Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P08949

- NMB_HUMAN

UniProt

P08949 - NMB_HUMAN

Protein

Neuromedin-B

Gene

NMB

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Stimulates smooth muscle contraction in a manner similar to that of bombesin.

    GO - Molecular functioni

    1. hormone activity Source: ProtInc

    GO - Biological processi

    1. arachidonic acid secretion Source: Ensembl
    2. cell-cell signaling Source: ProtInc
    3. glucose homeostasis Source: Ensembl
    4. negative regulation of hormone secretion Source: Ensembl
    5. neuropeptide signaling pathway Source: InterPro
    6. positive regulation of cell proliferation Source: Ensembl
    7. positive regulation of cytosolic calcium ion concentration Source: Ensembl
    8. positive regulation of hormone secretion Source: Ensembl
    9. signal transduction Source: ProtInc

    Enzyme and pathway databases

    ReactomeiREACT_14819. Peptide ligand-binding receptors.
    REACT_18283. G alpha (q) signalling events.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neuromedin-B
    Cleaved into the following 2 chains:
    Gene namesi
    Name:NMB
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:7842. NMB.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: Reactome
    2. neuron projection Source: Ensembl

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31654.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2424Add
    BLAST
    Peptidei25 – 5632Neuromedin-B-32PRO_0000003017Add
    BLAST
    Peptidei47 – 5610Neuromedin-BPRO_0000003018
    Propeptidei60 – 12162PRO_0000003019Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei56 – 561Methionine amide1 Publication

    Keywords - PTMi

    Amidation, Cleavage on pair of basic residues

    Proteomic databases

    PaxDbiP08949.
    PRIDEiP08949.

    Expressioni

    Gene expression databases

    BgeeiP08949.
    CleanExiHS_NMB.
    GenevestigatoriP08949.

    Organism-specific databases

    HPAiCAB019302.

    Interactioni

    Protein-protein interaction databases

    BioGridi110892. 2 interactions.
    IntActiP08949. 1 interaction.
    MINTiMINT-7969962.
    STRINGi9606.ENSP00000378089.

    Structurei

    Secondary structure

    1
    121
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi51 – 544

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1C98NMR-A47-56[»]
    1C9ANMR-A47-56[»]
    ProteinModelPortaliP08949.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP08949.

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG40699.
    HOGENOMiHOG000063661.
    HOVERGENiHBG079570.
    KOiK05223.
    OMAiAEMTPIM.
    OrthoDBiEOG761BX3.
    PhylomeDBiP08949.
    TreeFamiTF336860.

    Family and domain databases

    InterProiIPR000874. Bombesin.
    [Graphical view]
    PfamiPF02044. Bombesin. 1 hit.
    [Graphical view]
    PROSITEiPS00257. BOMBESIN. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P08949-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MARRAGGARM FGSLLLFALL AAGVAPLSWD LPEPRSRASK IRVHSRGNLW    50
    ATGHFMGKKS LEPSSPSPLG TAPHTSLRDQ RLQLSHDLLG ILLLKKALGV 100
    SLSRPAPQIQ YRRLLVQILQ K 121
    Length:121
    Mass (Da):13,252
    Last modified:December 15, 2009 - v4
    Checksum:i10E16BA4886F03FB
    GO
    Isoform 2 (identifier: P08949-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         111-121: YRRLLVQILQK → EAAGTNTAEMTPIMGQTQQRGLDCAHPGKVLNGTLLMAPSGCKS

    Note: No experimental confirmation available.

    Show »
    Length:154
    Mass (Da):16,309
    Checksum:i3FFBCF2BB83E2D84
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti68 – 769PLGTAPHTS → HWGQLPTPP in AAA59934. (PubMed:2458345)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti73 – 731P → T.1 Publication
    Corresponds to variant rs1051168 [ dbSNP | Ensembl ].
    VAR_060369

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei111 – 12111YRRLLVQILQK → EAAGTNTAEMTPIMGQTQQR GLDCAHPGKVLNGTLLMAPS GCKS in isoform 2. 1 PublicationVSP_000548Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M21551 mRNA. Translation: AAA59934.1.
    AC048382 Genomic DNA. No translation available.
    BC007407 mRNA. Translation: AAH07407.1.
    BC007431 mRNA. Translation: AAH07431.1.
    BC008603 mRNA. Translation: AAH08603.1.
    CCDSiCCDS10332.1. [P08949-1]
    CCDS42076.1. [P08949-2]
    PIRiA28945.
    RefSeqiNP_066563.2. NM_021077.3. [P08949-1]
    NP_995580.1. NM_205858.1. [P08949-2]
    UniGeneiHs.386470.

    Genome annotation databases

    EnsembliENST00000360476; ENSP00000353664; ENSG00000197696. [P08949-1]
    ENST00000394588; ENSP00000378089; ENSG00000197696. [P08949-2]
    GeneIDi4828.
    KEGGihsa:4828.
    UCSCiuc002bkz.3. human. [P08949-1]
    uc002bla.3. human. [P08949-2]

    Polymorphism databases

    DMDMi281185514.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M21551 mRNA. Translation: AAA59934.1 .
    AC048382 Genomic DNA. No translation available.
    BC007407 mRNA. Translation: AAH07407.1 .
    BC007431 mRNA. Translation: AAH07431.1 .
    BC008603 mRNA. Translation: AAH08603.1 .
    CCDSi CCDS10332.1. [P08949-1 ]
    CCDS42076.1. [P08949-2 ]
    PIRi A28945.
    RefSeqi NP_066563.2. NM_021077.3. [P08949-1 ]
    NP_995580.1. NM_205858.1. [P08949-2 ]
    UniGenei Hs.386470.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1C98 NMR - A 47-56 [» ]
    1C9A NMR - A 47-56 [» ]
    ProteinModelPortali P08949.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110892. 2 interactions.
    IntActi P08949. 1 interaction.
    MINTi MINT-7969962.
    STRINGi 9606.ENSP00000378089.

    Polymorphism databases

    DMDMi 281185514.

    Proteomic databases

    PaxDbi P08949.
    PRIDEi P08949.

    Protocols and materials databases

    DNASUi 4828.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000360476 ; ENSP00000353664 ; ENSG00000197696 . [P08949-1 ]
    ENST00000394588 ; ENSP00000378089 ; ENSG00000197696 . [P08949-2 ]
    GeneIDi 4828.
    KEGGi hsa:4828.
    UCSCi uc002bkz.3. human. [P08949-1 ]
    uc002bla.3. human. [P08949-2 ]

    Organism-specific databases

    CTDi 4828.
    GeneCardsi GC15M085198.
    H-InvDB HIX0202167.
    HGNCi HGNC:7842. NMB.
    HPAi CAB019302.
    MIMi 162340. gene.
    neXtProti NX_P08949.
    PharmGKBi PA31654.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG40699.
    HOGENOMi HOG000063661.
    HOVERGENi HBG079570.
    KOi K05223.
    OMAi AEMTPIM.
    OrthoDBi EOG761BX3.
    PhylomeDBi P08949.
    TreeFami TF336860.

    Enzyme and pathway databases

    Reactomei REACT_14819. Peptide ligand-binding receptors.
    REACT_18283. G alpha (q) signalling events.

    Miscellaneous databases

    ChiTaRSi NMB. human.
    EvolutionaryTracei P08949.
    GenomeRNAii 4828.
    NextBioi 18596.
    PROi P08949.
    SOURCEi Search...

    Gene expression databases

    Bgeei P08949.
    CleanExi HS_NMB.
    Genevestigatori P08949.

    Family and domain databases

    InterProi IPR000874. Bombesin.
    [Graphical view ]
    Pfami PF02044. Bombesin. 1 hit.
    [Graphical view ]
    PROSITEi PS00257. BOMBESIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of cDNAs encoding the human bombesin-like peptide neuromedin B. Chromosomal localization and comparison to cDNAs encoding its amphibian homolog ranatensin."
      Krane I.M., Naylor S.L., Helin-Davis D., Chin W.W., Spindel E.R.
      J. Biol. Chem. 263:13317-13323(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AMIDATION AT MET-56.
      Tissue: Hypothalamus.
    2. Erratum
      Krane I.M., Naylor S.L., Helin-Davis D., Chin W.W., Spindel E.R.
      J. Biol. Chem. 265:7091-7091(1990)
      Cited for: SEQUENCE REVISION.
    3. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-73.
      Tissue: Brain and Ovary.
    5. "Solution structure of neuromedin B by (1)H nuclear magnetic resonance spectroscopy."
      Lee S., Kim Y.
      FEBS Lett. 460:263-269(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 47-56.

    Entry informationi

    Entry nameiNMB_HUMAN
    AccessioniPrimary (citable) accession number: P08949
    Secondary accession number(s): Q96A06, Q96HH5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1988
    Last sequence update: December 15, 2009
    Last modified: October 1, 2014
    This is version 143 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3