Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WAS/WASL-interacting protein family member 3

Gene

Wipf3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be a regulator of cytoskeletal organization (Potential). May have a role in spermatogenesis.Curated1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
WAS/WASL-interacting protein family member 3
Alternative name(s):
Corticosteroids and regional expression protein 16 homolog
Gene namesi
Name:Wipf3
Synonyms:Cr16
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:3044681. Wipf3.

Subcellular locationi

  • Cytoplasm 1 Publication

  • Note: In hippocampal neurons colocalizes with WASL in the cell body, axons and the growth cone (By similarity). Localizes to the actin filaments at the Sertoli cell-spermatid junctions.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Disruption phenotypei

Mice are normal but males are sterile due to defects in spermatogenesis.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003379981 – 485WAS/WASL-interacting protein family member 3Add BLAST485

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei57Asymmetric dimethylarginineCombined sources1
Modified residuei161PhosphoserineCombined sources1
Modified residuei211PhosphoserineBy similarity1
Modified residuei392PhosphoserineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

MaxQBiP0C7L0.
PaxDbiP0C7L0.
PRIDEiP0C7L0.

PTM databases

iPTMnetiP0C7L0.
PhosphoSitePlusiP0C7L0.

Expressioni

Tissue specificityi

Isoform 1 is expressed in brain and testis and isoform 2 is expressed only in brain (at protein level).1 Publication

Interactioni

Subunit structurei

Interacts with WASL, and monomeric and filamentous actin.By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000120240.

Structurei

3D structure databases

ProteinModelPortaliP0C7L0.
SMRiP0C7L0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini56 – 73WH2PROSITE-ProRule annotationAdd BLAST18

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi3 – 8Profilin-binding motif6
Motifi11 – 16Profilin-binding motif6
Motifi31 – 36Profilin-binding motif6
Motifi69 – 72RLRK4
Motifi424 – 448WASP-binding motifAdd BLAST25

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi184 – 201Poly-ProAdd BLAST18
Compositional biasi232 – 246Poly-ProAdd BLAST15
Compositional biasi296 – 312Poly-ProAdd BLAST17

Domaini

The WH2 domain is found in a number of putative actin-binding proteins.By similarity
The profilin-binding motif has been implicated in the interaction with profilin and SH3 domains.By similarity
The KLKR motif is essential for G-actin binding and for actin polymerization.By similarity

Sequence similaritiesi

Contains 1 WH2 domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410J09R. Eukaryota.
ENOG410Y0AH. LUCA.
HOGENOMiHOG000090003.
HOVERGENiHBG108677.
InParanoidiP0C7L0.
PhylomeDBiP0C7L0.

Family and domain databases

InterProiIPR003124. WH2_dom.
[Graphical view]
PfamiPF02205. WH2. 1 hit.
[Graphical view]
SMARTiSM00246. WH2. 1 hit.
[Graphical view]
PROSITEiPS51082. WH2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P0C7L0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVPPPPPPP PPPPPPPPPP LGAPPPPPLG APPPPPPPGP PVSTDTPSLR
60 70 80 90 100
KPDLKGRSAL LADIQQGTRL RKVTQINDRS APQIEGSKGT SKEGGAAGSN
110 120 130 140 150
ARGGNTPPAL GDLFAGGFPV LRPAGQRDVS GGKSGQGPGS RAPSPRLPIK
160 170 180 190 200
AISGPLPAPA SPRLGNASET HSSARPVPPR PSVPAPPPPT PPPPPPPPLP
210 220 230 240 250
PASPIKAQLV SPPAPPTKVN PSVVPPPLPC APPLPPPPPT PPPLPPASAL
260 270 280 290 300
SDKAVRPQLA PLHLPPIPPP LPLLPPCGYP GLHSEPNSPA QEVREPPAPP
310 320 330 340 350
PPPPPPPPPP LPTYASCSSR TAVAPPPLPG ANNSGSETPP PLPPKSPSFQ
360 370 380 390 400
TQKALPTPPG APGPQAILQK KRRGPGTSGG KLNPPPAPPA RSPTTELSSK
410 420 430 440 450
SQQPGGQLRN GGQHAIDDFE SKFTFHSMED FPPPDEYKPC QKIYPSKVPR
460 470 480
SRTPGSWLQA EAAGQSSDDI KSRNSQLSLK ALPVR
Length:485
Mass (Da):49,453
Last modified:June 10, 2008 - v1
Checksum:i1ACA37E855D40447
GO
Isoform 2 (identifier: P0C7L0-2) [UniParc]FASTAAdd to basket
Also known as: deltains

The sequence of this isoform differs from the canonical sequence as follows:
     417-451: DDFESKFTFHSMEDFPPPDEYKPCQKIYPSKVPRS → G

Show »
Length:451
Mass (Da):45,334
Checksum:i1E61F3B3E4769E20
GO

Sequence cautioni

The sequence CB723002 differs from that shown. Reason: Frameshift at position 621.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti482L → LPV (PubMed:17573773).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_034030417 – 451DDFES…KVPRS → G in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC087841 Genomic DNA. No translation available.
BQ952480 mRNA. No translation available.
CB723002 mRNA. No translation available.
UniGeneiMm.434326.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC087841 Genomic DNA. No translation available.
BQ952480 mRNA. No translation available.
CB723002 mRNA. No translation available.
UniGeneiMm.434326.

3D structure databases

ProteinModelPortaliP0C7L0.
SMRiP0C7L0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000120240.

PTM databases

iPTMnetiP0C7L0.
PhosphoSitePlusiP0C7L0.

Proteomic databases

MaxQBiP0C7L0.
PaxDbiP0C7L0.
PRIDEiP0C7L0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

MGIiMGI:3044681. Wipf3.

Phylogenomic databases

eggNOGiENOG410J09R. Eukaryota.
ENOG410Y0AH. LUCA.
HOGENOMiHOG000090003.
HOVERGENiHBG108677.
InParanoidiP0C7L0.
PhylomeDBiP0C7L0.

Miscellaneous databases

ChiTaRSiWipf3. mouse.
PROiP0C7L0.
SOURCEiSearch...

Family and domain databases

InterProiIPR003124. WH2_dom.
[Graphical view]
PfamiPF02205. WH2. 1 hit.
[Graphical view]
SMARTiSM00246. WH2. 1 hit.
[Graphical view]
PROSITEiPS51082. WH2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiWIPF3_MOUSE
AccessioniPrimary (citable) accession number: P0C7L0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: November 2, 2016
This is version 49 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.