Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Signal recognition particle 19 kDa protein

Gene

SRP19

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

GO - Molecular functioni

  • 7S RNA binding Source: UniProtKB
  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000153037-MONOMER.
ReactomeiR-HSA-1799339. SRP-dependent cotranslational protein targeting to membrane.

Protein family/group databases

TCDBi3.A.5.9.1. the general secretory pathway (sec) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Signal recognition particle 19 kDa protein
Short name:
SRP19
Gene namesi
Name:SRP19
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:11300. SRP19.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • cytosol Source: Reactome
  • mitochondrion Source: HPA
  • nucleolus Source: MGI
  • nucleus Source: HPA
  • signal recognition particle, endoplasmic reticulum targeting Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Signal recognition particle

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000153037.
PharmGKBiPA36124.

Polymorphism and mutation databases

BioMutaiSRP19.
DMDMi115502457.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001351971 – 144Signal recognition particle 19 kDa proteinAdd BLAST144

Proteomic databases

EPDiP09132.
MaxQBiP09132.
PaxDbiP09132.
PeptideAtlasiP09132.
PRIDEiP09132.

PTM databases

iPTMnetiP09132.
PhosphoSitePlusiP09132.

Expressioni

Gene expression databases

BgeeiENSG00000153037.
CleanExiHS_SRP19.
ExpressionAtlasiP09132. baseline and differential.
GenevisibleiP09132. HS.

Organism-specific databases

HPAiHPA029272.
HPA057315.

Interactioni

Subunit structurei

Signal recognition particle consists of a 7S RNA molecule of 300 nucleotides and six protein subunits: SRP72, SRP68, SRP54, SRP19, SRP14 and SRP9.2 Publications

Protein-protein interaction databases

BioGridi112606. 22 interactors.
DIPiDIP-41412N.
IntActiP09132. 12 interactors.
MINTiMINT-247583.
STRINGi9606.ENSP00000424870.

Structurei

Secondary structure

1144
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi12 – 14Combined sources3
Beta strandi15 – 18Combined sources4
Helixi20 – 23Combined sources4
Turni29 – 32Combined sources4
Turni37 – 39Combined sources3
Beta strandi41 – 43Combined sources3
Helixi46 – 55Combined sources10
Beta strandi60 – 63Combined sources4
Helixi76 – 78Combined sources3
Beta strandi81 – 84Combined sources4
Beta strandi89 – 91Combined sources3
Beta strandi93 – 95Combined sources3
Helixi101 – 111Combined sources11
Helixi112 – 114Combined sources3
Helixi116 – 119Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JIDX-ray1.80A1-120[»]
1MFQX-ray3.10B14-120[»]
1RY1electron microscopy12.00B14-120[»]
2J37electron microscopy8.00B14-120[»]
3KTVX-ray3.80B/D1-120[»]
4P3EX-ray3.50B1-120[»]
DisProtiDP00570.
ProteinModelPortaliP09132.
SMRiP09132.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP09132.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni136 – 144Basic region, potentially involved in RNA-binding9

Sequence similaritiesi

Belongs to the SRP19 family.Curated

Phylogenomic databases

eggNOGiKOG3198. Eukaryota.
COG1400. LUCA.
GeneTreeiENSGT00390000004950.
HOGENOMiHOG000237221.
HOVERGENiHBG059463.
InParanoidiP09132.
KOiK03105.
OMAiCVENPTH.
OrthoDBiEOG091G0VWO.
PhylomeDBiP09132.
TreeFamiTF106248.

Family and domain databases

Gene3Di3.30.56.30. 1 hit.
InterProiIPR002778. Signal_recog_particle_SRP19.
[Graphical view]
PANTHERiPTHR17453. PTHR17453. 1 hit.
PfamiPF01922. SRP19. 1 hit.
[Graphical view]
SUPFAMiSSF69695. SSF69695. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P09132-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MACAAARSPA DQDRFICIYP AYLNNKKTIA EGRRIPISKA VENPTATEIQ
60 70 80 90 100
DVCSAVGLNV FLEKNKMYSR EWNRDVQYRG RVRVQLKQED GSLCLVQFPS
110 120 130 140
RKSVMLYAAE MIPKLKTRTQ KTGGADQSLQ QGEGSKKGKG KKKK
Length:144
Mass (Da):16,156
Last modified:October 3, 2006 - v3
Checksum:iE25F661972338CAE
GO
Isoform 2 (identifier: P09132-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-144: RKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK → HYTLSLTSGS

Note: No experimental confirmation available.
Show »
Length:110
Mass (Da):12,400
Checksum:iF199656A14C743E1
GO
Isoform 3 (identifier: P09132-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-144: FICIYPAYLN...SKKGKGKKKK → LLKILQLQRF...ALYSSHHVSQ

Show »
Length:78
Mass (Da):8,739
Checksum:i55C1707F8C5C2AE0
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0278004A → T.1 PublicationCorresponds to variant rs17855423dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04452415 – 144FICIY…GKKKK → LLKILQLQRFKMYVQQLDLT YFLRKIKCTLENGIVMSNTE AESGSSSNRKMGASALYSSH HVSQ in isoform 3. 1 PublicationAdd BLAST130
Alternative sequenceiVSP_042540101 – 144RKSVM…GKKKK → HYTLSLTSGS in isoform 2. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X12791 mRNA. Translation: CAA31280.1.
BU661702 mRNA. No translation available.
AK311803 mRNA. Translation: BAG34746.1.
AC008536 Genomic DNA. No translation available.
AC008575 Genomic DNA. No translation available.
CH471086 Genomic DNA. Translation: EAW48999.1.
CH471086 Genomic DNA. Translation: EAW49000.1.
BC010947 mRNA. Translation: AAH10947.1.
BC017830 mRNA. Translation: AAH17830.1.
CCDSiCCDS4108.1. [P09132-1]
CCDS56375.1. [P09132-2]
CCDS56376.1. [P09132-3]
PIRiS01700.
RefSeqiNP_001191122.1. NM_001204193.1. [P09132-2]
NP_001191123.1. NM_001204194.1.
NP_001191125.1. NM_001204196.1. [P09132-3]
NP_003126.1. NM_003135.2. [P09132-1]
UniGeneiHs.637001.

Genome annotation databases

EnsembliENST00000282999; ENSP00000282999; ENSG00000153037. [P09132-2]
ENST00000505459; ENSP00000424870; ENSG00000153037. [P09132-1]
ENST00000515463; ENSP00000425562; ENSG00000153037. [P09132-3]
GeneIDi6728.
KEGGihsa:6728.
UCSCiuc003kqb.3. human. [P09132-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Signal recognition particle entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X12791 mRNA. Translation: CAA31280.1.
BU661702 mRNA. No translation available.
AK311803 mRNA. Translation: BAG34746.1.
AC008536 Genomic DNA. No translation available.
AC008575 Genomic DNA. No translation available.
CH471086 Genomic DNA. Translation: EAW48999.1.
CH471086 Genomic DNA. Translation: EAW49000.1.
BC010947 mRNA. Translation: AAH10947.1.
BC017830 mRNA. Translation: AAH17830.1.
CCDSiCCDS4108.1. [P09132-1]
CCDS56375.1. [P09132-2]
CCDS56376.1. [P09132-3]
PIRiS01700.
RefSeqiNP_001191122.1. NM_001204193.1. [P09132-2]
NP_001191123.1. NM_001204194.1.
NP_001191125.1. NM_001204196.1. [P09132-3]
NP_003126.1. NM_003135.2. [P09132-1]
UniGeneiHs.637001.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JIDX-ray1.80A1-120[»]
1MFQX-ray3.10B14-120[»]
1RY1electron microscopy12.00B14-120[»]
2J37electron microscopy8.00B14-120[»]
3KTVX-ray3.80B/D1-120[»]
4P3EX-ray3.50B1-120[»]
DisProtiDP00570.
ProteinModelPortaliP09132.
SMRiP09132.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112606. 22 interactors.
DIPiDIP-41412N.
IntActiP09132. 12 interactors.
MINTiMINT-247583.
STRINGi9606.ENSP00000424870.

Protein family/group databases

TCDBi3.A.5.9.1. the general secretory pathway (sec) family.

PTM databases

iPTMnetiP09132.
PhosphoSitePlusiP09132.

Polymorphism and mutation databases

BioMutaiSRP19.
DMDMi115502457.

Proteomic databases

EPDiP09132.
MaxQBiP09132.
PaxDbiP09132.
PeptideAtlasiP09132.
PRIDEiP09132.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000282999; ENSP00000282999; ENSG00000153037. [P09132-2]
ENST00000505459; ENSP00000424870; ENSG00000153037. [P09132-1]
ENST00000515463; ENSP00000425562; ENSG00000153037. [P09132-3]
GeneIDi6728.
KEGGihsa:6728.
UCSCiuc003kqb.3. human. [P09132-1]

Organism-specific databases

CTDi6728.
GeneCardsiSRP19.
HGNCiHGNC:11300. SRP19.
HPAiHPA029272.
HPA057315.
MIMi182175. gene.
neXtProtiNX_P09132.
OpenTargetsiENSG00000153037.
PharmGKBiPA36124.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3198. Eukaryota.
COG1400. LUCA.
GeneTreeiENSGT00390000004950.
HOGENOMiHOG000237221.
HOVERGENiHBG059463.
InParanoidiP09132.
KOiK03105.
OMAiCVENPTH.
OrthoDBiEOG091G0VWO.
PhylomeDBiP09132.
TreeFamiTF106248.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000153037-MONOMER.
ReactomeiR-HSA-1799339. SRP-dependent cotranslational protein targeting to membrane.

Miscellaneous databases

ChiTaRSiSRP19. human.
EvolutionaryTraceiP09132.
GenomeRNAii6728.
PROiP09132.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000153037.
CleanExiHS_SRP19.
ExpressionAtlasiP09132. baseline and differential.
GenevisibleiP09132. HS.

Family and domain databases

Gene3Di3.30.56.30. 1 hit.
InterProiIPR002778. Signal_recog_particle_SRP19.
[Graphical view]
PANTHERiPTHR17453. PTHR17453. 1 hit.
PfamiPF01922. SRP19. 1 hit.
[Graphical view]
SUPFAMiSSF69695. SSF69695. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSRP19_HUMAN
AccessioniPrimary (citable) accession number: P09132
Secondary accession number(s): B2R4E9
, D6RCQ5, Q05D77, Q96FG6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1989
Last sequence update: October 3, 2006
Last modified: November 30, 2016
This is version 177 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.