Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neuromedin-B

Gene

NMB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Stimulates smooth muscle contraction in a manner similar to that of bombesin.

GO - Molecular functioni

  • hormone activity Source: ProtInc

GO - Biological processi

  • cell-cell signaling Source: ProtInc
  • G-protein coupled receptor signaling pathway Source: Reactome
  • neuropeptide signaling pathway Source: InterPro
  • signal transduction Source: ProtInc

Enzyme and pathway databases

ReactomeiR-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events
SIGNORiP08949

Names & Taxonomyi

Protein namesi
Recommended name:
Neuromedin-B
Cleaved into the following 2 chains:
Gene namesi
Name:NMB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000197696.9
HGNCiHGNC:7842 NMB
MIMi162340 gene
neXtProtiNX_P08949

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi4828
OpenTargetsiENSG00000197696
PharmGKBiPA31654

Polymorphism and mutation databases

BioMutaiNMB
DMDMi281185514

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24Add BLAST24
PeptideiPRO_000000301725 – 56Neuromedin-B-32Add BLAST32
PeptideiPRO_000000301847 – 56Neuromedin-B10
PropeptideiPRO_000000301960 – 121Add BLAST62

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei56Methionine amide1 Publication1

Keywords - PTMi

Amidation, Cleavage on pair of basic residues

Proteomic databases

PaxDbiP08949
PeptideAtlasiP08949
PRIDEiP08949
TopDownProteomicsiP08949-2 [P08949-2]

PTM databases

iPTMnetiP08949
PhosphoSitePlusiP08949

Expressioni

Gene expression databases

BgeeiENSG00000197696
CleanExiHS_NMB
GenevisibleiP08949 HS

Organism-specific databases

HPAiCAB019302

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
BIRC2Q134905EBI-12302085,EBI-514538

GO - Molecular functioni

  • hormone activity Source: ProtInc

Protein-protein interaction databases

BioGridi110892, 17 interactors
IntActiP08949, 2 interactors
MINTiP08949
STRINGi9606.ENSP00000378089

Structurei

Secondary structure

1121
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi51 – 54Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1C98NMR-A47-56[»]
1C9ANMR-A47-56[»]
ProteinModelPortaliP08949
SMRiP08949
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP08949

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IX9W Eukaryota
ENOG410Z1WN LUCA
GeneTreeiENSGT00390000015835
HOGENOMiHOG000063661
HOVERGENiHBG079570
InParanoidiP08949
KOiK05223
OMAiCAHPGKV
OrthoDBiEOG091G145J
PhylomeDBiP08949
TreeFamiTF336860

Family and domain databases

InterProiView protein in InterPro
IPR000874 Bombesin
PfamiView protein in Pfam
PF02044 Bombesin, 1 hit
PROSITEiView protein in PROSITE
PS00257 BOMBESIN, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P08949-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MARRAGGARM FGSLLLFALL AAGVAPLSWD LPEPRSRASK IRVHSRGNLW
60 70 80 90 100
ATGHFMGKKS LEPSSPSPLG TAPHTSLRDQ RLQLSHDLLG ILLLKKALGV
110 120
SLSRPAPQIQ YRRLLVQILQ K
Length:121
Mass (Da):13,252
Last modified:December 15, 2009 - v4
Checksum:i10E16BA4886F03FB
GO
Isoform 2 (identifier: P08949-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-121: YRRLLVQILQK → EAAGTNTAEMTPIMGQTQQRGLDCAHPGKVLNGTLLMAPSGCKS

Note: No experimental confirmation available.
Show »
Length:154
Mass (Da):16,309
Checksum:i3FFBCF2BB83E2D84
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti68 – 76PLGTAPHTS → HWGQLPTPP in AAA59934 (PubMed:2458345).Curated9

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06036973P → T1 PublicationCorresponds to variant dbSNP:rs1051168Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000548111 – 121YRRLLVQILQK → EAAGTNTAEMTPIMGQTQQR GLDCAHPGKVLNGTLLMAPS GCKS in isoform 2. 1 PublicationAdd BLAST11

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M21551 mRNA Translation: AAA59934.1
AC048382 Genomic DNA No translation available.
BC007407 mRNA Translation: AAH07407.1
BC007431 mRNA Translation: AAH07431.1
BC008603 mRNA Translation: AAH08603.1
CCDSiCCDS10332.1 [P08949-1]
CCDS42076.1 [P08949-2]
PIRiA28945
RefSeqiNP_066563.2, NM_021077.3 [P08949-1]
NP_995580.1, NM_205858.1 [P08949-2]
UniGeneiHs.386470

Genome annotation databases

EnsembliENST00000360476; ENSP00000353664; ENSG00000197696 [P08949-1]
ENST00000394588; ENSP00000378089; ENSG00000197696 [P08949-2]
GeneIDi4828
KEGGihsa:4828
UCSCiuc002bkz.4 human [P08949-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiNMB_HUMAN
AccessioniPrimary (citable) accession number: P08949
Secondary accession number(s): Q96A06, Q96HH5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: December 15, 2009
Last modified: February 28, 2018
This is version 170 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health