SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P08949

- NMB_HUMAN

UniProt

P08949 - NMB_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neuromedin-B

Gene
NMB
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Stimulates smooth muscle contraction in a manner similar to that of bombesin.

GO - Molecular functioni

  1. hormone activity Source: ProtInc

GO - Biological processi

  1. arachidonic acid secretion Source: Ensembl
  2. cell-cell signaling Source: ProtInc
  3. glucose homeostasis Source: Ensembl
  4. negative regulation of hormone secretion Source: Ensembl
  5. neuropeptide signaling pathway Source: InterPro
  6. positive regulation of cell proliferation Source: Ensembl
  7. positive regulation of cytosolic calcium ion concentration Source: Ensembl
  8. positive regulation of hormone secretion Source: Ensembl
  9. signal transduction Source: ProtInc
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_14819. Peptide ligand-binding receptors.
REACT_18283. G alpha (q) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Neuromedin-B
Cleaved into the following 2 chains:
Gene namesi
Name:NMB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:7842. NMB.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: Reactome
  2. neuron projection Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31654.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424Add
BLAST
Peptidei25 – 5632Neuromedin-B-32PRO_0000003017Add
BLAST
Peptidei47 – 5610Neuromedin-BPRO_0000003018
Propeptidei60 – 12162PRO_0000003019Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei56 – 561Methionine amide1 Publication

Keywords - PTMi

Amidation, Cleavage on pair of basic residues

Proteomic databases

PaxDbiP08949.
PRIDEiP08949.

Expressioni

Gene expression databases

BgeeiP08949.
CleanExiHS_NMB.
GenevestigatoriP08949.

Organism-specific databases

HPAiCAB019302.

Interactioni

Protein-protein interaction databases

BioGridi110892. 2 interactions.
IntActiP08949. 1 interaction.
MINTiMINT-7969962.
STRINGi9606.ENSP00000378089.

Structurei

Secondary structure

1
121
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi51 – 544

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1C98NMR-A47-56[»]
1C9ANMR-A47-56[»]
ProteinModelPortaliP08949.

Miscellaneous databases

EvolutionaryTraceiP08949.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG40699.
HOGENOMiHOG000063661.
HOVERGENiHBG079570.
KOiK05223.
OMAiAEMTPIM.
OrthoDBiEOG761BX3.
PhylomeDBiP08949.
TreeFamiTF336860.

Family and domain databases

InterProiIPR000874. Bombesin.
[Graphical view]
PfamiPF02044. Bombesin. 1 hit.
[Graphical view]
PROSITEiPS00257. BOMBESIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P08949-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MARRAGGARM FGSLLLFALL AAGVAPLSWD LPEPRSRASK IRVHSRGNLW    50
ATGHFMGKKS LEPSSPSPLG TAPHTSLRDQ RLQLSHDLLG ILLLKKALGV 100
SLSRPAPQIQ YRRLLVQILQ K 121
Length:121
Mass (Da):13,252
Last modified:December 15, 2009 - v4
Checksum:i10E16BA4886F03FB
GO
Isoform 2 (identifier: P08949-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-121: YRRLLVQILQK → EAAGTNTAEMTPIMGQTQQRGLDCAHPGKVLNGTLLMAPSGCKS

Note: No experimental confirmation available.

Show »
Length:154
Mass (Da):16,309
Checksum:i3FFBCF2BB83E2D84
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti73 – 731P → T.1 Publication
Corresponds to variant rs1051168 [ dbSNP | Ensembl ].
VAR_060369

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei111 – 12111YRRLLVQILQK → EAAGTNTAEMTPIMGQTQQR GLDCAHPGKVLNGTLLMAPS GCKS in isoform 2. VSP_000548Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti68 – 769PLGTAPHTS → HWGQLPTPP in AAA59934. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M21551 mRNA. Translation: AAA59934.1.
AC048382 Genomic DNA. No translation available.
BC007407 mRNA. Translation: AAH07407.1.
BC007431 mRNA. Translation: AAH07431.1.
BC008603 mRNA. Translation: AAH08603.1.
CCDSiCCDS10332.1. [P08949-1]
CCDS42076.1. [P08949-2]
PIRiA28945.
RefSeqiNP_066563.2. NM_021077.3. [P08949-1]
NP_995580.1. NM_205858.1. [P08949-2]
UniGeneiHs.386470.

Genome annotation databases

EnsembliENST00000360476; ENSP00000353664; ENSG00000197696. [P08949-1]
ENST00000394588; ENSP00000378089; ENSG00000197696. [P08949-2]
GeneIDi4828.
KEGGihsa:4828.
UCSCiuc002bkz.3. human. [P08949-1]
uc002bla.3. human. [P08949-2]

Polymorphism databases

DMDMi281185514.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M21551 mRNA. Translation: AAA59934.1 .
AC048382 Genomic DNA. No translation available.
BC007407 mRNA. Translation: AAH07407.1 .
BC007431 mRNA. Translation: AAH07431.1 .
BC008603 mRNA. Translation: AAH08603.1 .
CCDSi CCDS10332.1. [P08949-1 ]
CCDS42076.1. [P08949-2 ]
PIRi A28945.
RefSeqi NP_066563.2. NM_021077.3. [P08949-1 ]
NP_995580.1. NM_205858.1. [P08949-2 ]
UniGenei Hs.386470.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1C98 NMR - A 47-56 [» ]
1C9A NMR - A 47-56 [» ]
ProteinModelPortali P08949.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110892. 2 interactions.
IntActi P08949. 1 interaction.
MINTi MINT-7969962.
STRINGi 9606.ENSP00000378089.

Polymorphism databases

DMDMi 281185514.

Proteomic databases

PaxDbi P08949.
PRIDEi P08949.

Protocols and materials databases

DNASUi 4828.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000360476 ; ENSP00000353664 ; ENSG00000197696 . [P08949-1 ]
ENST00000394588 ; ENSP00000378089 ; ENSG00000197696 . [P08949-2 ]
GeneIDi 4828.
KEGGi hsa:4828.
UCSCi uc002bkz.3. human. [P08949-1 ]
uc002bla.3. human. [P08949-2 ]

Organism-specific databases

CTDi 4828.
GeneCardsi GC15M085198.
H-InvDB HIX0202167.
HGNCi HGNC:7842. NMB.
HPAi CAB019302.
MIMi 162340. gene.
neXtProti NX_P08949.
PharmGKBi PA31654.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG40699.
HOGENOMi HOG000063661.
HOVERGENi HBG079570.
KOi K05223.
OMAi AEMTPIM.
OrthoDBi EOG761BX3.
PhylomeDBi P08949.
TreeFami TF336860.

Enzyme and pathway databases

Reactomei REACT_14819. Peptide ligand-binding receptors.
REACT_18283. G alpha (q) signalling events.

Miscellaneous databases

ChiTaRSi NMB. human.
EvolutionaryTracei P08949.
GenomeRNAii 4828.
NextBioi 18596.
PROi P08949.
SOURCEi Search...

Gene expression databases

Bgeei P08949.
CleanExi HS_NMB.
Genevestigatori P08949.

Family and domain databases

InterProi IPR000874. Bombesin.
[Graphical view ]
Pfami PF02044. Bombesin. 1 hit.
[Graphical view ]
PROSITEi PS00257. BOMBESIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of cDNAs encoding the human bombesin-like peptide neuromedin B. Chromosomal localization and comparison to cDNAs encoding its amphibian homolog ranatensin."
    Krane I.M., Naylor S.L., Helin-Davis D., Chin W.W., Spindel E.R.
    J. Biol. Chem. 263:13317-13323(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AMIDATION AT MET-56.
    Tissue: Hypothalamus.
  2. Erratum
    Krane I.M., Naylor S.L., Helin-Davis D., Chin W.W., Spindel E.R.
    J. Biol. Chem. 265:7091-7091(1990)
    Cited for: SEQUENCE REVISION.
  3. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-73.
    Tissue: Brain and Ovary.
  5. "Solution structure of neuromedin B by (1)H nuclear magnetic resonance spectroscopy."
    Lee S., Kim Y.
    FEBS Lett. 460:263-269(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 47-56.

Entry informationi

Entry nameiNMB_HUMAN
AccessioniPrimary (citable) accession number: P08949
Secondary accession number(s): Q96A06, Q96HH5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: December 15, 2009
Last modified: September 3, 2014
This is version 142 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi