Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 159

Gene

CCDC159

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:G66-33079-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 159
Gene namesi
Name:CCDC159
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:26996. CCDC159.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000183401.

Polymorphism and mutation databases

DMDMi189041677.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003329961 – 412Coiled-coil domain-containing protein 159Add BLAST412

Proteomic databases

PaxDbiP0C7I6.
PRIDEiP0C7I6.

PTM databases

iPTMnetiP0C7I6.
PhosphoSitePlusiP0C7I6.

Expressioni

Gene expression databases

BgeeiENSG00000183401.
ExpressionAtlasiP0C7I6. baseline and differential.
GenevisibleiP0C7I6. HS.

Organism-specific databases

HPAiHPA047126.
HPA054655.

Interactioni

Protein-protein interaction databases

BioGridi125955. 1 interactor.
STRINGi9606.ENSP00000402239.

Structurei

3D structure databases

ProteinModelPortaliP0C7I6.
SMRiP0C7I6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili262 – 298Sequence analysisAdd BLAST37

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410J016. Eukaryota.
ENOG41114KW. LUCA.
GeneTreeiENSGT00390000008201.
HOGENOMiHOG000139146.
HOVERGENiHBG106503.
InParanoidiP0C7I6.
OMAiWPETEEI.
OrthoDBiEOG091G0A8B.
PhylomeDBiP0C7I6.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P0C7I6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLLPASDPLL AGLPRDPDYS VSCLYSPPSP SSMCLPANMK CDKYWGSSSD
60 70 80 90 100
KALERTAHWS RTPEPETLGC PASGDTVRTA DCRPGWGSGP SPHEAAPSPS
110 120 130 140 150
PDLQKQCCND QDILKRHHNV AKKPLETSSS KVKAKTIVMI PDSQKLLRCE
160 170 180 190 200
LESLKSQLQA QTKAFEFLNH SVTMLEKESC LQQIKIQQLE EVLSPTGRQG
210 220 230 240 250
EKEEHKWGME QGRQELYGAL TQGLQGLEKT LRDSEEMQRA RTTRCLQLLA
260 270 280 290 300
QEIRDSKKFL WEELELVREE VTFIYQKLQA QEDEISENLV NIQKMQKTQV
310 320 330 340 350
KCRKILTKMK QQGHETAACP ETEEIPQGAS GCWKDDLQKE LSDIWSAVHV
360 370 380 390 400
LQNSIDSLTL CSGACPKASS LRGHKGHQCL SPPLPSWDSD SDCDQDLSQP
410
PFSKSGRSFP PA
Note: No experimental confirmation.
Length:412
Mass (Da):46,012
Last modified:May 20, 2008 - v1
Checksum:i9877797635431886
GO
Isoform 2 (identifier: P0C7I6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-115: Missing.
     116-122: RHHNVAK → MGEHEQV

Show »
Length:297
Mass (Da):33,695
Checksum:i95D3A4E0B23F60C0
GO
Isoform 3 (identifier: P0C7I6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-116: Missing.
     117-122: HHNVAK → MNRWYV
     256-292: SKKFLWEELELVREEVTFIYQKLQAQEDEISENLVNI → RSGMAGGQLGVHRREGRPRTGEWRQDGGNGRCLGEGD
     293-412: Missing.

Show »
Length:176
Mass (Da):20,071
Checksum:i9A3A3656D9C92A63
GO
Isoform 4 (identifier: P0C7I6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-122: HHNVAK → MNRWYV

Show »
Length:412
Mass (Da):46,175
Checksum:iA00E55F917007E7F
GO
Isoform 5 (identifier: P0C7I6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-115: Missing.
     116-122: RHHNVAK → MGEHEQV
     256-292: SKKFLWEELELVREEVTFIYQKLQAQEDEISENLVNI → RSGMAGGQLGVHRREGRPRTGEWRQDGGNGRCLGEGD
     293-412: Missing.

Show »
Length:177
Mass (Da):20,032
Checksum:i059CA67AB49C90AB
GO

Sequence cautioni

The sequence BAG63130 differs from that shown. Intron retention.Curated
The sequence BC038439 differs from that shown. Reason: Frameshift at position 55.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti121A → S in BC038439 (PubMed:15057824).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043032393C → S.Corresponds to variant rs6887dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0405351 – 116Missing in isoform 3. 1 PublicationAdd BLAST116
Alternative sequenceiVSP_0405361 – 115Missing in isoform 2 and isoform 5. 1 PublicationAdd BLAST115
Alternative sequenceiVSP_040537116 – 122RHHNVAK → MGEHEQV in isoform 2 and isoform 5. 1 Publication7
Alternative sequenceiVSP_040538117 – 122HHNVAK → MNRWYV in isoform 3 and isoform 4. 1 Publication6
Alternative sequenceiVSP_040539256 – 292SKKFL…NLVNI → RSGMAGGQLGVHRREGRPRT GEWRQDGGNGRCLGEGD in isoform 3 and isoform 5. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_040540293 – 412Missing in isoform 3 and isoform 5. 1 PublicationAdd BLAST120

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK293611 mRNA. Translation: BAG57074.1.
AK301653 mRNA. Translation: BAG63130.1. Sequence problems.
AK303641 mRNA. Translation: BAG64645.1.
AK316339 mRNA. Translation: BAH14710.1.
AC024575 Genomic DNA. No translation available.
BC038439 mRNA. No translation available.
CCDSiCCDS45976.1. [P0C7I6-2]
RefSeqiNP_001073972.2. NM_001080503.2. [P0C7I6-2]
UniGeneiHs.631636.

Genome annotation databases

EnsembliENST00000458408; ENSP00000402239; ENSG00000183401. [P0C7I6-2]
ENST00000588790; ENSP00000468232; ENSG00000183401. [P0C7I6-2]
GeneIDi126075.
KEGGihsa:126075.
UCSCiuc010xlt.3. human. [P0C7I6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK293611 mRNA. Translation: BAG57074.1.
AK301653 mRNA. Translation: BAG63130.1. Sequence problems.
AK303641 mRNA. Translation: BAG64645.1.
AK316339 mRNA. Translation: BAH14710.1.
AC024575 Genomic DNA. No translation available.
BC038439 mRNA. No translation available.
CCDSiCCDS45976.1. [P0C7I6-2]
RefSeqiNP_001073972.2. NM_001080503.2. [P0C7I6-2]
UniGeneiHs.631636.

3D structure databases

ProteinModelPortaliP0C7I6.
SMRiP0C7I6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125955. 1 interactor.
STRINGi9606.ENSP00000402239.

PTM databases

iPTMnetiP0C7I6.
PhosphoSitePlusiP0C7I6.

Polymorphism and mutation databases

DMDMi189041677.

Proteomic databases

PaxDbiP0C7I6.
PRIDEiP0C7I6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000458408; ENSP00000402239; ENSG00000183401. [P0C7I6-2]
ENST00000588790; ENSP00000468232; ENSG00000183401. [P0C7I6-2]
GeneIDi126075.
KEGGihsa:126075.
UCSCiuc010xlt.3. human. [P0C7I6-1]

Organism-specific databases

CTDi126075.
GeneCardsiCCDC159.
HGNCiHGNC:26996. CCDC159.
HPAiHPA047126.
HPA054655.
neXtProtiNX_P0C7I6.
OpenTargetsiENSG00000183401.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J016. Eukaryota.
ENOG41114KW. LUCA.
GeneTreeiENSGT00390000008201.
HOGENOMiHOG000139146.
HOVERGENiHBG106503.
InParanoidiP0C7I6.
OMAiWPETEEI.
OrthoDBiEOG091G0A8B.
PhylomeDBiP0C7I6.

Enzyme and pathway databases

BioCyciZFISH:G66-33079-MONOMER.

Miscellaneous databases

ChiTaRSiCCDC159. human.
GenomeRNAii126075.
PROiP0C7I6.

Gene expression databases

BgeeiENSG00000183401.
ExpressionAtlasiP0C7I6. baseline and differential.
GenevisibleiP0C7I6. HS.

Family and domain databases

ProtoNetiSearch...

Entry informationi

Entry nameiCC159_HUMAN
AccessioniPrimary (citable) accession number: P0C7I6
Secondary accession number(s): B4DEG3
, B4DWR8, B4E133, B7ZAM4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: November 2, 2016
This is version 56 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.