Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 28

Gene

Zfp28

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation. May have a role in embryonic development.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri377 – 399C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri405 – 427C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri433 – 456C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri462 – 484C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri490 – 512C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri518 – 540C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri546 – 568C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri574 – 596C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri602 – 624C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri630 – 652C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri658 – 680C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri686 – 708C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri714 – 736C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri742 – 764C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri770 – 792C2H2-type 15; degeneratePROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 28
Short name:
Zfp-28
Alternative name(s):
Protein mKR5
Gene namesi
Name:Zfp28
Synonyms:Mkr5, Zfp-28
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:99175. Zfp28.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000472901 – 825Zinc finger protein 28Add BLAST825

Proteomic databases

MaxQBiP10078.
PaxDbiP10078.
PRIDEiP10078.

PTM databases

iPTMnetiP10078.
PhosphoSitePlusiP10078.

Expressioni

Tissue specificityi

Expressed predominantly in ovary.

Developmental stagei

Expression decreases in embryo after day 16.

Gene expression databases

BgeeiENSMUSG00000062861.
CleanExiMM_ZFP28.
ExpressionAtlasiP10078. baseline and differential.
GenevisibleiP10078. MM.

Interactioni

Protein-protein interaction databases

BioGridi204654. 1 interactor.
STRINGi10090.ENSMUSP00000079812.

Structurei

3D structure databases

ProteinModelPortaliP10078.
SMRiP10078.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini103 – 174KRABPROSITE-ProRule annotationAdd BLAST72

Sequence similaritiesi

Contains 15 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri377 – 399C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri405 – 427C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri433 – 456C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri462 – 484C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri490 – 512C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri518 – 540C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri546 – 568C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri574 – 596C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri602 – 624C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri630 – 652C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri658 – 680C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri686 – 708C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri714 – 736C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri742 – 764C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri770 – 792C2H2-type 15; degeneratePROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129704.
HOVERGENiHBG018163.
InParanoidiP10078.
KOiK09228.
OMAiTGIYAGK.
OrthoDBiEOG091G02KC.
TreeFamiTF341817.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 15 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 2 hits.
PF13912. zf-C2H2_6. 2 hits.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 14 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 14 hits.
PS50157. ZINC_FINGER_C2H2_2. 14 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P10078-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQGMASVVSC EPWALLGRGA LCTKARPGGG PAAGTVVAPG SPDRGRPRSR
60 70 80 90 100
NSLASQDQQG AVTSGTAHKA LFSRDTNFLQ EINRKQEAAP TGTRHKAKSQ
110 120 130 140 150
GLVTFGDVAV VFSQEEWEWL NSEQRSLYWK VMLDNYRNLA SLGLCASQPD
160 170 180 190 200
MITSLEQGRD PWMMKRKMRK GQHLDLKAMQ ETKEFPPKDL SEETLFLAVL
210 220 230 240 250
RKQLLPHRPK CSMVRAAWEG GAVFTTHRGL KTNSGLARDS PAQLVSAQRS
260 270 280 290 300
FCKSVTWENC GDRGSVGQQS VQEAQDLLPR QDSHAERVTG RTWSTKLECS
310 320 330 340 350
TFRDQDSECT FERNEQETVT PNRAFSEGRD GMCIESGRWF HLNSSDERSH
360 370 380 390 400
NCDSGKSFSS NPVVVKETGI CSGKKLFQCN ECKKTFTQSS SLTVHQRIHT
410 420 430 440 450
GEKPYKCNQC GKAFSDGSSF ARHQRCHTGK KPYECPECGK AFIQNTSLVR
460 470 480 490 500
HWRYYHTGEK PFDCIDCGKA FSDHIGLNQH RRIHTGEKPY TCEVCHKSFR
510 520 530 540 550
YGSSLTVHQR IHTGEKPYEC EICRKAFSHH ASLTQHQRVH SGEKPFKCKE
560 570 580 590 600
CGKAFRQNIH LASHWRIHTG EKPFECGECG KSFSISSQLA THQRIHTGEK
610 620 630 640 650
PYECKVCRKA FTQKAHLAQH QKTHTGEKPY ECKECGKAFS QTTHLIQHQR
660 670 680 690 700
VHTGEKPYKC LECGKAFGDN SSCTQHRRLH TGQRPYECVE CGKTFKTKSS
710 720 730 740 750
LICHRRCHTG EKPYECSACG KAFSHRQSLS VHQRIHSGKK PYECKECRKT
760 770 780 790 800
FIQIGHLNQH KRVHTGERTY NYKKGRRAFR QTAHFAHHQQ IHSGKSPAHH
810 820
SLPSTSNPVD LFSKFVWNPS SLPSS
Length:825
Mass (Da):93,309
Last modified:August 4, 2003 - v3
Checksum:i19BABAC25F2908E6
GO
Isoform 2 (identifier: P10078-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     600-600: K → KPFECKVCRKAFRQNIHLASHWRIHTGEKPFECGECGKSFSISSQLATHQRIHTGEK

Note: No experimental confirmation available.
Show »
Length:881
Mass (Da):99,745
Checksum:i79243B47C9F89C71
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti263R → W in BAC33362 (PubMed:16141072).Curated1
Sequence conflicti426C → Y in CAA31107 (PubMed:3143103).Curated1
Sequence conflicti426C → Y in AAA37120 (PubMed:3143103).Curated1
Sequence conflicti677R → Q (PubMed:3143103).Curated1
Sequence conflicti677R → Q (PubMed:7958967).Curated1
Sequence conflicti683Q → L (PubMed:3143103).Curated1
Sequence conflicti683Q → L (PubMed:7958967).Curated1
Sequence conflicti704 – 705HR → YC (PubMed:3143103).Curated2
Sequence conflicti704 – 705HR → YC (PubMed:7958967).Curated2
Sequence conflicti726R → W (PubMed:3143103).Curated1
Sequence conflicti726R → W (PubMed:7958967).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti658Y → I in strain: 129/Sv; requires 2 nucleotide substitutions. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006882600K → KPFECKVCRKAFRQNIHLAS HWRIHTGEKPFECGECGKSF SISSQLATHQRIHTGEK in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028202 mRNA. Translation: BAC25810.1.
AK048530 mRNA. Translation: BAC33362.1.
BC062116 mRNA. Translation: AAH62116.1.
X12594 mRNA. Translation: CAA31107.1.
M36516 mRNA. Translation: AAA37120.1.
L28802 Genomic DNA. Translation: AAA64428.1.
CCDSiCCDS39752.1. [P10078-1]
PIRiI53859.
RefSeqiNP_780456.2. NM_175247.3. [P10078-1]
UniGeneiMm.127014.

Genome annotation databases

EnsembliENSMUST00000081022; ENSMUSP00000079812; ENSMUSG00000062861. [P10078-1]
GeneIDi22690.
KEGGimmu:22690.
UCSCiuc009fbi.1. mouse. [P10078-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028202 mRNA. Translation: BAC25810.1.
AK048530 mRNA. Translation: BAC33362.1.
BC062116 mRNA. Translation: AAH62116.1.
X12594 mRNA. Translation: CAA31107.1.
M36516 mRNA. Translation: AAA37120.1.
L28802 Genomic DNA. Translation: AAA64428.1.
CCDSiCCDS39752.1. [P10078-1]
PIRiI53859.
RefSeqiNP_780456.2. NM_175247.3. [P10078-1]
UniGeneiMm.127014.

3D structure databases

ProteinModelPortaliP10078.
SMRiP10078.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204654. 1 interactor.
STRINGi10090.ENSMUSP00000079812.

PTM databases

iPTMnetiP10078.
PhosphoSitePlusiP10078.

Proteomic databases

MaxQBiP10078.
PaxDbiP10078.
PRIDEiP10078.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000081022; ENSMUSP00000079812; ENSMUSG00000062861. [P10078-1]
GeneIDi22690.
KEGGimmu:22690.
UCSCiuc009fbi.1. mouse. [P10078-1]

Organism-specific databases

CTDi140612.
MGIiMGI:99175. Zfp28.

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129704.
HOVERGENiHBG018163.
InParanoidiP10078.
KOiK09228.
OMAiTGIYAGK.
OrthoDBiEOG091G02KC.
TreeFamiTF341817.

Miscellaneous databases

PROiP10078.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000062861.
CleanExiMM_ZFP28.
ExpressionAtlasiP10078. baseline and differential.
GenevisibleiP10078. MM.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 15 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 2 hits.
PF13912. zf-C2H2_6. 2 hits.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 14 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 14 hits.
PS50157. ZINC_FINGER_C2H2_2. 14 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZFP28_MOUSE
AccessioniPrimary (citable) accession number: P10078
Secondary accession number(s): Q61776, Q8BT11, Q8C836
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: August 4, 2003
Last modified: November 30, 2016
This is version 167 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.