P0C215 (P12I_HTL1A) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 22.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Accessory protein p12I |
| Organism | Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) (HTLV-1) [Complete proteome] |
| Taxonomic identifier | 11926 [NCBI] |
| Taxonomic lineage | Viruses › Retro-transcribing viruses › Retroviridae › Orthoretrovirinae › Deltaretrovirus › ![]() |
| Virus host | Homo sapiens (Human) [TaxID: 9606] |
Protein attributes
| Sequence length | 99 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | p12I is a modulator of T-lymphocyte proliferation and immune function and may contribute to establish a persistent infection. Binds and down-modulates cell surface expression of interleukin-2 receptors IL2RB and IL2RG. Also down-modulates cell surface MHC-I molecules by binding to free immature MHC-I heavy chains in the ER and targeting them to the proteasome for degradation. Binding to IL2RB mediates recruitment of JAK1 and JAK3. As a result of this interaction, p12I increases DNA-binding and transcriptional activity of STAT5 By similarity. Ref.8 Ref.9 |
| Subunit structure | p12I is a homodimer. Interacts with human CANX, CALR, ATP6V0C, IL2RB, IL2RG. Binds to MHC-I heavy chains HLA-A2, HLA-B7 and HLA-Cw4. Ref.4 Ref.5 Ref.6 Ref.7 Ref.9 |
| Subcellular location | Isoform p12I: Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus › host cis-Golgi network membrane; Multi-pass membrane protein Potential Ref.2 Ref.7. |
| Post-translational modification | Ubiquitinated; a fraction of P12I is degraded via the ubiquitin system. Ref.4 |
| Miscellaneous | Lys-88 seems to be associated with tropical spastic paraparesis/HTLV-1-associated myelopathy (TSP/HAM). HTLV-1 lineages are divided in four clades, A (Cosmopolitan), B (Central African group), C (Melanesian group) and D (New Central African group). |
| Sequence similarities | Belongs to the HTLV-1 accessory protein p12I family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Evasion of host immunity by viral interleukin-like protein Host-virus interaction Inhibition of host MHC class I molecule presentation by virus Inhibition of host adaptive immune response by virus Viral immunoevasion |
| Cellular component | Host Golgi apparatus Host endoplasmic reticulum Host membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | SH3-binding Transmembrane Transmembrane helix |
| PTM | Isopeptide bond Ubl conjugation |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological_process | suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | host cell Golgi apparatus Inferred from electronic annotation. Source: UniProtKB-SubCell host cell endoplasmic reticulum membraneInferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform p12I (identifier: P0C215-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform p27I (identifier: P0C215-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MPKTRRRPRRSQRKRPPTPWQLPPFSLQGLHLAFQLSSIAINPQLLHFFFPST |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 99 | 99 | Accessory protein p12I | PRO_0000259953 | |||||
Regions | |||||||||
| Transmembrane | 3 – 23 | 21 | Helical; Potential | ||||||
| Transmembrane | 48 – 68 | 21 | Helical; Potential | ||||||
| Motif | 4 – 11 | 8 | SH3-binding Potential | ||||||
| Motif | 33 – 38 | 6 | SH3-binding Potential | ||||||
| Motif | 70 – 77 | 8 | SH3-binding Potential | ||||||
| Motif | 88 – 93 | 6 | SH3-binding Potential | ||||||
| Compositional bias | 1 – 72 | 72 | Leu-rich | ||||||
Amino acid modifications | |||||||||
| Cross-link | 88 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); in isolate LAF | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MPKTRRRPRRSQRKRPPTPW QLPPFSLQGLHLAFQLSSIA INPQLLHFFFPST in isoform p27I. | VSP_021562 | |||||
| Natural variant | 23 – 25 | 3 | PPS → SPG in strain: Isolate LAF. | ||||||
| Natural variant | 51 | 1 | G → N in strain: Isolate LAF. | ||||||
| Natural variant | 74 | 1 | I → L in strain: Isolate LAF. | ||||||
| Natural variant | 88 | 1 | K → R in strain: Isolate ATK-1. | ||||||
Experimental info | |||||||||
| Mutagenesis | 88 | 1 | K → R: Increases the steady state of p12I. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Human adult T-cell leukemia virus: complete nucleotide sequence of the provirus genome integrated in leukemia cell DNA." Seiki M., Hattori S., Hirayama Y., Yoshida M.C. Proc. Natl. Acad. Sci. U.S.A. 80:3618-3622(1983) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [2] | "The p12I, p13II, and p30II proteins encoded by human T-cell leukemia/lymphotropic virus type I open reading frames I and II are localized in three different cellular compartments." Koralnik I.J., Fullen J., Franchini G. J. Virol. 67:2360-2366(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS P27I AND P12I), SUBCELLULAR LOCATION OF P12I. |
| [3] | "Protein isoforms encoded by the pX region of human T-cell leukemia/lymphotropic virus type I." Koralnik I.J., Gessain A., Klotman M.E., Lo Monico A., Berneman Z.N., Franchini G. Proc. Natl. Acad. Sci. U.S.A. 89:8813-8817(1992) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS P27I AND P12I). Strain: Isolate LAF. |
| [4] | "A lysine-to-arginine change found in natural alleles of the human T-cell lymphotropic/leukemia virus type 1 p12(I) protein greatly influences its stability." Trovato R., Mulloy J.C., Johnson J.M., Takemoto S., de Oliveira M.P., Franchini G. J. Virol. 73:6460-6467(1999) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT, UBIQUITINATION, MUTAGENESIS OF LYS-88. Strain: Isolate LAF. |
| [5] | "Mapping of the intermolecular association of human T cell leukaemia/lymphotropic virus type I p12I and the vacuolar H+-ATPase 16 kDa subunit protein." Koralnik I.J., Mulloy J.C., Andresson T., Fullen J., Franchini G. J. Gen. Virol. 76:1909-1916(1995) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION OF P12I WITH HUMAN ATP6V0C. Strain: Isolate LAF. |
| [6] | "The human T-cell leukemia/lymphotropic virus type 1 p12I proteins bind the interleukin-2 receptor beta and gammac chains and affects their expression on the cell surface." Mulloy J.C., Crownley R.W., Fullen J., Leonard W.J., Franchini G. J. Virol. 70:3599-3605(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HUMAN IL2RB AND IL2RG. Strain: Isolate LAF. |
| [7] | "Endoplasmic reticulum and cis-Golgi localization of human T-lymphotropic virus type 1 p12(I): association with calreticulin and calnexin." Ding W., Albrecht B., Luo R., Zhang W., Stanley J.R., Newbound G.C., Lairmore M.D. J. Virol. 75:7672-7682(2001) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION OF P12I, INTERACTION OF P12I WITH HUMAN CANX AND CALR. |
| [8] | "HTLV-1 p12(I) protein enhances STAT5 activation and decreases the interleukin-2 requirement for proliferation of primary human peripheral blood mononuclear cells." Nicot C., Mulloy J.C., Ferrari M.G., Johnson J.M., Fu K., Fukumoto R., Trovato R., Fullen J., Leonard W.J., Franchini G. Blood 98:823-829(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [9] | "Free major histocompatibility complex class I heavy chain is preferentially targeted for degradation by human T-cell leukemia/lymphotropic virus type 1 p12(I) protein." Johnson J.M., Nicot C., Fullen J., Ciminale V., Casareto L., Mulloy J.C., Jacobson S., Franchini G. J. Virol. 75:6086-6094(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MHC-I HLA-A2; HLA-B7 AND HLA-CW4. Strain: Isolate LAF. |
| [10] | "Human T-cell leukemia/lymphoma virus type 1 nonstructural genes and their functions." Nicot C., Harrod R.L., Ciminale V., Franchini G. Oncogene 24:6026-6034(2005) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | J02029 Genomic DNA. No translation available. L08432 mRNA. No translation available. |
3D structure databases | |
| ModBase | Search... |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Family and domain databases | |
| InterPro | IPR021086. p12I. [Graphical view] |
| Pfam | PF12233. p12I. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | P12I_HTL1A | ||||||||
| Accession | Primary (citable) accession number: P0C215 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Viral Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
