P09132 (SRP19_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 139.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Signal recognition particle 19 kDa protein Short name=SRP19 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 144 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP. |
| Subunit structure | Signal recognition particle consists of a 7S RNA molecule of 300 nucleotides and six protein subunits: SRP72, SRP68, SRP54, SRP19, SRP14 and SRP9. |
| Subcellular location | |
| Sequence similarities | Belongs to the SRP19 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Signal recognition particle |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | RNA-binding |
| Molecular function | Ribonucleoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | SRP-dependent cotranslational protein targeting to membrane Traceable author statement. Source: Reactome response to drugInferred from direct assay PubMed 18089836. Source: UniProtKB translationTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome mitochondrionInferred from direct assay. Source: HPA nucleolusInferred from direct assay PubMed 10618370. Source: MGI signal recognition particle, endoplasmic reticulum targetingInferred from direct assay PubMed 18089836. Source: UniProtKB |
| Molecular_function | 7S RNA binding Inferred from direct assay PubMed 17434535. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P09132-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P09132-2) The sequence of this isoform differs from the canonical sequence as follows: 101-144: RKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK → HYTLSLTSGS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P09132-3) The sequence of this isoform differs from the canonical sequence as follows: 15-144: FICIYPAYLN...SKKGKGKKKK → LLKILQLQRF...ALYSSHHVSQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 144 | 144 | Signal recognition particle 19 kDa protein | PRO_0000135197 | |||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||
| Region | 136 – 144 | 9 | Basic region, potentially involved in RNA-binding | ||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 15 – 144 | 130 | FICIY…GKKKK → LLKILQLQRFKMYVQQLDLT YFLRKIKCTLENGIVMSNTE AESGSSSNRKMGASALYSSH HVSQ in isoform 3. | VSP_044524 | |||||||||||||||||||||||||||||||
| Alternative sequence | 101 – 144 | 44 | RKSVM…GKKKK → HYTLSLTSGS in isoform 2. | VSP_042540 | |||||||||||||||||||||||||||||||
| Natural variant | 4 | 1 | A → T. Ref.6 Corresponds to variant rs17855423 [ dbSNP | Ensembl ]. | VAR_027800 | |||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||
| Helix | 12 – 14 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 15 – 18 | 4 | |||||||||||||||||||||||||||||||||
| Helix | 20 – 23 | 4 | |||||||||||||||||||||||||||||||||
| Turn | 29 – 32 | 4 | |||||||||||||||||||||||||||||||||
| Turn | 37 – 39 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 41 – 43 | 3 | |||||||||||||||||||||||||||||||||
| Helix | 46 – 55 | 10 | |||||||||||||||||||||||||||||||||
| Beta strand | 60 – 63 | 4 | |||||||||||||||||||||||||||||||||
| Helix | 76 – 78 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 81 – 84 | 4 | |||||||||||||||||||||||||||||||||
| Beta strand | 93 – 95 | 3 | |||||||||||||||||||||||||||||||||
| Helix | 101 – 111 | 11 | |||||||||||||||||||||||||||||||||
| Helix | 112 – 114 | 3 | |||||||||||||||||||||||||||||||||
| Helix | 116 – 119 | 4 | |||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of a cDNA clone encoding the 19 kDa protein of signal recognition particle (SRP): expression and binding to 7SL RNA." Lingelbach K., Zwieb C., Webb J.R., Marshallsaz C., Hoben P., Walter P., Dobberstein B. Nucleic Acids Res. 16:9431-9442(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. Tissue: Liver. |
| [2] | "Gene expression in human erythroid precursor cells." Gubin A.N., Lee Y.T., Bouffard G.G., Miller J.L. Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Erythroblast. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-4. Tissue: Brain and Skin. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [8] | "Crystal structure of an early protein-RNA assembly complex of the signal recognition particle." Wild K., Sinning I., Cusack S. Science 294:598-601(2001) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 1-128. |
| [9] | "Induced structural changes of 7SL RNA during the assembly of human signal recognition particle." Kuglstatter A., Oubridge C., Nagai K. Nat. Struct. Biol. 9:740-744(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.1 ANGSTROMS) OF 14-120 IN COMPLEX WITH SRP54 AND 7SL RNA. |
| [10] | "Structural insights into the assembly of the human and archaeal signal recognition particles." Wild K., Bange G., Bozkurt G., Segnitz B., Hendricks A., Sinning I. Acta Crystallogr. D 66:295-303(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.8 ANGSTROMS) OF 1-120 IN COMPLEX WITH 7SL RNA. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Signal recognition particle entry |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X12791 mRNA. Translation: CAA31280.1. BU661702 mRNA. No translation available. AK311803 mRNA. Translation: BAG34746.1. AC008536 Genomic DNA. No translation available. AC008575 Genomic DNA. No translation available. CH471086 Genomic DNA. Translation: EAW48999.1. CH471086 Genomic DNA. Translation: EAW49000.1. BC010947 mRNA. Translation: AAH10947.1. BC017830 mRNA. Translation: AAH17830.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00295889. IPI00807414. IPI00967461. | ||||||||||||||||||||||||||||||||||||
| PIR | S01700. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001191122.1. NM_001204193.1. NP_001191123.1. NM_001204194.1. NP_001191125.1. NM_001204196.1. NP_003126.1. NM_003135.2. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.637001. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P09132. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| IntAct | P09132. 2 interactions. | ||||||||||||||||||||||||||||||||||||
| MINT | MINT-247583. | ||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000282999. | ||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||
| TCDB | 3.A.5.9.1. general secretory pathway (Sec) family. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | P09132. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 115502457. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | P09132. | ||||||||||||||||||||||||||||||||||||
| PRIDE | P09132. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000282999; ENSP00000282999; ENSG00000153037. ENST00000505459; ENSP00000424870; ENSG00000153037. ENST00000515463; ENSP00000425562; ENSG00000153037. | ||||||||||||||||||||||||||||||||||||
| GeneID | 6728. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:6728. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc003kqc.3. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 6728. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC05P112196. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:11300. SRP19. | ||||||||||||||||||||||||||||||||||||
| HPA | HPA029272. | ||||||||||||||||||||||||||||||||||||
| MIM | 182175. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P09132. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA36124. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | NOG265516. | ||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000237221. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG059463. | ||||||||||||||||||||||||||||||||||||
| InParanoid | P09132. | ||||||||||||||||||||||||||||||||||||
| KO | K03105. | ||||||||||||||||||||||||||||||||||||
| OMA | YVAEMIP. | ||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG48D0WP. | ||||||||||||||||||||||||||||||||||||
| PhylomeDB | P09132. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| Reactome | REACT_17015. Metabolism of proteins. REACT_71. Gene Expression. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | P09132. | ||||||||||||||||||||||||||||||||||||
| Bgee | P09132. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_SRP19. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | P09132. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000153037. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| Gene3D | 3.30.56.30. 1 hit. | ||||||||||||||||||||||||||||||||||||
| InterPro | IPR002778. Signal_recog_particle_SRP19. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR17453. PTHR17453. 1 hit. | ||||||||||||||||||||||||||||||||||||
| Pfam | PF01922. SRP19. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF69695. Signal_recog_particle_SRP19. 1 hit. | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| ChiTaRS | SRP19. human. | ||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P09132. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 6728. | ||||||||||||||||||||||||||||||||||||
| NextBio | 26244. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SRP19_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P09132 Secondary accession number(s): B2R4E9 Q96FG6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
