Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 159

Gene

CCDC159

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 159
Gene namesi
Name:CCDC159
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000183401.11
HGNCiHGNC:26996 CCDC159
neXtProtiNX_P0C7I6

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000183401

Polymorphism and mutation databases

DMDMi189041677

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003329961 – 297Coiled-coil domain-containing protein 159Add BLAST297

Proteomic databases

PaxDbiP0C7I6
PeptideAtlasiP0C7I6
PRIDEiP0C7I6
ProteomicsDBi52337
52338 [P0C7I6-2]

PTM databases

iPTMnetiP0C7I6
PhosphoSitePlusiP0C7I6

Expressioni

Gene expression databases

BgeeiENSG00000183401
ExpressionAtlasiP0C7I6 baseline and differential
GenevisibleiP0C7I6 HS

Organism-specific databases

HPAiHPA047126
HPA054655

Interactioni

Protein-protein interaction databases

BioGridi125955, 1 interactor

Structurei

3D structure databases

SMRiP0C7I6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili147 – 297Sequence analysisAdd BLAST151

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410J016 Eukaryota
ENOG41114KW LUCA
GeneTreeiENSGT00390000008201
HOGENOMiHOG000139146
HOVERGENiHBG106503
InParanoidiP0C7I6
OMAiKSTMMIP
OrthoDBiEOG091G0A8B
PhylomeDBiP0C7I6

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: P0C7I6-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGEHEQVKPL ETSSSKVKAK TIVMIPDSQK LLRCELESLK SQLQAQTKAF
60 70 80 90 100
EFLNHSVTML EKESCLQQIK IQQLEEVLSP TGRQGEKEEH KWGMEQGRQE
110 120 130 140 150
LYGALTQGLQ GLEKTLRDSE EMQRARTTRC LQLLAQEIRD SKKFLWEELE
160 170 180 190 200
LVREEVTFIY QKLQAQEDEI SENLVNIQKM QKTQVKCRKI LTKMKQQGHE
210 220 230 240 250
TAACPETEEI PQGASGCWKD DLQKELSDIW SAVHVLQNSI DSLTLCSGAC
260 270 280 290
PKASSLRGHK GHQCLSPPLP SWDSDSDCDQ DLSQPPFSKS GRSFPPA
Length:297
Mass (Da):33,695
Last modified:March 28, 2018 - v2
Checksum:i95D3A4E0B23F60C0
GO
Isoform 3 (identifier: P0C7I6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MGEHEQ → MNRWY
     141-177: SKKFLWEELELVREEVTFIYQKLQAQEDEISENLVNI → RSGMAGGQLGVHRREGRPRTGEWRQDGGNGRCLGEGD
     178-297: Missing.

Show »
Length:176
Mass (Da):20,071
Checksum:i9A3A3656D9C92A63
GO
Isoform 4 (identifier: P0C7I6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MGEHEQ → MNRWY

Show »
Length:296
Mass (Da):33,734
Checksum:iD4DCE4C1384ED418
GO
Isoform 5 (identifier: P0C7I6-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-177: SKKFLWEELELVREEVTFIYQKLQAQEDEISENLVNI → RSGMAGGQLGVHRREGRPRTGEWRQDGGNGRCLGEGD
     178-297: Missing.

Show »
Length:177
Mass (Da):20,032
Checksum:i059CA67AB49C90AB
GO

Sequence cautioni

The sequence BAG63130 differs from that shown. Intron retention.Curated
The sequence BC038439 differs from that shown. Cloning artifact.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043032278C → S. Corresponds to variant dbSNP:rs6887Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0595131 – 6MGEHEQ → MNRWY in isoform 3 and isoform 4. 6
Alternative sequenceiVSP_059514141 – 177SKKFL…NLVNI → RSGMAGGQLGVHRREGRPRT GEWRQDGGNGRCLGEGD in isoform 3 and isoform 5. Add BLAST37
Alternative sequenceiVSP_059515178 – 297Missing in isoform 3 and isoform 5. Add BLAST120

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK293611 mRNA Translation: BAG57074.1
AK301653 mRNA Translation: BAG63130.1 Sequence problems.
AK303641 mRNA Translation: BAG64645.1
AK316339 mRNA Translation: BAH14710.1
AC024575 Genomic DNA No translation available.
BC038439 mRNA No translation available.
CCDSiCCDS45976.1 [P0C7I6-2]
RefSeqiNP_001073972.2, NM_001080503.2 [P0C7I6-2]
XP_016881749.1, XM_017026260.1 [P0C7I6-7]
UniGeneiHs.631636

Genome annotation databases

EnsembliENST00000458408; ENSP00000402239; ENSG00000183401 [P0C7I6-2]
ENST00000588790; ENSP00000468232; ENSG00000183401 [P0C7I6-2]
GeneIDi126075
KEGGihsa:126075
UCSCiuc010xlt.3 human [P0C7I6-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCC159_HUMAN
AccessioniPrimary (citable) accession number: P0C7I6
Secondary accession number(s): B4DEG3
, B4DWR8, B4E133, B7ZAM4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: March 28, 2018
Last modified: June 20, 2018
This is version 66 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health