UniProtKB - P0DJ31 (KA231_VAEMS)
(max 400 entries)x
Your basket is currently empty.
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|P0DJ31|KA231_VAEMS Potassium channel toxin alpha-KTx 23.1 OS=Vaejovis mexicanus smithi PE=1 SV=1 AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC
- Align
- Format
- Add to basketAdded to basket
- History
- Other tutorials and videos
- Help video
- Feedback
Protein
Potassium channel toxin alpha-KTx 23.1
Gene
N/A
Organism
Vaejovis mexicanus smithi (Scorpion) (Vaejovis smithi)
Status
Reviewed-Annotation score:
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
Selectively and irreversibly binds (K(d)=2.9 pM) and blocks hKv1.3/KCNA3 potassium channels of human T-lymphocytes. Weakly blocks hKCa3.1/KCNN4, mKv1.1/KCNA1, and hKv1.2/KCNA2 channels. In vivo, high doses (200 µg) produce no symptoms of intoxication when injected into mice.3 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
- Ref.1"Vm23 and Vm24, two scorpion peptides that block human T-lymphocyte potassium channels sub-type K(v)1.3 w/high selectivity and decrease the in vivo DTH responses in rats."
Possani L.D., Gurrola G.B., Salas-Castillo S.P., Batista C.V.F., Varga Z., Panyi G., Caspar R.
Patent number US0059064, 10-MAR-2011Cited for: PROTEIN SEQUENCE, SYNTHESIS, FUNCTION, DISULFIDE BONDS, AMIDATION AT CYS-36, IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION. - Ref.2"Structure, function, and chemical synthesis of vaejovis mexicanus peptide 24: a novel potent blocker of Kv1.3 potassium channels of human T lymphocytes."
Gurrola G.B., Hernandez-Lopez R.A., Rodriguez de la Vega R.C., Varga Z., Batista C.V.F., Salas-Castillo S.P., Panyi G., del Rio-Portilla F., Possani L.D.
Biochemistry 51:4049-4061(2012) [PubMed] [Europe PMC] [Abstract]Cited for: PROTEIN SEQUENCE, SYNTHESIS, FUNCTION, DISULFIDE BONDS, AMIDATION AT CYS-36, MASS SPECTROMETRY, STRUCTURE BY NMR, SUBCELLULAR LOCATION, NOMENCLATURE. - Ref.3"Vm24, a natural immunosuppressant peptide potently and selectively blocks Kv1.3 potassium channels of human T Cells."
Varga Z., Gurrola-Briones G., Papp F., Rodriguez de la Vega R.C., Pedraza-Alva G., Tajhya R.B., Gaspar R., Cardenas L., Rosenstein Y., Beeton C., Possani L.D., Panyi G.
Mol. Pharmacol. 82:372-382(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, NOMENCLATURE.
Miscellaneous
Does not block hKv1.4/KCNA4, hKv1.5/KCNA5, rKv2.1/KCNB1, hBK, hERG, Nav1.5/SCN5A channels when assayed at a concentration of 10 nM.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
- Ref.1"Vm23 and Vm24, two scorpion peptides that block human T-lymphocyte potassium channels sub-type K(v)1.3 w/high selectivity and decrease the in vivo DTH responses in rats."
Possani L.D., Gurrola G.B., Salas-Castillo S.P., Batista C.V.F., Varga Z., Panyi G., Caspar R.
Patent number US0059064, 10-MAR-2011Cited for: PROTEIN SEQUENCE, SYNTHESIS, FUNCTION, DISULFIDE BONDS, AMIDATION AT CYS-36, IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.
Sites
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei | 25 | Basic residue of the functional dyad | 1 | |
| <p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei | 34 | Aromatic residue of the functional dyad | 1 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- ion channel inhibitor activity Source: InterPro
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- defense response Source: InterPro
- pathogenesis Source: InterPro
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Molecular function | Ion channel impairing toxin, Neurotoxin, Potassium channel impairing toxin, Toxin |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the ‘Names and Taxonomy’ section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Potassium channel toxin alpha-KTx 23.12 Publications<p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More…</a></p> Manual assertion based on opinion ini
Alternative name(s): Toxin Vm242 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More…</a></p> Manual assertion based on opinion ini
Toxin alpha-KTx 21.1 |
| <p>This subsection of the ‘Names and taxonomy’ section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Vaejovis mexicanus smithi (Scorpion) (Vaejovis smithi) |
| <p>This subsection of the ‘Names and taxonomy’ section shows the unique identifier assigned by the <span class="caps">NCBI</span> to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 1562928 [NCBI] |
| <p>This subsection of the ‘Names and taxonomy’ section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Protostomia › Ecdysozoa › Panarthropoda › Arthropoda › Chelicerata › Arachnida › Scorpiones › Iurida › Chactoidea › Vaejovidae › Vaejovis |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
- Secreted 3 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
- Ref.1"Vm23 and Vm24, two scorpion peptides that block human T-lymphocyte potassium channels sub-type K(v)1.3 w/high selectivity and decrease the in vivo DTH responses in rats."
Possani L.D., Gurrola G.B., Salas-Castillo S.P., Batista C.V.F., Varga Z., Panyi G., Caspar R.
Patent number US0059064, 10-MAR-2011Cited for: PROTEIN SEQUENCE, SYNTHESIS, FUNCTION, DISULFIDE BONDS, AMIDATION AT CYS-36, IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION. - Ref.2"Structure, function, and chemical synthesis of vaejovis mexicanus peptide 24: a novel potent blocker of Kv1.3 potassium channels of human T lymphocytes."
Gurrola G.B., Hernandez-Lopez R.A., Rodriguez de la Vega R.C., Varga Z., Batista C.V.F., Salas-Castillo S.P., Panyi G., del Rio-Portilla F., Possani L.D.
Biochemistry 51:4049-4061(2012) [PubMed] [Europe PMC] [Abstract]Cited for: PROTEIN SEQUENCE, SYNTHESIS, FUNCTION, DISULFIDE BONDS, AMIDATION AT CYS-36, MASS SPECTROMETRY, STRUCTURE BY NMR, SUBCELLULAR LOCATION, NOMENCLATURE. - Ref.3"Vm24, a natural immunosuppressant peptide potently and selectively blocks Kv1.3 potassium channels of human T Cells."
Varga Z., Gurrola-Briones G., Papp F., Rodriguez de la Vega R.C., Pedraza-Alva G., Tajhya R.B., Gaspar R., Cardenas L., Rosenstein Y., Beeton C., Possani L.D., Panyi G.
Mol. Pharmacol. 82:372-382(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, NOMENCLATURE.
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Cellular componenti
- extracellular region Source: UniProtKB-SubCell
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Secreted<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000415929 | 1 – 36 | Potassium channel toxin alpha-KTx 23.12 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
| 36 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <span class="caps">PTM</span> / Processing”:/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 6 ↔ 26 | 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
<p>Manually validated information which has been imported from another database.</p> <p><a href="/manual/evidences#ECO:0000312">More…</a></p> Manual assertion inferred from database entriesi | ||
| <p>This subsection of the <span class="caps">PTM</span> / Processing”:/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 12 ↔ 31 | 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
<p>Manually validated information which has been imported from another database.</p> <p><a href="/manual/evidences#ECO:0000312">More…</a></p> Manual assertion inferred from database entriesi | ||
| <p>This subsection of the <span class="caps">PTM</span> / Processing”:/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 16 ↔ 33 | 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
<p>Manually validated information which has been imported from another database.</p> <p><a href="/manual/evidences#ECO:0000312">More…</a></p> Manual assertion inferred from database entriesi | ||
| <p>This subsection of the <span class="caps">PTM</span> / Processing”:/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 21 ↔ 36 | 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
<p>Manually validated information which has been imported from another database.</p> <p><a href="/manual/evidences#ECO:0000312">More…</a></p> Manual assertion inferred from database entriesi | ||
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 36 | Cysteine amide2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
| 1 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
Amidation, Disulfide bond<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression"><span class="caps">P92958</span></a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression"><span class="caps">Q8TDN4</span></a>, <a href="http://www.uniprot.org/uniprot/O14734#expression"><span class="caps">O14734</span></a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
Expressed by the venom gland.3 Publications
<p>Manually curated information which has been inferred by a curator based on his/her scientific knowledge or on the scientific content of an article.</p> <p><a href="/manual/evidences#ECO:0000305">More…</a></p> Manual assertion inferred by curator fromi
- Ref.1"Vm23 and Vm24, two scorpion peptides that block human T-lymphocyte potassium channels sub-type K(v)1.3 w/high selectivity and decrease the in vivo DTH responses in rats."
Possani L.D., Gurrola G.B., Salas-Castillo S.P., Batista C.V.F., Varga Z., Panyi G., Caspar R.
Patent number US0059064, 10-MAR-2011Cited for: PROTEIN SEQUENCE, SYNTHESIS, FUNCTION, DISULFIDE BONDS, AMIDATION AT CYS-36, IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION. - Ref.2"Structure, function, and chemical synthesis of vaejovis mexicanus peptide 24: a novel potent blocker of Kv1.3 potassium channels of human T lymphocytes."
Gurrola G.B., Hernandez-Lopez R.A., Rodriguez de la Vega R.C., Varga Z., Batista C.V.F., Salas-Castillo S.P., Panyi G., del Rio-Portilla F., Possani L.D.
Biochemistry 51:4049-4061(2012) [PubMed] [Europe PMC] [Abstract]Cited for: PROTEIN SEQUENCE, SYNTHESIS, FUNCTION, DISULFIDE BONDS, AMIDATION AT CYS-36, MASS SPECTROMETRY, STRUCTURE BY NMR, SUBCELLULAR LOCATION, NOMENCLATURE. - Ref.3"Vm24, a natural immunosuppressant peptide potently and selectively blocks Kv1.3 potassium channels of human T Cells."
Varga Z., Gurrola-Briones G., Papp F., Rodriguez de la Vega R.C., Pedraza-Alva G., Tajhya R.B., Gaspar R., Cardenas L., Rosenstein Y., Beeton C., Possani L.D., Panyi G.
Mol. Pharmacol. 82:372-382(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, NOMENCLATURE.
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more detailsHide details| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 3 – 5 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More…</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 8 – 10 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More…</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 13 – 16 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More…</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 22 – 34 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More…</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 13 |
3D structure databases
| Select the link destinations: Protein Data Bank Europe More...PDBeiProtein Data Bank RCSB More...RCSB PDBiProtein Data Bank Japan More...PDBjiLinks Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 2K9O | NMR | - | A | 1-36 | [»] | |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P0DJ31. | |||||
Database of comparative protein structure models More...ModBasei | Search... | |||||
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... | |||||
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini
Has the CSalpha/beta fold, which comprises one or two short alpha helices connected to anti-parallel beta-sheets stabilized by three or four disulfide bonds.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
- Ref.2"Structure, function, and chemical synthesis of vaejovis mexicanus peptide 24: a novel potent blocker of Kv1.3 potassium channels of human T lymphocytes."
Gurrola G.B., Hernandez-Lopez R.A., Rodriguez de la Vega R.C., Varga Z., Batista C.V.F., Salas-Castillo S.P., Panyi G., del Rio-Portilla F., Possani L.D.
Biochemistry 51:4049-4061(2012) [PubMed] [Europe PMC] [Abstract]Cited for: PROTEIN SEQUENCE, SYNTHESIS, FUNCTION, DISULFIDE BONDS, AMIDATION AT CYS-36, MASS SPECTROMETRY, STRUCTURE BY NMR, SUBCELLULAR LOCATION, NOMENCLATURE.
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Belongs to the short scorpion toxin superfamily. Potassium channel inhibitor family. Alpha-KTx 23 subfamily.Curated
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 3.30.30.10. 1 hit. |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR003614. Scorpion_toxin-like. IPR001947. Scorpion_toxinS_K_inh. |
Pfam protein domain database More...Pfami | View protein in Pfam PF00451. Toxin_2. 1 hit. |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR00286. CHARYBDTOXIN. |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF57095. SSF57095. 1 hit. |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS01138. SCORP_SHORT_TOXIN. 1 hit. |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including length and molecular weight.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the ‘Sequence’ section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
P0DJ31-1 [UniParc]FASTAAdd to basketAdded to basketShow »
10 20 30
AAAISCVGSP ECPPKCRAQG CKNGKCMNRK CKCYYC
Length:36
Mass (Da):3,873
Last modified:March 21, 2012 - v1
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:iD7A77050D7902995
<p>This subsection of the ‘Sequence’ section reports information derived from mass spectrometry experiments done on the entire protein or on biologically active derived peptide(s).<p><a href='/help/mass_spectrometry' target='_top'>More...</a></p>Mass spectrometryi
Molecular mass is 3864.0 Da from positions 1 - 36. Determined by ESI. 1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More…</a></p> Manual assertion based on experiment ini
- Ref.2"Structure, function, and chemical synthesis of vaejovis mexicanus peptide 24: a novel potent blocker of Kv1.3 potassium channels of human T lymphocytes."
Gurrola G.B., Hernandez-Lopez R.A., Rodriguez de la Vega R.C., Varga Z., Batista C.V.F., Salas-Castillo S.P., Panyi G., del Rio-Portilla F., Possani L.D.
Biochemistry 51:4049-4061(2012) [PubMed] [Europe PMC] [Abstract]Cited for: PROTEIN SEQUENCE, SYNTHESIS, FUNCTION, DISULFIDE BONDS, AMIDATION AT CYS-36, MASS SPECTROMETRY, STRUCTURE BY NMR, SUBCELLULAR LOCATION, NOMENCLATURE.
<p>This section provides links to the UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>). UniRef consists of clusters for UniProtKB sequences (including isoforms) and selected UniParc sequences, in order to obtain complete coverage of the sequence space at resolutions of 100%, 90% and 50% identity.<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:| 100% | UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry. |
| 90% | UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence). |
| 50% | UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster. |
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
3D structure databases
| Select the link destinations: Protein Data Bank Europe More...PDBeiProtein Data Bank RCSB More...RCSB PDBiProtein Data Bank Japan More...PDBjiLinks Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 2K9O | NMR | - | A | 1-36 | [»] | |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P0DJ31. | |||||
Database of comparative protein structure models More...ModBasei | Search... | |||||
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... | |||||
Protocols and materials databases
| Structural Biology Knowledgebase | Search... |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 3.30.30.10. 1 hit. |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR003614. Scorpion_toxin-like. IPR001947. Scorpion_toxinS_K_inh. |
Pfam protein domain database More...Pfami | View protein in Pfam PF00451. Toxin_2. 1 hit. |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR00286. CHARYBDTOXIN. |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF57095. SSF57095. 1 hit. |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS01138. SCORP_SHORT_TOXIN. 1 hit. |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | KA231_VAEMS | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | P0DJ31Primary (citable) accession number: P0DJ31 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | March 21, 2012 |
| Last sequence update: | March 21, 2012 | |
| Last modified: | May 10, 2017 | |
| This is version 20 of the entry and version 1 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Animal Toxin Annotation Program | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
3D-structure, Direct protein sequencingDocuments
- PDB cross-references
Index of Protein Data Bank (PDB) cross-references - Scorpion potassium channel toxins
Nomenclature of scorpion potassium channel toxins and list of entries - SIMILARITY comments
Index of protein domains and families