Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P08949 (NMB_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 138. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Neuromedin-B

Cleaved into the following 2 chains:

  1. Neuromedin-B-32
  2. Neuromedin-B
Gene names
Name:NMB
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length121 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Stimulates smooth muscle contraction in a manner similar to that of bombesin.

Subcellular location

Secreted.

Sequence similarities

Belongs to the bombesin/neuromedin-B/ranatensin family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P08949-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P08949-2)

The sequence of this isoform differs from the canonical sequence as follows:
     111-121: YRRLLVQILQK → EAAGTNTAEMTPIMGQTQQRGLDCAHPGKVLNGTLLMAPSGCKS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2424
Peptide25 – 5632Neuromedin-B-32
PRO_0000003017
Peptide47 – 5610Neuromedin-B
PRO_0000003018
Propeptide60 – 12162
PRO_0000003019

Amino acid modifications

Modified residue561Methionine amide

Natural variations

Alternative sequence111 – 12111YRRLLVQILQK → EAAGTNTAEMTPIMGQTQQR GLDCAHPGKVLNGTLLMAPS GCKS in isoform 2.
VSP_000548
Natural variant731P → T. Ref.4
Corresponds to variant rs1051168 [ dbSNP | Ensembl ].
VAR_060369

Experimental info

Sequence conflict68 – 769PLGTAPHTS → HWGQLPTPP in AAA59934. Ref.1

Secondary structure

... 121
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 15, 2009. Version 4.
Checksum: 10E16BA4886F03FB

FASTA12113,252
        10         20         30         40         50         60 
MARRAGGARM FGSLLLFALL AAGVAPLSWD LPEPRSRASK IRVHSRGNLW ATGHFMGKKS 

        70         80         90        100        110        120 
LEPSSPSPLG TAPHTSLRDQ RLQLSHDLLG ILLLKKALGV SLSRPAPQIQ YRRLLVQILQ 


K 

« Hide

Isoform 2 [UniParc].

Checksum: 3FFBCF2BB83E2D84
Show »

FASTA15416,309

References

« Hide 'large scale' references
[1]"Molecular cloning of cDNAs encoding the human bombesin-like peptide neuromedin B. Chromosomal localization and comparison to cDNAs encoding its amphibian homolog ranatensin."
Krane I.M., Naylor S.L., Helin-Davis D., Chin W.W., Spindel E.R.
J. Biol. Chem. 263:13317-13323(1988) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Hypothalamus.
[2]Erratum
Krane I.M., Naylor S.L., Helin-Davis D., Chin W.W., Spindel E.R.
J. Biol. Chem. 265:7091-7091(1990)
Cited for: SEQUENCE REVISION.
[3]"Analysis of the DNA sequence and duplication history of human chromosome 15."
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. expand/collapse author list , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-73.
Tissue: Brain and Ovary.
[5]"Solution structure of neuromedin B by (1)H nuclear magnetic resonance spectroscopy."
Lee S., Kim Y.
FEBS Lett. 460:263-269(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 47-56.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M21551 mRNA. Translation: AAA59934.1.
AC048382 Genomic DNA. No translation available.
BC007407 mRNA. Translation: AAH07407.1.
BC007431 mRNA. Translation: AAH07431.1.
BC008603 mRNA. Translation: AAH08603.1.
PIRA28945.
RefSeqNP_066563.2. NM_021077.3.
NP_995580.1. NM_205858.1.
UniGeneHs.386470.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1C98NMR-A47-56[»]
1C9ANMR-A47-56[»]
ProteinModelPortalP08949.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110892. 2 interactions.
IntActP08949. 1 interaction.
MINTMINT-7969962.
STRING9606.ENSP00000378089.

Polymorphism databases

DMDM281185514.

Proteomic databases

PaxDbP08949.
PRIDEP08949.

Protocols and materials databases

DNASU4828.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000360476; ENSP00000353664; ENSG00000197696. [P08949-1]
ENST00000394588; ENSP00000378089; ENSG00000197696. [P08949-2]
GeneID4828.
KEGGhsa:4828.
UCSCuc002bkz.3. human. [P08949-1]
uc002bla.3. human. [P08949-2]

Organism-specific databases

CTD4828.
GeneCardsGC15M085198.
H-InvDBHIX0202167.
HGNCHGNC:7842. NMB.
HPACAB019302.
MIM162340. gene.
neXtProtNX_P08949.
PharmGKBPA31654.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG40699.
HOGENOMHOG000063661.
HOVERGENHBG079570.
KOK05223.
OMACAHPGKV.
OrthoDBEOG761BX3.
PhylomeDBP08949.
TreeFamTF336860.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

BgeeP08949.
CleanExHS_NMB.
GenevestigatorP08949.

Family and domain databases

InterProIPR000874. Bombesin.
[Graphical view]
PfamPF02044. Bombesin. 1 hit.
[Graphical view]
PROSITEPS00257. BOMBESIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSNMB. human.
EvolutionaryTraceP08949.
GenomeRNAi4828.
NextBio18596.
PROP08949.
SOURCESearch...

Entry information

Entry nameNMB_HUMAN
AccessionPrimary (citable) accession number: P08949
Secondary accession number(s): Q96A06, Q96HH5
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1988
Last sequence update: December 15, 2009
Last modified: March 19, 2014
This is version 138 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 15

Human chromosome 15: entries, gene names and cross-references to MIM