN.
  15. "p53 suppresses the c-Myb-induced activation of heat shock transcription factor 3."
    Tanikawa J., Ichikawa-Iwata E., Kanei-Ishii C., Nakai A., Matsuzawa S., Reed J.C., Ishii S.
    J. Biol. Chem. 275:15578-15585(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SIAH1, DEGRADATION.
  16. "HIPK1 interacts with c-Myb and modulates its activity through phosphorylation."
    Matre V., Nordgaard O., Alm-Kristiansen A.H., Ledsaak M., Gabrielsen O.S.
    Biochem. Biophys. Res. Commun. 388:150-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION BY HIPK1, INTERACTION WITH HIPK1, SUBCELLULAR LOCATION.
  17. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-471 AND LYS-480, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  18. "BCL6 positively regulates AID and germinal center gene expression via repression of miR-155."
    Basso K., Schneider C., Shen Q., Holmes A.B., Setty M., Leslie C., Dalla-Favera R.
    J. Exp. Med. 209:2455-2465(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.

Entry informationi

Entry nameiMYB_HUMAN
AccessioniPrimary (citable) accession number: P10242
Secondary accession number(s): E9PI07
, E9PLZ5, E9PNA4, E9PNL6, E9PRS2, P78391, P78392, P78525, P78526, Q14023, Q14024, Q708E4, Q708E7, Q9UE83
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: November 1, 1997
Last modified: September 3, 2014
This is version 153 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi