Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sulfotransferase 1A3

Gene

SULT1A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.

Catalytic activityi

3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei86 – 861Substrate
Active sitei108 – 1081Proton acceptorBy similarity
Binding sitei130 – 1301PAPS
Binding sitei138 – 1381PAPS
Binding sitei146 – 1461Substrate
Binding sitei193 – 1931PAPS

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi48 – 536PAPS
Nucleotide bindingi227 – 2326PAPS
Nucleotide bindingi257 – 2593PAPS

GO - Molecular functioni

  • aryl sulfotransferase activity Source: CACAO
  • sulfotransferase activity Source: BHF-UCL

GO - Biological processi

  • 3'-phosphoadenosine 5'-phosphosulfate metabolic process Source: Reactome
  • catecholamine metabolic process Source: UniProtKB-KW
  • flavonoid metabolic process Source: BHF-UCL
  • IRE1-mediated unfolded protein response Source: Reactome
  • steroid metabolic process Source: UniProtKB-KW
  • sulfation Source: BHF-UCL
  • xenobiotic metabolic process Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

Catecholamine metabolism, Lipid metabolism, Steroid metabolism

Enzyme and pathway databases

ReactomeiR-HSA-156584. Cytosolic sulfonation of small molecules.
R-HSA-381038. XBP1(S) activates chaperone genes.

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfotransferase 1A3 (EC:2.8.2.1)
Short name:
ST1A3
Alternative name(s):
Aryl sulfotransferase 1A3/1A4
Catecholamine-sulfating phenol sulfotransferase
HAST3
M-PST
Monoamine-sulfating phenol sulfotransferase
Placental estrogen sulfotransferase
Sulfotransferase 1A3/1A4
Sulfotransferase, monoamine-preferring
Thermolabile phenol sulfotransferase
Short name:
TL-PST
Gene namesi
Name:SULT1A3
Synonyms:STM
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:11455. SULT1A3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Chemistry

ChEMBLiCHEMBL1743293.

Polymorphism and mutation databases

DMDMi1711609.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 295295Sulfotransferase 1A3PRO_0000085159Add
BLAST

Post-translational modificationi

The N-terminus is blocked.

Proteomic databases

PaxDbiP0DMM9.
PeptideAtlasiP0DMM9.
TopDownProteomicsiP0DMM9-2. [P0DMM9-2]

PTM databases

iPTMnetiP0DMM9.
PhosphoSiteiP0DMM9.

Expressioni

Tissue specificityi

Liver, colon, kidney, lung, brain, spleen, small intestine, placenta and leukocyte.

Gene expression databases

CleanExiHS_SULT1A3.
HS_SULT1A4.
ExpressionAtlasiP0DMM9. baseline.
GenevisibleiP0DMM9. HS.

Organism-specific databases

HPAiHPA049500.
HPA051051.

Interactioni

Subunit structurei

Homodimer.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
KHDRBS2Q5VWX13EBI-10196922,EBI-742808
NIF3L1Q9GZT83EBI-10196922,EBI-740897
SHMT1P348963EBI-10196922,EBI-715117

Protein-protein interaction databases

BioGridi112687. 12 interactions.
138644. 4 interactions.
IntActiP0DMM9. 3 interactions.
STRINGi9606.ENSP00000343645.

Structurei

Secondary structure

1
295
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi12 – 154Combined sources
Beta strandi18 – 214Combined sources
Helixi22 – 276Combined sources
Helixi30 – 334Combined sources
Beta strandi41 – 466Combined sources
Helixi51 – 6212Combined sources
Turni63 – 653Combined sources
Helixi67 – 704Combined sources
Helixi75 – 784Combined sources
Helixi92 – 976Combined sources
Beta strandi104 – 1074Combined sources
Helixi111 – 1133Combined sources
Helixi116 – 1205Combined sources
Beta strandi124 – 1296Combined sources
Helixi132 – 14514Combined sources
Helixi155 – 16410Combined sources
Helixi172 – 18211Combined sources
Turni183 – 1853Combined sources
Beta strandi188 – 1925Combined sources
Helixi193 – 1986Combined sources
Helixi200 – 21011Combined sources
Helixi217 – 22610Combined sources
Helixi229 – 2346Combined sources
Turni236 – 2383Combined sources
Turni245 – 2473Combined sources
Turni250 – 2523Combined sources
Helixi263 – 2664Combined sources
Helixi270 – 28314Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1CJMX-ray2.40A1-295[»]
2A3RX-ray2.60A/B1-295[»]
DisProtiDP00011.
ProteinModelPortaliP0DMM9.
SMRiP0DMM9. Positions 9-295.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni106 – 1083Substrate binding

Sequence similaritiesi

Belongs to the sulfotransferase 1 family.Curated

Phylogenomic databases

eggNOGiKOG1584. Eukaryota.
ENOG4111H56. LUCA.
GeneTreeiENSGT00760000118932.
HOVERGENiHBG001195.
KOiK01014.
OMAiTSFREMK.
PhylomeDBiP0DMM9.
TreeFamiTF321745.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view]
PfamiPF00685. Sulfotransfer_1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P0DMM9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELIQDTSRP PLEYVKGVPL IKYFAEALGP LQSFQARPDD LLINTYPKSG
60 70 80 90 100
TTWVSQILDM IYQGGDLEKC NRAPIYVRVP FLEVNDPGEP SGLETLKDTP
110 120 130 140 150
PPRLIKSHLP LALLPQTLLD QKVKVVYVAR NPKDVAVSYY HFHRMEKAHP
160 170 180 190 200
EPGTWDSFLE KFMAGEVSYG SWYQHVQEWW ELSRTHPVLY LFYEDMKENP
210 220 230 240 250
KREIQKILEF VGRSLPEETM DFMVQHTSFK EMKKNPMTNY TTVPQELMDH
260 270 280 290
SISPFMRKGM AGDWKTTFTV AQNERFDADY AEKMAGCSLS FRSEL
Length:295
Mass (Da):34,196
Last modified:September 3, 2014 - v1
Checksum:iECDDEC03DBE30D46
GO
Isoform 2 (identifier: P0DMM9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     167-295: VSYGSWYQHV...GCSLSFRSEL → GGLDWRKEGVKPRGGGYNVQQPCVGAPCPLL

Note: No experimental confirmation available.Curated
Show »
Length:197
Mass (Da):22,069
Checksum:i44C5F13EDA71BC1D
GO
Isoform 3 (identifier: P0DMM9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-198: E → EEPSAAQ

Show »
Length:301
Mass (Da):34,780
Checksum:i7018229AD3F67542
GO

Sequence cautioni

Isoform 2 : The sequence BAC85507 differs from that shown. Reason: Frameshift at position 101. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti220 – 2256MDFMVQ → VDLMVE in AAC99987 (Ref. 8) Curated
Sequence conflicti235 – 2351N → T in AAC99987 (Ref. 8) Curated
Sequence conflicti244 – 2452PQ → RR in AAC99987 (Ref. 8) Curated
Sequence conflicti290 – 2901S → T in AAC99987 (Ref. 8) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti101 – 1011P → H Decreases levels of sulfotransferase activity. 1 Publication
VAR_071108
Natural varianti101 – 1011P → L Decreases levels of sulfotransferase activity. 1 Publication
Corresponds to variant rs751527244 [ dbSNP | Ensembl ].
VAR_071109
Natural varianti144 – 1441R → C No effect on sulfotransferase activity. 1 Publication
VAR_071110
Natural varianti234 – 2341K → N Decreases levels of sulfotransferase activity; accelerates proteasome-dependent degradation. 1 Publication
VAR_071111

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei167 – 295129VSYGS…FRSEL → GGLDWRKEGVKPRGGGYNVQ QPCVGAPCPLL in isoform 2. 1 PublicationVSP_012326Add
BLAST
Alternative sequencei198 – 1981E → EEPSAAQ in isoform 3. 1 PublicationVSP_047771

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19956 mRNA. Translation: AAA02943.1.
L25275 mRNA. Translation: AAA36523.1.
L19956 mRNA. Translation: AAA17723.1.
U20499 Genomic DNA. Translation: AAA64490.1.
X84653 mRNA. Translation: CAA59146.1.
L34160 Genomic DNA. No translation available.
U37686 Genomic DNA. Translation: AAA86536.1.
U34199 mRNA. Translation: AAC99987.1.
AK122733 mRNA. Translation: BAC85507.1. Frameshift.
AK298073 mRNA. Translation: BAG60362.1.
AC106782 Genomic DNA. No translation available.
AC133555 Genomic DNA. No translation available.
AB111094 mRNA. Translation: BAE94928.1.
BC014471 mRNA. Translation: AAH14471.1.
BC078144 mRNA. Translation: AAH78144.1.
U08099 Genomic DNA. Translation: AAA82126.1.
CCDSiCCDS10674.1. [P0DMM9-1]
PIRiA55451.
RefSeqiNP_001017390.1. NM_001017390.2. [P0DMM9-1]
NP_808220.1. NM_177552.3. [P0DMM9-1]
XP_011506903.1. XM_011508601.1. [P0DMM9-3]
UniGeneiHs.460558.
Hs.744871.

Genome annotation databases

EnsembliENST00000338971; ENSP00000343645; ENSG00000261052. [P0DMM9-1]
ENST00000395138; ENSP00000378570; ENSG00000261052. [P0DMM9-1]
ENST00000563322; ENSP00000454518; ENSG00000261052. [P0DMM9-3]
GeneIDi105369243.
445329.
6818.
KEGGihsa:105369243.
hsa:445329.
hsa:6818.
UCSCiuc010bzt.4. human. [P0DMM9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19956 mRNA. Translation: AAA02943.1.
L25275 mRNA. Translation: AAA36523.1.
L19956 mRNA. Translation: AAA17723.1.
U20499 Genomic DNA. Translation: AAA64490.1.
X84653 mRNA. Translation: CAA59146.1.
L34160 Genomic DNA. No translation available.
U37686 Genomic DNA. Translation: AAA86536.1.
U34199 mRNA. Translation: AAC99987.1.
AK122733 mRNA. Translation: BAC85507.1. Frameshift.
AK298073 mRNA. Translation: BAG60362.1.
AC106782 Genomic DNA. No translation available.
AC133555 Genomic DNA. No translation available.
AB111094 mRNA. Translation: BAE94928.1.
BC014471 mRNA. Translation: AAH14471.1.
BC078144 mRNA. Translation: AAH78144.1.
U08099 Genomic DNA. Translation: AAA82126.1.
CCDSiCCDS10674.1. [P0DMM9-1]
PIRiA55451.
RefSeqiNP_001017390.1. NM_001017390.2. [P0DMM9-1]
NP_808220.1. NM_177552.3. [P0DMM9-1]
XP_011506903.1. XM_011508601.1. [P0DMM9-3]
UniGeneiHs.460558.
Hs.744871.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1CJMX-ray2.40A1-295[»]
2A3RX-ray2.60A/B1-295[»]
DisProtiDP00011.
ProteinModelPortaliP0DMM9.
SMRiP0DMM9. Positions 9-295.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112687. 12 interactions.
138644. 4 interactions.
IntActiP0DMM9. 3 interactions.
STRINGi9606.ENSP00000343645.

Chemistry

ChEMBLiCHEMBL1743293.

PTM databases

iPTMnetiP0DMM9.
PhosphoSiteiP0DMM9.

Polymorphism and mutation databases

DMDMi1711609.

Proteomic databases

PaxDbiP0DMM9.
PeptideAtlasiP0DMM9.
TopDownProteomicsiP0DMM9-2. [P0DMM9-2]

Protocols and materials databases

DNASUi445329.
6818.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338971; ENSP00000343645; ENSG00000261052. [P0DMM9-1]
ENST00000395138; ENSP00000378570; ENSG00000261052. [P0DMM9-1]
ENST00000563322; ENSP00000454518; ENSG00000261052. [P0DMM9-3]
GeneIDi105369243.
445329.
6818.
KEGGihsa:105369243.
hsa:445329.
hsa:6818.
UCSCiuc010bzt.4. human. [P0DMM9-1]

Organism-specific databases

CTDi445329.
6818.
GeneCardsiSULT1A3.
HGNCiHGNC:11455. SULT1A3.
HPAiHPA049500.
HPA051051.
MIMi600641. gene.
neXtProtiNX_P0DMM9.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1584. Eukaryota.
ENOG4111H56. LUCA.
GeneTreeiENSGT00760000118932.
HOVERGENiHBG001195.
KOiK01014.
OMAiTSFREMK.
PhylomeDBiP0DMM9.
TreeFamiTF321745.

Enzyme and pathway databases

ReactomeiR-HSA-156584. Cytosolic sulfonation of small molecules.
R-HSA-381038. XBP1(S) activates chaperone genes.

Miscellaneous databases

PROiP0DMM9.
SOURCEiSearch...

Gene expression databases

CleanExiHS_SULT1A3.
HS_SULT1A4.
ExpressionAtlasiP0DMM9. baseline.
GenevisibleiP0DMM9. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR000863. Sulfotransferase_dom.
[Graphical view]
PfamiPF00685. Sulfotransfer_1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiST1A3_HUMAN
AccessioniPrimary (citable) accession number: P0DMM9
Secondary accession number(s): B4DNV0
, O95603, P50224, Q1ET66, Q6ZWJ5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 3, 2014
Last sequence update: September 3, 2014
Last modified: September 7, 2016
This is version 23 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Found in a segmental duplication on p arm of chromosome 16 giving rise to two identical copies of this gene sharing exons with SLX1A and SLX1B. The ORFs of SULT1A3 and SULT1A4 differ with only a single nucleotide change that does not alter the encoded amino acid. It is not possible to determine whether any individual polymorphism is present within SULT1A3 or SULT1A4 (PubMed:15358107).1 Publication

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.