Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sex hormone-binding globulin

Gene

Shbg

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • primary spermatocyte growth Source: RGD
Complete GO annotation...

Keywords - Ligandi

Lipid-binding, Steroid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Sex hormone-binding globulin
Short name:
SHBG
Alternative name(s):
Sex steroid-binding protein
Short name:
SBP
Testis-specific androgen-binding protein
Short name:
ABP
Gene namesi
Name:Shbg
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3671. Shbg.

Subcellular locationi

  • Secreted

  • Note: In testis, it is synthesized by the Sertoli cells, secreted into the lumen of the seminiferous tubule and transported to the epididymis.

GO - Cellular componenti

  • extracellular space Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL4932.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 30Sequence analysisAdd BLAST30
ChainiPRO_000003256131 – 403Sex hormone-binding globulinAdd BLAST373

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi194 ↔ 218PROSITE-ProRule annotation
Glycosylationi274N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi363 ↔ 391PROSITE-ProRule annotation
Glycosylationi397N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP08689.
PRIDEiP08689.

Expressioni

Tissue specificityi

Isoform 2 is only expressed in the liver.

Developmental stagei

In the fetal liver, expressed from day 14 to day 17 after conception.

Gene expression databases

BgeeiENSRNOG00000011357.
GenevisibleiP08689. RN.

Interactioni

Subunit structurei

Homodimer.

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000015248.

Chemistry databases

BindingDBiP08689.

Structurei

3D structure databases

ProteinModelPortaliP08689.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini46 – 218Laminin G-like 1PROSITE-ProRule annotationAdd BLAST173
Domaini225 – 391Laminin G-like 2PROSITE-ProRule annotationAdd BLAST167

Sequence similaritiesi

Contains 2 laminin G-like domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiENOG410IKW6. Eukaryota.
ENOG410YKMT. LUCA.
HOGENOMiHOG000285982.
HOVERGENiHBG017800.
InParanoidiP08689.
OrthoDBiEOG091G0D6A.
PhylomeDBiP08689.
TreeFamiTF334367.

Family and domain databases

Gene3Di2.60.120.200. 3 hits.
InterProiIPR013320. ConA-like_dom.
IPR001791. Laminin_G.
[Graphical view]
PfamiPF00054. Laminin_G_1. 1 hit.
[Graphical view]
SMARTiSM00282. LamG. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 2 hits.
PROSITEiPS50025. LAM_G_DOMAIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P08689-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKGEVASLR CRLLLLLLLL TLPPTHQGRT LRHIDPIQSA QDSPAKYLSN
60 70 80 90 100
GPGQEPVTVL TIDLTKISKP SSSFEFRTWD PEGVIFYGDT NTEDDWFMLG
110 120 130 140 150
LRDGQLEIQL HNLWARLTVG FGPRLNDGRW HPVELKMNGD SLLLWVDGKE
160 170 180 190 200
MLCLRQVSAS LADHPQLSMR IALGGLLLPT SKLRFPLVPA LDGCIRRDIW
210 220 230 240 250
LGHQAQLSTS ARTSLGNCDV DLQPGLFFPP GTHAEFSLQD IPQPHTDPWT
260 270 280 290 300
FSLELGFKLV DGAGRLLTLG TGTNSSWLTL HLQDQTVVLS SEAEPKLALP
310 320 330 340 350
LAVGLPLQLK LDVFKVALSQ GPKMEVLSTS LLRLASLWRL WSHPQGHLSL
360 370 380 390 400
GALPGEDSSA SFCLSDLWVQ GQRLDIDKAL SRSQDIWTHS CPQSPSNDTH

TSH
Length:403
Mass (Da):44,533
Last modified:January 1, 1988 - v1
Checksum:i2B359392CEFDF39D
GO
Isoform 2 (identifier: P08689-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MEKGEVASLRCRLLLLLLLLTLPPTHQGRTLRHIDPIQ → QSREERGRARSVGLDFRLHK
     241-245: Missing.

Note: Incomplete sequence.
Show »
Length:380
Mass (Da):42,012
Checksum:i0340107C42562D59
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti347H → R in AAA40649 (PubMed:3135485).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0060931 – 38MEKGE…IDPIQ → QSREERGRARSVGLDFRLHK in isoform 2. CuratedAdd BLAST38
Alternative sequenceiVSP_006094241 – 245Missing in isoform 2. Curated5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M15034 mRNA. Translation: AAA40648.1.
M19993 Genomic DNA. Translation: AAA40650.1.
BC097336 mRNA. Translation: AAH97336.1.
M38759 mRNA. Translation: AAA63476.1. Different termination.
M31179 mRNA. Translation: AAA40649.1.
PIRiA40935. A26371.
RefSeqiNP_036782.1. NM_012650.1. [P08689-1]
UniGeneiRn.37473.

Genome annotation databases

GeneIDi24775.
KEGGirno:24775.
UCSCiRGD:3671. rat. [P08689-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M15034 mRNA. Translation: AAA40648.1.
M19993 Genomic DNA. Translation: AAA40650.1.
BC097336 mRNA. Translation: AAH97336.1.
M38759 mRNA. Translation: AAA63476.1. Different termination.
M31179 mRNA. Translation: AAA40649.1.
PIRiA40935. A26371.
RefSeqiNP_036782.1. NM_012650.1. [P08689-1]
UniGeneiRn.37473.

3D structure databases

ProteinModelPortaliP08689.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000015248.

Chemistry databases

BindingDBiP08689.
ChEMBLiCHEMBL4932.

Proteomic databases

PaxDbiP08689.
PRIDEiP08689.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi24775.
KEGGirno:24775.
UCSCiRGD:3671. rat. [P08689-1]

Organism-specific databases

CTDi6462.
RGDi3671. Shbg.

Phylogenomic databases

eggNOGiENOG410IKW6. Eukaryota.
ENOG410YKMT. LUCA.
HOGENOMiHOG000285982.
HOVERGENiHBG017800.
InParanoidiP08689.
OrthoDBiEOG091G0D6A.
PhylomeDBiP08689.
TreeFamiTF334367.

Miscellaneous databases

PROiP08689.

Gene expression databases

BgeeiENSRNOG00000011357.
GenevisibleiP08689. RN.

Family and domain databases

Gene3Di2.60.120.200. 3 hits.
InterProiIPR013320. ConA-like_dom.
IPR001791. Laminin_G.
[Graphical view]
PfamiPF00054. Laminin_G_1. 1 hit.
[Graphical view]
SMARTiSM00282. LamG. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 2 hits.
PROSITEiPS50025. LAM_G_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSHBG_RAT
AccessioniPrimary (citable) accession number: P08689
Secondary accession number(s): Q4QR94, Q63029
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 1, 1988
Last sequence update: January 1, 1988
Last modified: November 30, 2016
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

A putative trans-splicing which involves HDC and SHBG gene regions produces a fusion protein expressed in fetal liver.

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.