Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P0CAP1

- MYZAP_HUMAN

UniProt

P0CAP1 - MYZAP_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Myocardial zonula adherens protein

Gene

MYZAP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Plays a role in cellular signaling via Rho-related GTP-binding proteins and subsequent activation of transcription factor SRF (By similarity). Targets TJP1 to cell junctions. In cortical neurons, may play a role in glutaminergic signal transduction through interaction with the NMDA receptor subunit GRIN1 (By similarity).By similarity

GO - Biological processi

  1. intracellular signal transduction Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Myocardial zonula adherens protein
Alternative name(s):
GRINL1A upstream protein
Short name:
Gup
Gene namesi
Name:MYZAP
Synonyms:MYOZAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:43444. MYZAP.

Subcellular locationi

Cytoplasmcytoskeleton By similarity. Cell membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity. CytoplasmmyofibrilsarcomereI band By similarity. CytoplasmmyofibrilsarcomereZ line By similarity. Cell junction 2 Publications
Note: Detected predominantly at the intercalated disk in cardiomyocytes, and at low levels on sarcomeric Z disks. Colocalizes with F-actin. Colocalizes with cortical actin (By similarity).By similarity

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. cytoskeleton Source: UniProtKB-KW
  3. extrinsic component of cytoplasmic side of plasma membrane Source: UniProtKB
  4. I band Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi436 – 4361Q → G: No effect on DYNLL1-binding; when associated with G-448. 1 Publication
Mutagenesisi448 – 4481R → G: No effect on DYNLL1-binding; when associated with G-436. 1 Publication
Mutagenesisi450 – 4501Y → G: No effect on DYNLL1-binding. 1 Publication

Organism-specific databases

PharmGKBiPA28986.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020Sequence AnalysisAdd
BLAST
Chaini21 – 466446Myocardial zonula adherens proteinPRO_0000376013Add
BLAST

Proteomic databases

MaxQBiP0CAP1.
PaxDbiP0CAP1.
PRIDEiP0CAP1.

PTM databases

PhosphoSiteiP0CAP1.

Expressioni

Tissue specificityi

Detected in heart, liver, skeletal muscle, placenta, small intestine, lung, prostate and testis.2 Publications

Gene expression databases

BgeeiP0CAP1.
ExpressionAtlasiP0CAP1. baseline.
GenevestigatoriP0CAP1.

Organism-specific databases

HPAiHPA039827.

Interactioni

Subunit structurei

Interacts with DSP, MPRIP and TJP1/ZO1. Interaction with MPRIP inhibits the activation of transcription factor SRF (By similarity). Interacts with GRIN1. Interacts with DYNLL1.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
DYNLL1P631676EBI-7929343,EBI-349105

Protein-protein interaction databases

BioGridi123498. 51 interactions.
IntActiP0CAP1. 1 interaction.
MINTiMINT-1370040.

Structurei

Secondary structure

1
466
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi70 – 778

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2KXSNMR-A70-79[»]
ProteinModelPortaliP0CAP1.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP0CAP1.

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili96 – 14247Sequence AnalysisAdd
BLAST
Coiled coili174 – 418245Sequence AnalysisAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi424 – 4252Required for DYNLL1-binding

Sequence similaritiesi

Belongs to the MYZAP family.Curated

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiNOG81402.
GeneTreeiENSGT00530000063232.
InParanoidiP0CAP1.
OrthoDBiEOG79PJPG.
PhylomeDBiP0CAP1.

Family and domain databases

InterProiIPR028273. Myozap.
[Graphical view]
PANTHERiPTHR23171:SF2. PTHR23171:SF2. 1 hit.

Sequences (11)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 11 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: P0CAP1-1) [UniParc]FASTAAdd to Basket

Also known as: Gcom8, Gup1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLRSTSTVTL LSGGAARTPG APSRRANVCR LRLTVPPESP VPEQCEKKIE
60 70 80 90 100
RKEQLLDLSN GEPTRKLPQG VVYGVVRRSD QNQQKEMVVY GWSTSQLKEE
110 120 130 140 150
MNYIKDVRAT LEKVRKRMYG DYDEMRQKIR QLTQELSVSH AQQEYLENHI
160 170 180 190 200
QTQSSALDRF NAMNSALASD SIGLQKTLVD VTLENSNIKD QIRNLQQTYE
210 220 230 240 250
ASMDKLREKQ RQLEVAQVEN QLLKMKVESS QEANAEVMRE MTKKLYSQYE
260 270 280 290 300
EKLQEEQRKH SAEKEALLEE TNSFLKAIEE ANKKMQAAEI SLEEKDQRIG
310 320 330 340 350
ELDRLIERME KERHQLQLQL LEHETEMSGE LTDSDKERYQ QLEEASASLR
360 370 380 390 400
ERIRHLDDMV HCQQKKVKQM VEEIESLKKK LQQKQLLILQ LLEKISFLEG
410 420 430 440 450
ENNELQSRLD YLTETQAKTE VETREIGVGC DLLPSQTGRT REIVMPSRNY
460
TPYTRVLELT MKKTLT
Length:466
Mass (Da):54,206
Last modified:May 26, 2009 - v1
Checksum:i2A6B9C464B8641B4
GO
Isoform 2 (identifier: P0CAP1-2) [UniParc]FASTAAdd to Basket

Also known as: Gcom2

The sequence of this isoform differs from the canonical sequence as follows:
     435-466: SQTGRTREIVMPSRNYTPYTRVLELTMKKTLT → RRCKQSSQRKN

Show »
Length:445
Mass (Da):51,824
Checksum:iB5586CECD9FE1E47
GO
Isoform 3 (identifier: P0CAP1-3) [UniParc]FASTAAdd to Basket

Also known as: Gcom13

The sequence of this isoform differs from the canonical sequence as follows:
     108-138: Missing.

Show »
Length:435
Mass (Da):50,381
Checksum:i50120C5144877080
GO
Isoform 4 (identifier: P0CAP1-4) [UniParc]FASTAAdd to Basket

Also known as: Gcom9, Gup2

The sequence of this isoform differs from the canonical sequence as follows:
     374-401: Missing.

Show »
Length:438
Mass (Da):50,913
Checksum:iC87A8E4F6C075852
GO
Isoform 5 (identifier: P0CAP1-5) [UniParc]FASTAAdd to Basket

Also known as: Gcom10

The sequence of this isoform differs from the canonical sequence as follows:
     375-466: ESLKKKLQQK...LELTMKKTLT → MSHELFSRFSLRLFGR

Show »
Length:390
Mass (Da):45,519
Checksum:i8188CE8C6E4A4EBF
GO
Isoform 6 (identifier: P0CAP1-6) [UniParc]FASTAAdd to Basket

Also known as: Gcom3

The sequence of this isoform differs from the canonical sequence as follows:
     402-466: NNELQSRLDY...LELTMKKTLT → GRKGLKGRLKMSC

Show »
Length:414
Mass (Da):48,149
Checksum:iA2F670D7A9752679
GO
Isoform 7 (identifier: P0CAP1-7) [UniParc]FASTAAdd to Basket

Also known as: Gcom4

The sequence of this isoform differs from the canonical sequence as follows:
     402-466: NNELQSRLDYLTETQAKTEVETREIGVGCDLLPSQTGRTREIVMPSRNYTPYTRVLELTMKKTLT → VTFSTK

Show »
Length:407
Mass (Da):47,397
Checksum:i498D9F157C6B072E
GO
Isoform 8 (identifier: P0CAP1-8) [UniParc]FASTAAdd to Basket

Also known as: Gcom5

The sequence of this isoform differs from the canonical sequence as follows:
     374-466: IESLKKKLQQ...LELTMKKTLT → VTFSTK

Show »
Length:379
Mass (Da):44,104
Checksum:i981B1A2DA4E222F9
GO
Isoform 9 (identifier: P0CAP1-9) [UniParc]FASTAAdd to Basket

Also known as: Gcom6

The sequence of this isoform differs from the canonical sequence as follows:
     108-138: Missing.
     374-401: Missing.
     435-466: SQTGRTREIVMPSRNYTPYTRVLELTMKKTLT → RQSRKFEKVLNEFVQLLPLPHHLLWAFGNVCWRRHFGLLQ

Show »
Length:415
Mass (Da):48,231
Checksum:iF58E12AF16EE9267
GO
Isoform 10 (identifier: P0CAP1-10) [UniParc]FASTAAdd to Basket

Also known as: Gcom11

The sequence of this isoform differs from the canonical sequence as follows:
     107-175: Missing.

Show »
Length:397
Mass (Da):46,224
Checksum:i9F313D3BC8F5CBEF
GO
Isoform 11 (identifier: P0CAP1-11) [UniParc]FASTAAdd to Basket

Also known as: Gcom1, GRINL1A complex locus protein 1

The sequence of this isoform differs from the canonical sequence as follows:
     435-466: SQTGRTREIVMPSRNYTPYTRVLELTMKKTLT → RLPFRQNDSS...EDDDWSSDEF

Note: Based on a naturally occurring readthrough transcript which produces a MYZAP-POLR2M fusion protein.

Show »
Length:550
Mass (Da):64,046
Checksum:i6A30A8464C3EA8CB
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti144 – 1463Missing in ADA68358. (PubMed:20093627)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti277 – 2771A → V.2 Publications
Corresponds to variant rs16977629 [ dbSNP | Ensembl ].
VAR_055453

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei107 – 17569Missing in isoform 10. 1 PublicationVSP_037389Add
BLAST
Alternative sequencei108 – 13831Missing in isoform 9 and isoform 3. 1 PublicationVSP_037390Add
BLAST
Alternative sequencei374 – 46693IESLK…KKTLT → VTFSTK in isoform 8. 1 PublicationVSP_037391Add
BLAST
Alternative sequencei374 – 40128Missing in isoform 4 and isoform 9. 1 PublicationVSP_037392Add
BLAST
Alternative sequencei375 – 46692ESLKK…KKTLT → MSHELFSRFSLRLFGR in isoform 5. 1 PublicationVSP_037393Add
BLAST
Alternative sequencei402 – 46665NNELQ…KKTLT → GRKGLKGRLKMSC in isoform 6. 1 PublicationVSP_037394Add
BLAST
Alternative sequencei402 – 46665NNELQ…KKTLT → VTFSTK in isoform 7. 1 PublicationVSP_037395Add
BLAST
Alternative sequencei435 – 46632SQTGR…KKTLT → RLPFRQNDSSSHCQKSGSPI SSEERRRRDKQHLDDITAAR LLPLHHMPTQLLSIEESLAL QKQQKQNYEEMQAKLAAQKL AERLNIKMRSYNPEGESSGR YREVRDEDDDWSSDEF in isoform 11. 1 PublicationVSP_037397Add
BLAST
Alternative sequencei435 – 46632SQTGR…KKTLT → RRCKQSSQRKN in isoform 2. 1 PublicationVSP_037398Add
BLAST
Alternative sequencei435 – 46632SQTGR…KKTLT → RQSRKFEKVLNEFVQLLPLP HHLLWAFGNVCWRRHFGLLQ in isoform 9. 1 PublicationVSP_037396Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY207007 mRNA. Translation: AAO39707.1.
AY207459 mRNA. Translation: AAP41548.1.
AY208913 mRNA. Translation: AAP41549.1.
AY237639 mRNA. Translation: AAP75897.1.
AY331564 mRNA. Translation: AAQ76825.1.
AY333779 mRNA. Translation: AAQ76826.1.
AY334560 mRNA. Translation: AAQ76827.1.
AY334561 mRNA. Translation: AAQ76828.1.
AY334562 mRNA. Translation: AAQ76829.1.
AY341345 mRNA. Translation: AAQ76831.1.
AY353056 mRNA. Translation: AAQ76832.1.
AY353057 mRNA. Translation: AAQ76833.1.
AY353058 mRNA. Translation: AAQ76834.1.
AY353060 mRNA. Translation: AAQ76836.1.
FJ970029 mRNA. Translation: ADA68358.1.
AK055535 mRNA. Translation: BAB70944.1.
AC025271 Genomic DNA. No translation available.
AC090651 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77522.1.
CH471082 Genomic DNA. Translation: EAW77527.1.
BC101645 mRNA. Translation: AAI01646.1.
BC112148 mRNA. Translation: AAI12149.1.
CCDSiCCDS10162.1. [P0CAP1-1]
CCDS42044.1. [P0CAP1-4]
RefSeqiNP_001018100.1. NM_001018090.6. [P0CAP1-11]
NP_001018101.1. NM_001018091.6. [P0CAP1-2]
NP_001018110.1. NM_001018100.4.
NP_001018112.1. NM_001018102.2.
NP_689664.3. NM_152451.7. [P0CAP1-4]
UniGeneiHs.437256.
Hs.702937.
Hs.711270.

Genome annotation databases

EnsembliENST00000267853; ENSP00000267853; ENSG00000263155. [P0CAP1-1]
ENST00000380565; ENSP00000369939; ENSG00000263155. [P0CAP1-4]
GeneIDi100820829.
145781.
81488.
KEGGihsa:100820829.
hsa:145781.
hsa:81488.
UCSCiuc002aei.3. human. [P0CAP1-1]
uc002aej.3. human. [P0CAP1-4]
uc002aem.3. human. [P0CAP1-11]
uc002aeo.3. human. [P0CAP1-2]

Polymorphism databases

DMDMi238064959.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY207007 mRNA. Translation: AAO39707.1 .
AY207459 mRNA. Translation: AAP41548.1 .
AY208913 mRNA. Translation: AAP41549.1 .
AY237639 mRNA. Translation: AAP75897.1 .
AY331564 mRNA. Translation: AAQ76825.1 .
AY333779 mRNA. Translation: AAQ76826.1 .
AY334560 mRNA. Translation: AAQ76827.1 .
AY334561 mRNA. Translation: AAQ76828.1 .
AY334562 mRNA. Translation: AAQ76829.1 .
AY341345 mRNA. Translation: AAQ76831.1 .
AY353056 mRNA. Translation: AAQ76832.1 .
AY353057 mRNA. Translation: AAQ76833.1 .
AY353058 mRNA. Translation: AAQ76834.1 .
AY353060 mRNA. Translation: AAQ76836.1 .
FJ970029 mRNA. Translation: ADA68358.1 .
AK055535 mRNA. Translation: BAB70944.1 .
AC025271 Genomic DNA. No translation available.
AC090651 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77522.1 .
CH471082 Genomic DNA. Translation: EAW77527.1 .
BC101645 mRNA. Translation: AAI01646.1 .
BC112148 mRNA. Translation: AAI12149.1 .
CCDSi CCDS10162.1. [P0CAP1-1 ]
CCDS42044.1. [P0CAP1-4 ]
RefSeqi NP_001018100.1. NM_001018090.6. [P0CAP1-11 ]
NP_001018101.1. NM_001018091.6. [P0CAP1-2 ]
NP_001018110.1. NM_001018100.4.
NP_001018112.1. NM_001018102.2.
NP_689664.3. NM_152451.7. [P0CAP1-4 ]
UniGenei Hs.437256.
Hs.702937.
Hs.711270.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2KXS NMR - A 70-79 [» ]
ProteinModelPortali P0CAP1.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123498. 51 interactions.
IntActi P0CAP1. 1 interaction.
MINTi MINT-1370040.

PTM databases

PhosphoSitei P0CAP1.

Polymorphism databases

DMDMi 238064959.

Proteomic databases

MaxQBi P0CAP1.
PaxDbi P0CAP1.
PRIDEi P0CAP1.

Protocols and materials databases

DNASUi 81488.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000267853 ; ENSP00000267853 ; ENSG00000263155 . [P0CAP1-1 ]
ENST00000380565 ; ENSP00000369939 ; ENSG00000263155 . [P0CAP1-4 ]
GeneIDi 100820829.
145781.
81488.
KEGGi hsa:100820829.
hsa:145781.
hsa:81488.
UCSCi uc002aei.3. human. [P0CAP1-1 ]
uc002aej.3. human. [P0CAP1-4 ]
uc002aem.3. human. [P0CAP1-11 ]
uc002aeo.3. human. [P0CAP1-2 ]

Organism-specific databases

CTDi 100820829.
145781.
81488.
GeneCardsi GC15P057887.
HGNCi HGNC:43444. MYZAP.
HPAi HPA039827.
MIMi 614071. gene.
neXtProti NX_P0CAP1.
PharmGKBi PA28986.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG81402.
GeneTreei ENSGT00530000063232.
InParanoidi P0CAP1.
OrthoDBi EOG79PJPG.
PhylomeDBi P0CAP1.

Miscellaneous databases

ChiTaRSi MYZAP. human.
EvolutionaryTracei P0CAP1.
GeneWikii GRINL1A.
NextBioi 71714.
PROi P0CAP1.
SOURCEi Search...

Gene expression databases

Bgeei P0CAP1.
ExpressionAtlasi P0CAP1. baseline.
Genevestigatori P0CAP1.

Family and domain databases

InterProi IPR028273. Myozap.
[Graphical view ]
PANTHERi PTHR23171:SF2. PTHR23171:SF2. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The human GRINL1A gene defines a complex transcription unit, an unusual form of gene organization in eukaryotes."
    Roginski R.S., Mohan Raj B.K., Birditt B., Rowen L.
    Genomics 84:265-276(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10 AND 11), TISSUE SPECIFICITY.
    Tissue: Brain and Lung.
  2. "Myozap, a novel intercalated disc protein, activates serum response factor-dependent signaling and is required to maintain cardiac function in vivo."
    Seeger T.S., Frank D., Rohr C., Will R., Just S., Grund C., Lyon R., Luedde M., Koegl M., Sheikh F., Rottbauer W., Franke W.W., Katus H.A., Olson E.N., Frey N.
    Circ. Res. 106:880-890(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT VAL-277, TISSUE SPECIFICITY.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-277.
    Tissue: Heart.
  4. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain cortex.
  7. "GRINL1A colocalizes with N-methyl D-aspartate receptor NR1 subunit and reduces N-methyl D-aspartate toxicity."
    Roginski R.S., Goubaeva F., Mikami M., Fried-Cassorla E., Nair M.R., Yang J.
    NeuroReport 19:1721-1726(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH GRIN1, SUBCELLULAR LOCATION.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Structural basis for the interaction between dynein light chain 1 and the glutamate channel homolog GRINL1A."
    Garcia-Mayoral M.F., Martinez-Moreno M., Albar J.P., Rodriguez-Crespo I., Bruix M.
    FEBS J. 277:2340-2350(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH DYNLL1, MUTAGENESIS OF GLN-436; ARG-448 AND TYR-450.
  10. "Cdc42-dependent formation of the ZO-1/MRCKbeta complex at the leading edge controls cell migration."
    Huo L., Wen W., Wang R., Kam C., Xia J., Feng W., Zhang M.
    EMBO J. 30:665-678(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 70-79 IN COMPLEX WITH TJP1, SUBCELLULAR LOCATION, INTERACTION WITH TJP1.

Entry informationi

Entry nameiMYZAP_HUMAN
AccessioniPrimary (citable) accession number: P0CAP1
Secondary accession number(s): D2E9U7
, Q6EER8, Q6EES2, Q6EEV3, Q6EF00, Q6EF01, Q6EF02, Q6EF46, Q6EFN8, Q6EM48, Q6K046, Q6K050, Q6K051, Q6ZQZ3, Q8NC58, Q8NCF3, Q96DI5, Q96JB7, Q96NF5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 26, 2009
Last sequence update: May 26, 2009
Last modified: October 29, 2014
This is version 52 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The adjacent MYZAP and POLR2M genes are part of a complex transcription unit. The respective transcripts derive from different promoters and are alternatively spliced. In human, some transcripts of the upstream promoter of MYZAP use exons of the downstream POLR2M gene.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3