Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P0CAP1

- MYZAP_HUMAN

UniProt

P0CAP1 - MYZAP_HUMAN

Protein

Myocardial zonula adherens protein

Gene

MYZAP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 51 (01 Oct 2014)
      Sequence version 1 (26 May 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in cellular signaling via Rho-related GTP-binding proteins and subsequent activation of transcription factor SRF By similarity. Targets TJP1 to cell junctions. In cortical neurons, may play a role in glutaminergic signal transduction through interaction with the NMDA receptor subunit GRIN1 By similarity.By similarity

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. intracellular signal transduction Source: UniProtKB

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Myocardial zonula adherens protein
    Alternative name(s):
    GRINL1A upstream protein
    Short name:
    Gup
    Gene namesi
    Name:MYZAP
    Synonyms:MYOZAP
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:43444. MYZAP.

    Subcellular locationi

    Cytoplasmcytoskeleton By similarity. Cell membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity. CytoplasmmyofibrilsarcomereI band By similarity. CytoplasmmyofibrilsarcomereZ line By similarity. Cell junction 2 Publications
    Note: Detected predominantly at the intercalated disk in cardiomyocytes, and at low levels on sarcomeric Z disks. Colocalizes with F-actin. Colocalizes with cortical actin By similarity.By similarity

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-SubCell
    2. cytoskeleton Source: UniProtKB-SubCell
    3. extrinsic component of cytoplasmic side of plasma membrane Source: UniProtKB
    4. I band Source: UniProtKB
    5. Z disc Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi436 – 4361Q → G: No effect on DYNLL1-binding; when associated with G-448. 1 Publication
    Mutagenesisi448 – 4481R → G: No effect on DYNLL1-binding; when associated with G-436. 1 Publication
    Mutagenesisi450 – 4501Y → G: No effect on DYNLL1-binding. 1 Publication

    Organism-specific databases

    PharmGKBiPA28986.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2020Sequence AnalysisAdd
    BLAST
    Chaini21 – 466446Myocardial zonula adherens proteinPRO_0000376013Add
    BLAST

    Proteomic databases

    PaxDbiP0CAP1.
    PRIDEiP0CAP1.

    PTM databases

    PhosphoSiteiP0CAP1.

    Expressioni

    Tissue specificityi

    Detected in heart, liver, skeletal muscle, placenta, small intestine, lung, prostate and testis.2 Publications

    Gene expression databases

    BgeeiP0CAP1.
    GenevestigatoriP0CAP1.

    Organism-specific databases

    HPAiHPA039827.

    Interactioni

    Subunit structurei

    Interacts with DSP, MPRIP and TJP1/ZO1. Interaction with MPRIP inhibits the activation of transcription factor SRF By similarity. Interacts with GRIN1. Interacts with DYNLL1.By similarity3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    DYNLL1P631676EBI-7929343,EBI-349105

    Protein-protein interaction databases

    BioGridi123498. 20 interactions.
    IntActiP0CAP1. 1 interaction.
    MINTiMINT-1370040.

    Structurei

    Secondary structure

    1
    466
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi70 – 778

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2KXSNMR-A70-79[»]
    ProteinModelPortaliP0CAP1.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP0CAP1.

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili96 – 14247Sequence AnalysisAdd
    BLAST
    Coiled coili174 – 418245Sequence AnalysisAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi424 – 4252Required for DYNLL1-binding

    Sequence similaritiesi

    Belongs to the MYZAP family.Curated

    Keywords - Domaini

    Coiled coil, Signal

    Phylogenomic databases

    eggNOGiNOG81402.
    OrthoDBiEOG79PJPG.
    PhylomeDBiP0CAP1.

    Family and domain databases

    InterProiIPR028273. Myozap.
    [Graphical view]
    PANTHERiPTHR23171:SF2. PTHR23171:SF2. 1 hit.

    Sequences (11)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 11 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: P0CAP1-1) [UniParc]FASTAAdd to Basket

    Also known as: Gcom8, Gup1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLRSTSTVTL LSGGAARTPG APSRRANVCR LRLTVPPESP VPEQCEKKIE    50
    RKEQLLDLSN GEPTRKLPQG VVYGVVRRSD QNQQKEMVVY GWSTSQLKEE 100
    MNYIKDVRAT LEKVRKRMYG DYDEMRQKIR QLTQELSVSH AQQEYLENHI 150
    QTQSSALDRF NAMNSALASD SIGLQKTLVD VTLENSNIKD QIRNLQQTYE 200
    ASMDKLREKQ RQLEVAQVEN QLLKMKVESS QEANAEVMRE MTKKLYSQYE 250
    EKLQEEQRKH SAEKEALLEE TNSFLKAIEE ANKKMQAAEI SLEEKDQRIG 300
    ELDRLIERME KERHQLQLQL LEHETEMSGE LTDSDKERYQ QLEEASASLR 350
    ERIRHLDDMV HCQQKKVKQM VEEIESLKKK LQQKQLLILQ LLEKISFLEG 400
    ENNELQSRLD YLTETQAKTE VETREIGVGC DLLPSQTGRT REIVMPSRNY 450
    TPYTRVLELT MKKTLT 466
    Length:466
    Mass (Da):54,206
    Last modified:May 26, 2009 - v1
    Checksum:i2A6B9C464B8641B4
    GO
    Isoform 2 (identifier: P0CAP1-2) [UniParc]FASTAAdd to Basket

    Also known as: Gcom2

    The sequence of this isoform differs from the canonical sequence as follows:
         435-466: SQTGRTREIVMPSRNYTPYTRVLELTMKKTLT → RRCKQSSQRKN

    Show »
    Length:445
    Mass (Da):51,824
    Checksum:iB5586CECD9FE1E47
    GO
    Isoform 3 (identifier: P0CAP1-3) [UniParc]FASTAAdd to Basket

    Also known as: Gcom13

    The sequence of this isoform differs from the canonical sequence as follows:
         108-138: Missing.

    Show »
    Length:435
    Mass (Da):50,381
    Checksum:i50120C5144877080
    GO
    Isoform 4 (identifier: P0CAP1-4) [UniParc]FASTAAdd to Basket

    Also known as: Gcom9, Gup2

    The sequence of this isoform differs from the canonical sequence as follows:
         374-401: Missing.

    Show »
    Length:438
    Mass (Da):50,913
    Checksum:iC87A8E4F6C075852
    GO
    Isoform 5 (identifier: P0CAP1-5) [UniParc]FASTAAdd to Basket

    Also known as: Gcom10

    The sequence of this isoform differs from the canonical sequence as follows:
         375-466: ESLKKKLQQK...LELTMKKTLT → MSHELFSRFSLRLFGR

    Show »
    Length:390
    Mass (Da):45,519
    Checksum:i8188CE8C6E4A4EBF
    GO
    Isoform 6 (identifier: P0CAP1-6) [UniParc]FASTAAdd to Basket

    Also known as: Gcom3

    The sequence of this isoform differs from the canonical sequence as follows:
         402-466: NNELQSRLDY...LELTMKKTLT → GRKGLKGRLKMSC

    Show »
    Length:414
    Mass (Da):48,149
    Checksum:iA2F670D7A9752679
    GO
    Isoform 7 (identifier: P0CAP1-7) [UniParc]FASTAAdd to Basket

    Also known as: Gcom4

    The sequence of this isoform differs from the canonical sequence as follows:
         402-466: NNELQSRLDYLTETQAKTEVETREIGVGCDLLPSQTGRTREIVMPSRNYTPYTRVLELTMKKTLT → VTFSTK

    Show »
    Length:407
    Mass (Da):47,397
    Checksum:i498D9F157C6B072E
    GO
    Isoform 8 (identifier: P0CAP1-8) [UniParc]FASTAAdd to Basket

    Also known as: Gcom5

    The sequence of this isoform differs from the canonical sequence as follows:
         374-466: IESLKKKLQQ...LELTMKKTLT → VTFSTK

    Show »
    Length:379
    Mass (Da):44,104
    Checksum:i981B1A2DA4E222F9
    GO
    Isoform 9 (identifier: P0CAP1-9) [UniParc]FASTAAdd to Basket

    Also known as: Gcom6

    The sequence of this isoform differs from the canonical sequence as follows:
         108-138: Missing.
         374-401: Missing.
         435-466: SQTGRTREIVMPSRNYTPYTRVLELTMKKTLT → RQSRKFEKVLNEFVQLLPLPHHLLWAFGNVCWRRHFGLLQ

    Show »
    Length:415
    Mass (Da):48,231
    Checksum:iF58E12AF16EE9267
    GO
    Isoform 10 (identifier: P0CAP1-10) [UniParc]FASTAAdd to Basket

    Also known as: Gcom11

    The sequence of this isoform differs from the canonical sequence as follows:
         107-175: Missing.

    Show »
    Length:397
    Mass (Da):46,224
    Checksum:i9F313D3BC8F5CBEF
    GO
    Isoform 11 (identifier: P0CAP1-11) [UniParc]FASTAAdd to Basket

    Also known as: Gcom1, GRINL1A complex locus protein 1

    The sequence of this isoform differs from the canonical sequence as follows:
         435-466: SQTGRTREIVMPSRNYTPYTRVLELTMKKTLT → RLPFRQNDSS...EDDDWSSDEF

    Note: Based on a naturally occurring readthrough transcript which produces a MYZAP-POLR2M fusion protein.

    Show »
    Length:550
    Mass (Da):64,046
    Checksum:i6A30A8464C3EA8CB
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti144 – 1463Missing in ADA68358. (PubMed:20093627)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti277 – 2771A → V.2 Publications
    Corresponds to variant rs16977629 [ dbSNP | Ensembl ].
    VAR_055453

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei107 – 17569Missing in isoform 10. 1 PublicationVSP_037389Add
    BLAST
    Alternative sequencei108 – 13831Missing in isoform 9 and isoform 3. 1 PublicationVSP_037390Add
    BLAST
    Alternative sequencei374 – 46693IESLK…KKTLT → VTFSTK in isoform 8. 1 PublicationVSP_037391Add
    BLAST
    Alternative sequencei374 – 40128Missing in isoform 4 and isoform 9. 1 PublicationVSP_037392Add
    BLAST
    Alternative sequencei375 – 46692ESLKK…KKTLT → MSHELFSRFSLRLFGR in isoform 5. 1 PublicationVSP_037393Add
    BLAST
    Alternative sequencei402 – 46665NNELQ…KKTLT → GRKGLKGRLKMSC in isoform 6. 1 PublicationVSP_037394Add
    BLAST
    Alternative sequencei402 – 46665NNELQ…KKTLT → VTFSTK in isoform 7. 1 PublicationVSP_037395Add
    BLAST
    Alternative sequencei435 – 46632SQTGR…KKTLT → RLPFRQNDSSSHCQKSGSPI SSEERRRRDKQHLDDITAAR LLPLHHMPTQLLSIEESLAL QKQQKQNYEEMQAKLAAQKL AERLNIKMRSYNPEGESSGR YREVRDEDDDWSSDEF in isoform 11. 1 PublicationVSP_037397Add
    BLAST
    Alternative sequencei435 – 46632SQTGR…KKTLT → RRCKQSSQRKN in isoform 2. 1 PublicationVSP_037398Add
    BLAST
    Alternative sequencei435 – 46632SQTGR…KKTLT → RQSRKFEKVLNEFVQLLPLP HHLLWAFGNVCWRRHFGLLQ in isoform 9. 1 PublicationVSP_037396Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY207007 mRNA. Translation: AAO39707.1.
    AY207459 mRNA. Translation: AAP41548.1.
    AY208913 mRNA. Translation: AAP41549.1.
    AY237639 mRNA. Translation: AAP75897.1.
    AY331564 mRNA. Translation: AAQ76825.1.
    AY333779 mRNA. Translation: AAQ76826.1.
    AY334560 mRNA. Translation: AAQ76827.1.
    AY334561 mRNA. Translation: AAQ76828.1.
    AY334562 mRNA. Translation: AAQ76829.1.
    AY341345 mRNA. Translation: AAQ76831.1.
    AY353056 mRNA. Translation: AAQ76832.1.
    AY353057 mRNA. Translation: AAQ76833.1.
    AY353058 mRNA. Translation: AAQ76834.1.
    AY353060 mRNA. Translation: AAQ76836.1.
    FJ970029 mRNA. Translation: ADA68358.1.
    AK055535 mRNA. Translation: BAB70944.1.
    AC025271 Genomic DNA. No translation available.
    AC090651 Genomic DNA. No translation available.
    CH471082 Genomic DNA. Translation: EAW77522.1.
    CH471082 Genomic DNA. Translation: EAW77527.1.
    BC101645 mRNA. Translation: AAI01646.1.
    BC112148 mRNA. Translation: AAI12149.1.
    CCDSiCCDS10162.1. [P0CAP1-1]
    CCDS42044.1. [P0CAP1-4]
    RefSeqiNP_001018100.1. NM_001018090.6. [P0CAP1-11]
    NP_001018101.1. NM_001018091.6. [P0CAP1-2]
    NP_001018110.1. NM_001018100.4.
    NP_001018112.1. NM_001018102.2.
    NP_689664.3. NM_152451.7. [P0CAP1-4]
    UniGeneiHs.437256.
    Hs.702937.
    Hs.711270.

    Genome annotation databases

    EnsembliENST00000267853; ENSP00000267853; ENSG00000263155. [P0CAP1-1]
    ENST00000380565; ENSP00000369939; ENSG00000263155. [P0CAP1-4]
    GeneIDi100820829.
    145781.
    81488.
    KEGGihsa:100820829.
    hsa:145781.
    hsa:81488.
    UCSCiuc002aei.3. human. [P0CAP1-1]
    uc002aej.3. human. [P0CAP1-4]
    uc002aem.3. human. [P0CAP1-11]
    uc002aeo.3. human. [P0CAP1-2]

    Polymorphism databases

    DMDMi238064959.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY207007 mRNA. Translation: AAO39707.1 .
    AY207459 mRNA. Translation: AAP41548.1 .
    AY208913 mRNA. Translation: AAP41549.1 .
    AY237639 mRNA. Translation: AAP75897.1 .
    AY331564 mRNA. Translation: AAQ76825.1 .
    AY333779 mRNA. Translation: AAQ76826.1 .
    AY334560 mRNA. Translation: AAQ76827.1 .
    AY334561 mRNA. Translation: AAQ76828.1 .
    AY334562 mRNA. Translation: AAQ76829.1 .
    AY341345 mRNA. Translation: AAQ76831.1 .
    AY353056 mRNA. Translation: AAQ76832.1 .
    AY353057 mRNA. Translation: AAQ76833.1 .
    AY353058 mRNA. Translation: AAQ76834.1 .
    AY353060 mRNA. Translation: AAQ76836.1 .
    FJ970029 mRNA. Translation: ADA68358.1 .
    AK055535 mRNA. Translation: BAB70944.1 .
    AC025271 Genomic DNA. No translation available.
    AC090651 Genomic DNA. No translation available.
    CH471082 Genomic DNA. Translation: EAW77522.1 .
    CH471082 Genomic DNA. Translation: EAW77527.1 .
    BC101645 mRNA. Translation: AAI01646.1 .
    BC112148 mRNA. Translation: AAI12149.1 .
    CCDSi CCDS10162.1. [P0CAP1-1 ]
    CCDS42044.1. [P0CAP1-4 ]
    RefSeqi NP_001018100.1. NM_001018090.6. [P0CAP1-11 ]
    NP_001018101.1. NM_001018091.6. [P0CAP1-2 ]
    NP_001018110.1. NM_001018100.4.
    NP_001018112.1. NM_001018102.2.
    NP_689664.3. NM_152451.7. [P0CAP1-4 ]
    UniGenei Hs.437256.
    Hs.702937.
    Hs.711270.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2KXS NMR - A 70-79 [» ]
    ProteinModelPortali P0CAP1.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123498. 20 interactions.
    IntActi P0CAP1. 1 interaction.
    MINTi MINT-1370040.

    PTM databases

    PhosphoSitei P0CAP1.

    Polymorphism databases

    DMDMi 238064959.

    Proteomic databases

    PaxDbi P0CAP1.
    PRIDEi P0CAP1.

    Protocols and materials databases

    DNASUi 81488.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000267853 ; ENSP00000267853 ; ENSG00000263155 . [P0CAP1-1 ]
    ENST00000380565 ; ENSP00000369939 ; ENSG00000263155 . [P0CAP1-4 ]
    GeneIDi 100820829.
    145781.
    81488.
    KEGGi hsa:100820829.
    hsa:145781.
    hsa:81488.
    UCSCi uc002aei.3. human. [P0CAP1-1 ]
    uc002aej.3. human. [P0CAP1-4 ]
    uc002aem.3. human. [P0CAP1-11 ]
    uc002aeo.3. human. [P0CAP1-2 ]

    Organism-specific databases

    CTDi 100820829.
    145781.
    81488.
    GeneCardsi GC15P057887.
    HGNCi HGNC:43444. MYZAP.
    HPAi HPA039827.
    MIMi 614071. gene.
    neXtProti NX_P0CAP1.
    PharmGKBi PA28986.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG81402.
    OrthoDBi EOG79PJPG.
    PhylomeDBi P0CAP1.

    Miscellaneous databases

    ChiTaRSi MYZAP. human.
    EvolutionaryTracei P0CAP1.
    GeneWikii GRINL1A.
    NextBioi 71714.
    PROi P0CAP1.
    SOURCEi Search...

    Gene expression databases

    Bgeei P0CAP1.
    Genevestigatori P0CAP1.

    Family and domain databases

    InterProi IPR028273. Myozap.
    [Graphical view ]
    PANTHERi PTHR23171:SF2. PTHR23171:SF2. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "The human GRINL1A gene defines a complex transcription unit, an unusual form of gene organization in eukaryotes."
      Roginski R.S., Mohan Raj B.K., Birditt B., Rowen L.
      Genomics 84:265-276(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10 AND 11), TISSUE SPECIFICITY.
      Tissue: Brain and Lung.
    2. "Myozap, a novel intercalated disc protein, activates serum response factor-dependent signaling and is required to maintain cardiac function in vivo."
      Seeger T.S., Frank D., Rohr C., Will R., Just S., Grund C., Lyon R., Luedde M., Koegl M., Sheikh F., Rottbauer W., Franke W.W., Katus H.A., Olson E.N., Frey N.
      Circ. Res. 106:880-890(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT VAL-277, TISSUE SPECIFICITY.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-277.
      Tissue: Heart.
    4. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain cortex.
    7. "GRINL1A colocalizes with N-methyl D-aspartate receptor NR1 subunit and reduces N-methyl D-aspartate toxicity."
      Roginski R.S., Goubaeva F., Mikami M., Fried-Cassorla E., Nair M.R., Yang J.
      NeuroReport 19:1721-1726(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH GRIN1, SUBCELLULAR LOCATION.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Structural basis for the interaction between dynein light chain 1 and the glutamate channel homolog GRINL1A."
      Garcia-Mayoral M.F., Martinez-Moreno M., Albar J.P., Rodriguez-Crespo I., Bruix M.
      FEBS J. 277:2340-2350(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH DYNLL1, MUTAGENESIS OF GLN-436; ARG-448 AND TYR-450.
    10. "Cdc42-dependent formation of the ZO-1/MRCKbeta complex at the leading edge controls cell migration."
      Huo L., Wen W., Wang R., Kam C., Xia J., Feng W., Zhang M.
      EMBO J. 30:665-678(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 70-79 IN COMPLEX WITH TJP1, SUBCELLULAR LOCATION, INTERACTION WITH TJP1.

    Entry informationi

    Entry nameiMYZAP_HUMAN
    AccessioniPrimary (citable) accession number: P0CAP1
    Secondary accession number(s): D2E9U7
    , Q6EER8, Q6EES2, Q6EEV3, Q6EF00, Q6EF01, Q6EF02, Q6EF46, Q6EFN8, Q6EM48, Q6K046, Q6K050, Q6K051, Q6ZQZ3, Q8NC58, Q8NCF3, Q96DI5, Q96JB7, Q96NF5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 26, 2009
    Last sequence update: May 26, 2009
    Last modified: October 1, 2014
    This is version 51 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    The adjacent MYZAP and POLR2M genes are part of a complex transcription unit. The respective transcripts derive from different promoters and are alternatively spliced. In human, some transcripts of the upstream promoter of MYZAP use exons of the downstream POLR2M gene.

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3