P08949 (NMB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 131.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Neuromedin-B Cleaved into the following 2 chains: | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 121 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Stimulates smooth muscle contraction in a manner similar to that of bombesin. |
| Subcellular location | |
| Sequence similarities | Belongs to the bombesin/neuromedin-B/ranatensin family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P08949-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P08949-2) The sequence of this isoform differs from the canonical sequence as follows: 111-121: YRRLLVQILQK → EAAGTNTAEMTPIMGQTQQRGLDCAHPGKVLNGTLLMAPSGCKS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | |||||||||
| Peptide | 25 – 56 | 32 | Neuromedin-B-32 | PRO_0000003017 | |||||||
| Peptide | 47 – 56 | 10 | Neuromedin-B | PRO_0000003018 | |||||||
| Propeptide | 60 – 121 | 62 | PRO_0000003019 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 56 | 1 | Methionine amide | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 111 – 121 | 11 | YRRLLVQILQK → EAAGTNTAEMTPIMGQTQQR GLDCAHPGKVLNGTLLMAPS GCKS in isoform 2. | VSP_000548 | |||||||
| Natural variant | 73 | 1 | P → T. Ref.4 Corresponds to variant rs1051168 [ dbSNP | Ensembl ]. | VAR_060369 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 68 – 76 | 9 | PLGTAPHTS → HWGQLPTPP in AAA59934. Ref.1 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 51 – 54 | 4 | |||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of cDNAs encoding the human bombesin-like peptide neuromedin B. Chromosomal localization and comparison to cDNAs encoding its amphibian homolog ranatensin." Krane I.M., Naylor S.L., Helin-Davis D., Chin W.W., Spindel E.R. J. Biol. Chem. 263:13317-13323(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Hypothalamus. |
| [2] | Erratum Krane I.M., Naylor S.L., Helin-Davis D., Chin W.W., Spindel E.R. J. Biol. Chem. 265:7091-7091(1990) Cited for: SEQUENCE REVISION. |
| [3] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-73. Tissue: Brain and Ovary. |
| [5] | "Solution structure of neuromedin B by (1)H nuclear magnetic resonance spectroscopy." Lee S., Kim Y. FEBS Lett. 460:263-269(1999) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 47-56. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M21551 mRNA. Translation: AAA59934.1. AC048382 Genomic DNA. No translation available. BC007407 mRNA. Translation: AAH07407.1. BC007431 mRNA. Translation: AAH07431.1. BC008603 mRNA. Translation: AAH08603.1. | ||||||||||||||||||
| IPI | IPI00031753. IPI00220630. | ||||||||||||||||||
| PIR | A28945. | ||||||||||||||||||
| RefSeq | NP_066563.2. NM_021077.3. NP_995580.1. NM_205858.1. | ||||||||||||||||||
| UniGene | Hs.386470. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P08949. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| STRING | 9606.ENSP00000378089. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 281185514. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | P08949. | ||||||||||||||||||
| PRIDE | P08949. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 4828. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000360476; ENSP00000353664; ENSG00000197696. ENST00000394588; ENSP00000378089; ENSG00000197696. | ||||||||||||||||||
| GeneID | 4828. | ||||||||||||||||||
| KEGG | hsa:4828. | ||||||||||||||||||
| UCSC | uc002bkz.3. human. uc002bla.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 4828. | ||||||||||||||||||
| GeneCards | GC15M085198. | ||||||||||||||||||
| H-InvDB | HIX0202167. | ||||||||||||||||||
| HGNC | HGNC:7842. NMB. | ||||||||||||||||||
| HPA | CAB019302. | ||||||||||||||||||
| MIM | 162340. gene. | ||||||||||||||||||
| neXtProt | NX_P08949. | ||||||||||||||||||
| PharmGKB | PA31654. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG40699. | ||||||||||||||||||
| HOGENOM | HOG000063661. | ||||||||||||||||||
| HOVERGEN | HBG079570. | ||||||||||||||||||
| KO | K05223. | ||||||||||||||||||
| OMA | LGTAPHT. | ||||||||||||||||||
| OrthoDB | EOG4X97JR. | ||||||||||||||||||
| PhylomeDB | P08949. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| Bgee | P08949. | ||||||||||||||||||
| CleanEx | HS_NMB. | ||||||||||||||||||
| Genevestigator | P08949. | ||||||||||||||||||
| GermOnline | ENSG00000197696. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR000874. Bombesin. [Graphical view] | ||||||||||||||||||
| Pfam | PF02044. Bombesin. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00257. BOMBESIN. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | NMB. human. | ||||||||||||||||||
| EvolutionaryTrace | P08949. | ||||||||||||||||||
| GenomeRNAi | 4828. | ||||||||||||||||||
| NextBio | 18596. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | NMB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P08949 Secondary accession number(s): Q96A06, Q96HH5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
