Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P09132

- SRP19_HUMAN

UniProt

P09132 - SRP19_HUMAN

Protein

Signal recognition particle 19 kDa protein

Gene

SRP19

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

    GO - Molecular functioni

    1. 7S RNA binding Source: UniProtKB
    2. poly(A) RNA binding Source: UniProtKB

    GO - Biological processi

    1. cellular protein metabolic process Source: Reactome
    2. cotranslational protein targeting to membrane Source: ProtInc
    3. gene expression Source: Reactome
    4. response to drug Source: UniProtKB
    5. SRP-dependent cotranslational protein targeting to membrane Source: Reactome
    6. translation Source: Reactome

    Keywords - Molecular functioni

    Ribonucleoprotein

    Keywords - Ligandi

    RNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_115902. SRP-dependent cotranslational protein targeting to membrane.

    Protein family/group databases

    TCDBi3.A.5.9.1. the general secretory pathway (sec) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Signal recognition particle 19 kDa protein
    Short name:
    SRP19
    Gene namesi
    Name:SRP19
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:11300. SRP19.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. cytosol Source: Reactome
    3. mitochondrion Source: HPA
    4. nucleolus Source: MGI
    5. nucleus Source: HPA
    6. signal recognition particle, endoplasmic reticulum targeting Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Signal recognition particle

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA36124.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 144144Signal recognition particle 19 kDa proteinPRO_0000135197Add
    BLAST

    Proteomic databases

    MaxQBiP09132.
    PaxDbiP09132.
    PRIDEiP09132.

    PTM databases

    PhosphoSiteiP09132.

    Expressioni

    Gene expression databases

    BgeeiP09132.
    CleanExiHS_SRP19.
    GenevestigatoriP09132.

    Organism-specific databases

    HPAiHPA029272.

    Interactioni

    Subunit structurei

    Signal recognition particle consists of a 7S RNA molecule of 300 nucleotides and six protein subunits: SRP72, SRP68, SRP54, SRP19, SRP14 and SRP9.2 Publications

    Protein-protein interaction databases

    BioGridi112606. 13 interactions.
    IntActiP09132. 6 interactions.
    MINTiMINT-247583.
    STRINGi9606.ENSP00000282999.

    Structurei

    Secondary structure

    1
    144
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi12 – 143
    Beta strandi15 – 184
    Helixi20 – 234
    Turni29 – 324
    Turni37 – 393
    Beta strandi41 – 433
    Helixi46 – 5510
    Beta strandi60 – 634
    Helixi76 – 783
    Beta strandi81 – 844
    Beta strandi89 – 913
    Beta strandi93 – 953
    Helixi101 – 11111
    Helixi112 – 1143
    Helixi116 – 1194

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1JIDX-ray1.80A1-120[»]
    1MFQX-ray3.10B14-120[»]
    1RY1electron microscopy12.00B14-120[»]
    2J37electron microscopy8.00B14-120[»]
    3KTVX-ray3.80B/D1-120[»]
    4P3EX-ray3.50B1-120[»]
    DisProtiDP00570.
    ProteinModelPortaliP09132.
    SMRiP09132. Positions 5-118.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP09132.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni136 – 1449Basic region, potentially involved in RNA-binding

    Sequence similaritiesi

    Belongs to the SRP19 family.Curated

    Phylogenomic databases

    eggNOGiNOG265516.
    HOGENOMiHOG000237221.
    HOVERGENiHBG059463.
    InParanoidiP09132.
    KOiK03105.
    OMAiRWICIYP.
    OrthoDBiEOG72G199.
    PhylomeDBiP09132.
    TreeFamiTF106248.

    Family and domain databases

    Gene3Di3.30.56.30. 1 hit.
    InterProiIPR002778. Signal_recog_particle_SRP19.
    [Graphical view]
    PANTHERiPTHR17453. PTHR17453. 1 hit.
    PfamiPF01922. SRP19. 1 hit.
    [Graphical view]
    SUPFAMiSSF69695. SSF69695. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P09132-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MACAAARSPA DQDRFICIYP AYLNNKKTIA EGRRIPISKA VENPTATEIQ    50
    DVCSAVGLNV FLEKNKMYSR EWNRDVQYRG RVRVQLKQED GSLCLVQFPS 100
    RKSVMLYAAE MIPKLKTRTQ KTGGADQSLQ QGEGSKKGKG KKKK 144
    Length:144
    Mass (Da):16,156
    Last modified:October 3, 2006 - v3
    Checksum:iE25F661972338CAE
    GO
    Isoform 2 (identifier: P09132-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         101-144: RKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK → HYTLSLTSGS

    Note: No experimental confirmation available.

    Show »
    Length:110
    Mass (Da):12,400
    Checksum:iF199656A14C743E1
    GO
    Isoform 3 (identifier: P09132-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         15-144: FICIYPAYLN...SKKGKGKKKK → LLKILQLQRF...ALYSSHHVSQ

    Show »
    Length:78
    Mass (Da):8,739
    Checksum:i55C1707F8C5C2AE0
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti4 – 41A → T.1 Publication
    Corresponds to variant rs17855423 [ dbSNP | Ensembl ].
    VAR_027800

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei15 – 144130FICIY…GKKKK → LLKILQLQRFKMYVQQLDLT YFLRKIKCTLENGIVMSNTE AESGSSSNRKMGASALYSSH HVSQ in isoform 3. 1 PublicationVSP_044524Add
    BLAST
    Alternative sequencei101 – 14444RKSVM…GKKKK → HYTLSLTSGS in isoform 2. 1 PublicationVSP_042540Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X12791 mRNA. Translation: CAA31280.1.
    BU661702 mRNA. No translation available.
    AK311803 mRNA. Translation: BAG34746.1.
    AC008536 Genomic DNA. No translation available.
    AC008575 Genomic DNA. No translation available.
    CH471086 Genomic DNA. Translation: EAW48999.1.
    CH471086 Genomic DNA. Translation: EAW49000.1.
    BC010947 mRNA. Translation: AAH10947.1.
    BC017830 mRNA. Translation: AAH17830.1.
    CCDSiCCDS4108.1. [P09132-1]
    CCDS56375.1. [P09132-2]
    CCDS56376.1. [P09132-3]
    PIRiS01700.
    RefSeqiNP_001191122.1. NM_001204193.1. [P09132-2]
    NP_001191123.1. NM_001204194.1.
    NP_001191125.1. NM_001204196.1. [P09132-3]
    NP_003126.1. NM_003135.2. [P09132-1]
    UniGeneiHs.637001.

    Genome annotation databases

    EnsembliENST00000282999; ENSP00000282999; ENSG00000153037. [P09132-2]
    ENST00000505459; ENSP00000424870; ENSG00000153037. [P09132-1]
    ENST00000515463; ENSP00000425562; ENSG00000153037. [P09132-3]
    GeneIDi6728.
    KEGGihsa:6728.
    UCSCiuc003kqb.2. human. [P09132-2]
    uc003kqc.3. human. [P09132-1]
    uc021yck.1. human. [P09132-3]

    Polymorphism databases

    DMDMi115502457.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Wikipedia

    Signal recognition particle entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X12791 mRNA. Translation: CAA31280.1 .
    BU661702 mRNA. No translation available.
    AK311803 mRNA. Translation: BAG34746.1 .
    AC008536 Genomic DNA. No translation available.
    AC008575 Genomic DNA. No translation available.
    CH471086 Genomic DNA. Translation: EAW48999.1 .
    CH471086 Genomic DNA. Translation: EAW49000.1 .
    BC010947 mRNA. Translation: AAH10947.1 .
    BC017830 mRNA. Translation: AAH17830.1 .
    CCDSi CCDS4108.1. [P09132-1 ]
    CCDS56375.1. [P09132-2 ]
    CCDS56376.1. [P09132-3 ]
    PIRi S01700.
    RefSeqi NP_001191122.1. NM_001204193.1. [P09132-2 ]
    NP_001191123.1. NM_001204194.1.
    NP_001191125.1. NM_001204196.1. [P09132-3 ]
    NP_003126.1. NM_003135.2. [P09132-1 ]
    UniGenei Hs.637001.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1JID X-ray 1.80 A 1-120 [» ]
    1MFQ X-ray 3.10 B 14-120 [» ]
    1RY1 electron microscopy 12.00 B 14-120 [» ]
    2J37 electron microscopy 8.00 B 14-120 [» ]
    3KTV X-ray 3.80 B/D 1-120 [» ]
    4P3E X-ray 3.50 B 1-120 [» ]
    DisProti DP00570.
    ProteinModelPortali P09132.
    SMRi P09132. Positions 5-118.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112606. 13 interactions.
    IntActi P09132. 6 interactions.
    MINTi MINT-247583.
    STRINGi 9606.ENSP00000282999.

    Protein family/group databases

    TCDBi 3.A.5.9.1. the general secretory pathway (sec) family.

    PTM databases

    PhosphoSitei P09132.

    Polymorphism databases

    DMDMi 115502457.

    Proteomic databases

    MaxQBi P09132.
    PaxDbi P09132.
    PRIDEi P09132.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000282999 ; ENSP00000282999 ; ENSG00000153037 . [P09132-2 ]
    ENST00000505459 ; ENSP00000424870 ; ENSG00000153037 . [P09132-1 ]
    ENST00000515463 ; ENSP00000425562 ; ENSG00000153037 . [P09132-3 ]
    GeneIDi 6728.
    KEGGi hsa:6728.
    UCSCi uc003kqb.2. human. [P09132-2 ]
    uc003kqc.3. human. [P09132-1 ]
    uc021yck.1. human. [P09132-3 ]

    Organism-specific databases

    CTDi 6728.
    GeneCardsi GC05P112196.
    HGNCi HGNC:11300. SRP19.
    HPAi HPA029272.
    MIMi 182175. gene.
    neXtProti NX_P09132.
    PharmGKBi PA36124.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG265516.
    HOGENOMi HOG000237221.
    HOVERGENi HBG059463.
    InParanoidi P09132.
    KOi K03105.
    OMAi RWICIYP.
    OrthoDBi EOG72G199.
    PhylomeDBi P09132.
    TreeFami TF106248.

    Enzyme and pathway databases

    Reactomei REACT_115902. SRP-dependent cotranslational protein targeting to membrane.

    Miscellaneous databases

    ChiTaRSi SRP19. human.
    EvolutionaryTracei P09132.
    GenomeRNAii 6728.
    NextBioi 26244.
    PROi P09132.
    SOURCEi Search...

    Gene expression databases

    Bgeei P09132.
    CleanExi HS_SRP19.
    Genevestigatori P09132.

    Family and domain databases

    Gene3Di 3.30.56.30. 1 hit.
    InterProi IPR002778. Signal_recog_particle_SRP19.
    [Graphical view ]
    PANTHERi PTHR17453. PTHR17453. 1 hit.
    Pfami PF01922. SRP19. 1 hit.
    [Graphical view ]
    SUPFAMi SSF69695. SSF69695. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Isolation and characterization of a cDNA clone encoding the 19 kDa protein of signal recognition particle (SRP): expression and binding to 7SL RNA."
      Lingelbach K., Zwieb C., Webb J.R., Marshallsaz C., Hoben P., Walter P., Dobberstein B.
      Nucleic Acids Res. 16:9431-9442(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE.
      Tissue: Liver.
    2. "Gene expression in human erythroid precursor cells."
      Gubin A.N., Lee Y.T., Bouffard G.G., Miller J.L.
      Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
      Tissue: Erythroblast.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    4. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-4.
      Tissue: Brain and Skin.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    8. "Crystal structure of an early protein-RNA assembly complex of the signal recognition particle."
      Wild K., Sinning I., Cusack S.
      Science 294:598-601(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 1-128.
    9. "Induced structural changes of 7SL RNA during the assembly of human signal recognition particle."
      Kuglstatter A., Oubridge C., Nagai K.
      Nat. Struct. Biol. 9:740-744(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (3.1 ANGSTROMS) OF 14-120 IN COMPLEX WITH SRP54 AND 7SL RNA.
    10. "Structural insights into the assembly of the human and archaeal signal recognition particles."
      Wild K., Bange G., Bozkurt G., Segnitz B., Hendricks A., Sinning I.
      Acta Crystallogr. D 66:295-303(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (3.8 ANGSTROMS) OF 1-120 IN COMPLEX WITH 7SL RNA.

    Entry informationi

    Entry nameiSRP19_HUMAN
    AccessioniPrimary (citable) accession number: P09132
    Secondary accession number(s): B2R4E9
    , D6RCQ5, Q05D77, Q96FG6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 1, 1989
    Last sequence update: October 3, 2006
    Last modified: October 1, 2014
    This is version 154 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3