SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P09132

- SRP19_HUMAN

UniProt

P09132 - SRP19_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Signal recognition particle 19 kDa protein

Gene
SRP19
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

GO - Molecular functioni

  1. 7S RNA binding Source: UniProtKB
  2. poly(A) RNA binding Source: UniProtKB

GO - Biological processi

  1. cellular protein metabolic process Source: Reactome
  2. cotranslational protein targeting to membrane Source: ProtInc
  3. gene expression Source: Reactome
  4. response to drug Source: UniProtKB
  5. SRP-dependent cotranslational protein targeting to membrane Source: Reactome
  6. translation Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

ReactomeiREACT_115902. SRP-dependent cotranslational protein targeting to membrane.

Protein family/group databases

TCDBi3.A.5.9.1. the general secretory pathway (sec) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Signal recognition particle 19 kDa protein
Short name:
SRP19
Gene namesi
Name:SRP19
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:11300. SRP19.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. cytosol Source: Reactome
  3. mitochondrion Source: HPA
  4. nucleolus Source: MGI
  5. nucleus Source: HPA
  6. signal recognition particle, endoplasmic reticulum targeting Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Signal recognition particle

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36124.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 144144Signal recognition particle 19 kDa proteinPRO_0000135197Add
BLAST

Proteomic databases

MaxQBiP09132.
PaxDbiP09132.
PRIDEiP09132.

PTM databases

PhosphoSiteiP09132.

Expressioni

Gene expression databases

BgeeiP09132.
CleanExiHS_SRP19.
GenevestigatoriP09132.

Organism-specific databases

HPAiHPA029272.

Interactioni

Subunit structurei

Signal recognition particle consists of a 7S RNA molecule of 300 nucleotides and six protein subunits: SRP72, SRP68, SRP54, SRP19, SRP14 and SRP9.

Protein-protein interaction databases

BioGridi112606. 13 interactions.
IntActiP09132. 6 interactions.
MINTiMINT-247583.
STRINGi9606.ENSP00000282999.

Structurei

Secondary structure

1
144
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi12 – 143
Beta strandi15 – 184
Helixi20 – 234
Turni29 – 324
Turni37 – 393
Beta strandi41 – 433
Helixi46 – 5510
Beta strandi60 – 634
Helixi76 – 783
Beta strandi81 – 844
Beta strandi89 – 913
Beta strandi93 – 953
Helixi101 – 11111
Helixi112 – 1143
Helixi116 – 1194

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1JIDX-ray1.80A1-120[»]
1MFQX-ray3.10B14-120[»]
1RY1electron microscopy12.00B14-120[»]
2J37electron microscopy8.00B14-120[»]
3KTVX-ray3.80B/D1-120[»]
4P3EX-ray3.50B1-120[»]
DisProtiDP00570.
ProteinModelPortaliP09132.
SMRiP09132. Positions 5-118.

Miscellaneous databases

EvolutionaryTraceiP09132.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni136 – 1449Basic region, potentially involved in RNA-binding

Sequence similaritiesi

Belongs to the SRP19 family.

Phylogenomic databases

eggNOGiNOG265516.
HOGENOMiHOG000237221.
HOVERGENiHBG059463.
InParanoidiP09132.
KOiK03105.
OMAiRWICIYP.
OrthoDBiEOG72G199.
PhylomeDBiP09132.
TreeFamiTF106248.

Family and domain databases

Gene3Di3.30.56.30. 1 hit.
InterProiIPR002778. Signal_recog_particle_SRP19.
[Graphical view]
PANTHERiPTHR17453. PTHR17453. 1 hit.
PfamiPF01922. SRP19. 1 hit.
[Graphical view]
SUPFAMiSSF69695. SSF69695. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P09132-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MACAAARSPA DQDRFICIYP AYLNNKKTIA EGRRIPISKA VENPTATEIQ    50
DVCSAVGLNV FLEKNKMYSR EWNRDVQYRG RVRVQLKQED GSLCLVQFPS 100
RKSVMLYAAE MIPKLKTRTQ KTGGADQSLQ QGEGSKKGKG KKKK 144
Length:144
Mass (Da):16,156
Last modified:October 3, 2006 - v3
Checksum:iE25F661972338CAE
GO
Isoform 2 (identifier: P09132-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-144: RKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK → HYTLSLTSGS

Note: No experimental confirmation available.

Show »
Length:110
Mass (Da):12,400
Checksum:iF199656A14C743E1
GO
Isoform 3 (identifier: P09132-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-144: FICIYPAYLN...SKKGKGKKKK → LLKILQLQRF...ALYSSHHVSQ

Show »
Length:78
Mass (Da):8,739
Checksum:i55C1707F8C5C2AE0
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti4 – 41A → T.1 Publication
Corresponds to variant rs17855423 [ dbSNP | Ensembl ].
VAR_027800

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei15 – 144130FICIY…GKKKK → LLKILQLQRFKMYVQQLDLT YFLRKIKCTLENGIVMSNTE AESGSSSNRKMGASALYSSH HVSQ in isoform 3. VSP_044524Add
BLAST
Alternative sequencei101 – 14444RKSVM…GKKKK → HYTLSLTSGS in isoform 2. VSP_042540Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X12791 mRNA. Translation: CAA31280.1.
BU661702 mRNA. No translation available.
AK311803 mRNA. Translation: BAG34746.1.
AC008536 Genomic DNA. No translation available.
AC008575 Genomic DNA. No translation available.
CH471086 Genomic DNA. Translation: EAW48999.1.
CH471086 Genomic DNA. Translation: EAW49000.1.
BC010947 mRNA. Translation: AAH10947.1.
BC017830 mRNA. Translation: AAH17830.1.
CCDSiCCDS4108.1. [P09132-1]
CCDS56375.1. [P09132-2]
CCDS56376.1. [P09132-3]
PIRiS01700.
RefSeqiNP_001191122.1. NM_001204193.1. [P09132-2]
NP_001191123.1. NM_001204194.1.
NP_001191125.1. NM_001204196.1. [P09132-3]
NP_003126.1. NM_003135.2. [P09132-1]
UniGeneiHs.637001.

Genome annotation databases

EnsembliENST00000282999; ENSP00000282999; ENSG00000153037. [P09132-2]
ENST00000505459; ENSP00000424870; ENSG00000153037. [P09132-1]
ENST00000515463; ENSP00000425562; ENSG00000153037. [P09132-3]
GeneIDi6728.
KEGGihsa:6728.
UCSCiuc003kqb.2. human. [P09132-2]
uc003kqc.3. human. [P09132-1]
uc021yck.1. human. [P09132-3]

Polymorphism databases

DMDMi115502457.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Signal recognition particle entry

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X12791 mRNA. Translation: CAA31280.1 .
BU661702 mRNA. No translation available.
AK311803 mRNA. Translation: BAG34746.1 .
AC008536 Genomic DNA. No translation available.
AC008575 Genomic DNA. No translation available.
CH471086 Genomic DNA. Translation: EAW48999.1 .
CH471086 Genomic DNA. Translation: EAW49000.1 .
BC010947 mRNA. Translation: AAH10947.1 .
BC017830 mRNA. Translation: AAH17830.1 .
CCDSi CCDS4108.1. [P09132-1 ]
CCDS56375.1. [P09132-2 ]
CCDS56376.1. [P09132-3 ]
PIRi S01700.
RefSeqi NP_001191122.1. NM_001204193.1. [P09132-2 ]
NP_001191123.1. NM_001204194.1.
NP_001191125.1. NM_001204196.1. [P09132-3 ]
NP_003126.1. NM_003135.2. [P09132-1 ]
UniGenei Hs.637001.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1JID X-ray 1.80 A 1-120 [» ]
1MFQ X-ray 3.10 B 14-120 [» ]
1RY1 electron microscopy 12.00 B 14-120 [» ]
2J37 electron microscopy 8.00 B 14-120 [» ]
3KTV X-ray 3.80 B/D 1-120 [» ]
4P3E X-ray 3.50 B 1-120 [» ]
DisProti DP00570.
ProteinModelPortali P09132.
SMRi P09132. Positions 5-118.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112606. 13 interactions.
IntActi P09132. 6 interactions.
MINTi MINT-247583.
STRINGi 9606.ENSP00000282999.

Protein family/group databases

TCDBi 3.A.5.9.1. the general secretory pathway (sec) family.

PTM databases

PhosphoSitei P09132.

Polymorphism databases

DMDMi 115502457.

Proteomic databases

MaxQBi P09132.
PaxDbi P09132.
PRIDEi P09132.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000282999 ; ENSP00000282999 ; ENSG00000153037 . [P09132-2 ]
ENST00000505459 ; ENSP00000424870 ; ENSG00000153037 . [P09132-1 ]
ENST00000515463 ; ENSP00000425562 ; ENSG00000153037 . [P09132-3 ]
GeneIDi 6728.
KEGGi hsa:6728.
UCSCi uc003kqb.2. human. [P09132-2 ]
uc003kqc.3. human. [P09132-1 ]
uc021yck.1. human. [P09132-3 ]

Organism-specific databases

CTDi 6728.
GeneCardsi GC05P112196.
HGNCi HGNC:11300. SRP19.
HPAi HPA029272.
MIMi 182175. gene.
neXtProti NX_P09132.
PharmGKBi PA36124.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG265516.
HOGENOMi HOG000237221.
HOVERGENi HBG059463.
InParanoidi P09132.
KOi K03105.
OMAi RWICIYP.
OrthoDBi EOG72G199.
PhylomeDBi P09132.
TreeFami TF106248.

Enzyme and pathway databases

Reactomei REACT_115902. SRP-dependent cotranslational protein targeting to membrane.

Miscellaneous databases

ChiTaRSi SRP19. human.
EvolutionaryTracei P09132.
GenomeRNAii 6728.
NextBioi 26244.
PROi P09132.
SOURCEi Search...

Gene expression databases

Bgeei P09132.
CleanExi HS_SRP19.
Genevestigatori P09132.

Family and domain databases

Gene3Di 3.30.56.30. 1 hit.
InterProi IPR002778. Signal_recog_particle_SRP19.
[Graphical view ]
PANTHERi PTHR17453. PTHR17453. 1 hit.
Pfami PF01922. SRP19. 1 hit.
[Graphical view ]
SUPFAMi SSF69695. SSF69695. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and characterization of a cDNA clone encoding the 19 kDa protein of signal recognition particle (SRP): expression and binding to 7SL RNA."
    Lingelbach K., Zwieb C., Webb J.R., Marshallsaz C., Hoben P., Walter P., Dobberstein B.
    Nucleic Acids Res. 16:9431-9442(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE.
    Tissue: Liver.
  2. "Gene expression in human erythroid precursor cells."
    Gubin A.N., Lee Y.T., Bouffard G.G., Miller J.L.
    Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Erythroblast.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  4. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-4.
    Tissue: Brain and Skin.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "Crystal structure of an early protein-RNA assembly complex of the signal recognition particle."
    Wild K., Sinning I., Cusack S.
    Science 294:598-601(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 1-128.
  9. "Induced structural changes of 7SL RNA during the assembly of human signal recognition particle."
    Kuglstatter A., Oubridge C., Nagai K.
    Nat. Struct. Biol. 9:740-744(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (3.1 ANGSTROMS) OF 14-120 IN COMPLEX WITH SRP54 AND 7SL RNA.
  10. "Structural insights into the assembly of the human and archaeal signal recognition particles."
    Wild K., Bange G., Bozkurt G., Segnitz B., Hendricks A., Sinning I.
    Acta Crystallogr. D 66:295-303(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (3.8 ANGSTROMS) OF 1-120 IN COMPLEX WITH 7SL RNA.

Entry informationi

Entry nameiSRP19_HUMAN
AccessioniPrimary (citable) accession number: P09132
Secondary accession number(s): B2R4E9
, D6RCQ5, Q05D77, Q96FG6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: October 3, 2006
Last modified: September 3, 2014
This is version 153 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi