P08686 (CP21A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 158.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Steroid 21-hydroxylase EC=1.14.99.10 Alternative name(s): 21-OHase Cytochrome P-450c21 Cytochrome P450 21 Cytochrome P450 XXI Cytochrome P450-C21 Cytochrome P450-C21B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 494 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Specifically catalyzes the 21-hydroxylation of steroids. Required for the adrenal synthesis of mineralocorticoids and glucocorticoids. |
| Catalytic activity | A C21 steroid + (reduced NADPH--hemoprotein reductase) + O2 = a 21-hydroxy-C(21)-steroid + (oxidized NADPH--hemoprotein reductase) + H2O. |
| Cofactor | Heme group. |
| Subcellular location | Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein. |
| Domain | The leucine-rich hydrophobic amino acid N-terminal region probably helps to anchor the protein to the microsomal membrane. |
| Polymorphism | Seven non deleterious alleles are known: CYP21A2*1A, CYP21A2*1B, CYP21A2*2, CYP21A2*3, CYP21A2*4, CYP21A2*5 and CYP21A2*6. The sequence shown corresponds to allele CYP21A2*1B. Deleterious alleles are mostly generated by recombinations between CYP21A2 and the pseudogene CYP21A1P through gene conversion. This process consists of recombination events that either delete CYP21A2 or transfer deleterious mutations from CYP21A1P to CYP21A2. |
| Involvement in disease | Adrenal hyperplasia 3 (AH3) [MIM:201910]: A form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: 'salt wasting' (SW, the most severe type), 'simple virilizing' (SV, less severely affected patients), with normal aldosterone biosynthesis, 'non-classic form' or late-onset (NC or LOAH)and 'cryptic' (asymptomatic). |
| Sequence similarities | Belongs to the cytochrome P450 family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P08686-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P08686-2) The sequence of this isoform differs from the canonical sequence as follows: 6-6: L → LL 68-102: VVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSK → KLVSR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 494 | 494 | Steroid 21-hydroxylase | PRO_0000051976 | |||||
Regions | |||||||||
| Region | 342 – 358 | 17 | Steroid-binding By similarity | ||||||
Sites | |||||||||
| Metal binding | 428 | 1 | Iron (heme axial ligand) | ||||||
Natural variations | |||||||||
| Alternative sequence | 6 | 1 | L → LL in isoform 2. | VSP_046264 | |||||
| Alternative sequence | 68 – 102 | 35 | VVVLN…KLVSK → KLVSR in isoform 2. | VSP_046265 | |||||
| Natural variant | 9 | 1 | L → LL in allele CYP21A2*2. Ref.3 Ref.4 Ref.5 Ref.19 | VAR_018363 | |||||
| Natural variant | 15 | 1 | A → T in AH3; salt wasting form; no significant difference in activity compared with the wild-type. Ref.50 Ref.55 Corresponds to variant rs63749090 [ dbSNP | Ensembl ]. | VAR_026059 | |||||
| Natural variant | 30 | 1 | P → L in AH3; non-classic form; 50% activity; 10% of non-classic AH3 Texan patients. Ref.21 Ref.22 Ref.33 Ref.35 Ref.36 Ref.38 Ref.42 Ref.43 Ref.44 Ref.45 Ref.47 Ref.50 Ref.51 Ref.55 Ref.56 Ref.57 Ref.58 | VAR_001281 | |||||
| Natural variant | 30 | 1 | P → Q in AH3; does not affect membrane binding; enzyme function abolished. Ref.32 | VAR_026060 | |||||
| Natural variant | 56 | 1 | G → R in AH3; loss of activity. Ref.59 | VAR_065668 | |||||
| Natural variant | 62 | 1 | H → L in AH3; non-classic form; simple virilizing form when associated with a second mild mutation such as S-453 or L-30; activity is significantly reduced in association with S-453. Ref.51 Ref.58 Ref.59 | VAR_018364 | |||||
| Natural variant | 64 | 1 | G → E in AH3; no activity. Ref.35 | VAR_007923 | |||||
| Natural variant | 77 | 1 | I → T in AH3; simple virilizing form. Ref.61 | VAR_065669 | |||||
| Natural variant | 90 | 1 | G → V in AH3. Ref.33 | VAR_026061 | |||||
| Natural variant | 98 | 1 | K → R. | VAR_001282 | |||||
| Natural variant | 102 | 1 | K → R in allele CYP21A2*3. Ref.3 Ref.5 Ref.56 | VAR_001283 | |||||
| Natural variant | 105 | 1 | P → L in AH3. Ref.24 Ref.29 | VAR_001284 | |||||
| Natural variant | 107 | 1 | L → R in AH3; loss of activity. Ref.59 | VAR_065670 | |||||
| Natural variant | 121 | 1 | K → Q in AH3; non-classic form; reduced activity; decreased affinity for 17-hydroxyprogesterone and progesterone. Ref.60 | VAR_065671 | |||||
| Natural variant | 124 | 1 | R → H in AH3. Ref.54 Corresponds to variant rs72552750 [ dbSNP | Ensembl ]. | VAR_026062 | |||||
| Natural variant | 142 | 1 | L → P in AH3; loss of activity. Ref.59 | VAR_065672 | |||||
| Natural variant | 167 | 1 | L → P in AH3; salt wasting form; loss of activity. Ref.61 | VAR_065673 | |||||
| Natural variant | 169 | 1 | C → Y in AH3. Ref.34 | VAR_001285 | |||||
| Natural variant | 172 | 1 | I → N in AH3; simple virilizing form; 1-4% activity. Ref.11 Ref.12 Ref.13 Ref.19 Ref.20 Ref.22 Ref.26 Ref.33 Ref.35 Ref.36 Ref.38 Ref.39 Ref.42 Ref.43 Ref.44 Ref.45 Ref.47 Ref.50 Ref.51 Ref.52 Ref.53 Ref.56 Ref.57 Ref.58 Ref.59 Ref.61 | VAR_001286 | |||||
| Natural variant | 178 | 1 | G → A in AH3. Ref.33 Corresponds to variant rs72552751 [ dbSNP | Ensembl ]. | VAR_026063 | |||||
| Natural variant | 183 | 1 | D → E in allele CYP21A2*4. Corresponds to variant rs1040310 [ dbSNP | Ensembl ]. | VAR_001287 | |||||
| Natural variant | 196 | 1 | Missing in AH3; moderate. Ref.31 | VAR_008688 | |||||
| Natural variant | 211 | 1 | V → L in AH3; non-classic form; pathogenicity uncertain. Ref.18 | VAR_026064 | |||||
| Natural variant | 230 | 1 | I → T in AH3. Ref.61 | VAR_065674 | |||||
| Natural variant | 233 | 1 | R → K in AH3. Ref.61 | VAR_065675 | |||||
| Natural variant | 236 | 1 | I → N in AH3; salt wasting form. Ref.22 Ref.26 Ref.35 Ref.36 Ref.56 | VAR_001288 | |||||
| Natural variant | 237 | 1 | V → E in AH3; salt wasting form. Ref.22 Ref.36 Ref.56 Corresponds to variant rs12530380 [ dbSNP | Ensembl ]. | VAR_001289 | |||||
| Natural variant | 239 | 1 | M → K in AH3; salt wasting form. Ref.22 Ref.36 Ref.56 Corresponds to variant rs6476 [ dbSNP | Ensembl ]. | VAR_001290 | |||||
| Natural variant | 261 | 1 | L → P in AH3. Ref.43 | VAR_026065 | |||||
| Natural variant | 268 | 1 | S → T in allele CYP21A2*5. Ref.3 Ref.21 Ref.38 Ref.40 Corresponds to variant rs6472 [ dbSNP | Ensembl ]. | VAR_001291 | |||||
| Natural variant | 281 | 1 | V → G in AH3; salt wasting form. Ref.42 | VAR_026066 | |||||
| Natural variant | 281 | 1 | V → L in AH3; non-classic form; 50% activity; most common variant; normal KM but 20% reduced Vmax. Ref.4 Ref.14 Ref.15 Ref.18 Ref.22 Ref.26 Ref.33 Ref.34 Ref.35 Ref.36 Ref.37 Ref.38 Ref.40 Ref.42 Ref.44 Ref.45 Ref.47 Ref.50 Ref.51 Ref.52 Ref.55 Ref.56 Ref.61 Corresponds to variant rs6471 [ dbSNP | Ensembl ]. | VAR_001292 | |||||
| Natural variant | 283 | 1 | M → L in AH3. Ref.47 | VAR_026067 | |||||
| Natural variant | 291 | 1 | G → C in AH3. Ref.33 | VAR_026068 | |||||
| Natural variant | 291 | 1 | G → R in AH3. Ref.52 | VAR_018365 | |||||
| Natural variant | 291 | 1 | G → S in AH3; salt wasting form; less then 1% activity. Ref.24 Ref.31 Ref.35 Ref.45 Ref.56 Ref.61 | VAR_001293 | |||||
| Natural variant | 292 | 1 | G → D in AH3; salt wasting form; less then 1% activity. Ref.61 | VAR_065676 | |||||
| Natural variant | 300 | 1 | L → F in AH3; salt wasting form. Ref.42 | VAR_026069 | |||||
| Natural variant | 301 | 1 | S → Y in AH3. Ref.52 | VAR_018366 | |||||
| Natural variant | 304 | 1 | V → M in hyperandrogenism; due to 21-hydroxylase deficiency; non-classic type; residual activity of 46% for conversion of 17-hydroxyprogesterone and 26% for conversion of progesterone compared with the normal enzyme. Ref.48 | VAR_026070 | |||||
| Natural variant | 317 | 1 | L → M in AH3. Ref.44 | VAR_026071 | |||||
| Natural variant | 320 | 1 | E → K in AH3; simple virilizing form; 4% activity. Ref.61 | VAR_065677 | |||||
| Natural variant | 339 | 1 | R → H in AH3; non-classic form; 50% activity. Ref.5 | VAR_001294 | |||||
| Natural variant | 341 | 1 | R → P in AH3; simple virilizing form. Ref.51 Ref.52 Ref.61 | VAR_018367 | |||||
| Natural variant | 341 | 1 | R → W in AH3; non-classic form; mild. | VAR_001295 | |||||
| Natural variant | 354 | 1 | R → C in AH3; salt wasting form. Ref.42 | VAR_026072 | |||||
| Natural variant | 354 | 1 | R → H in AH3; salt wasting form. Ref.33 Ref.61 | VAR_026073 | |||||
| Natural variant | 356 | 1 | R → P in AH3; salt wasting form; 0.15% activity. Ref.28 | VAR_001296 | |||||
| Natural variant | 356 | 1 | R → Q in AH3; simple virilizing form; mild; 0.65% activity. Ref.28 Ref.34 Ref.56 | VAR_001297 | |||||
| Natural variant | 356 | 1 | R → W in AH3; salt wasting form. Ref.19 Ref.22 Ref.33 Ref.35 Ref.36 Ref.37 Ref.38 Ref.39 Ref.42 Ref.43 Ref.44 Ref.45 Ref.47 Ref.51 Ref.52 Ref.53 Ref.56 Ref.57 Ref.58 Ref.59 Ref.61 | VAR_001298 | |||||
| Natural variant | 362 | 1 | A → V in AH3; no activity. Ref.35 | VAR_007924 | |||||
| Natural variant | 363 | 1 | L → W in AH3. Ref.46 | VAR_026074 | |||||
| Natural variant | 365 | 1 | H → Y in AH3. Ref.56 | VAR_026075 | |||||
| Natural variant | 369 | 1 | R → W in AH3. Ref.61 | VAR_065678 | |||||
| Natural variant | 375 | 1 | G → S in hyperandrogenism; due to 21-hydroxylase deficiency; almost completely abolished enzyme activity. Ref.48 | VAR_026076 | |||||
| Natural variant | 380 | 1 | E → D in AH3; salt wasting form. Ref.27 | VAR_001299 | |||||
| Natural variant | 408 | 1 | R → C in AH3; very low residual activity. Ref.49 Ref.59 Ref.61 | VAR_026077 | |||||
| Natural variant | 424 | 1 | G → S in AH3; very low activity. Ref.37 Ref.45 Ref.49 Ref.61 | VAR_026078 | |||||
| Natural variant | 426 | 1 | R → H in AH3; exhibit only low enzyme activity toward 17-hydroxyprogesterone. Ref.45 Ref.61 | VAR_026079 | |||||
| Natural variant | 435 | 1 | R → C in AH3. Ref.44 | VAR_026080 | |||||
| Natural variant | 453 | 1 | P → S in AH3; non-classic form; simple virilizing form when associated with L-62; 50% of activity; almost completely abolished enzyme activity when associated with S-375. Ref.5 Ref.23 Ref.24 Ref.29 Ref.33 Ref.40 Ref.42 Ref.44 Ref.45 Ref.47 Ref.48 Ref.50 Ref.51 Ref.56 Ref.58 Ref.59 Ref.60 Ref.61 Corresponds to variant rs6445 [ dbSNP | Ensembl ]. | VAR_001300 | |||||
| Natural variant | 479 | 1 | R → L in AH3. Ref.56 | VAR_026081 | |||||
| Natural variant | 482 | 1 | P → S in AH3; reduced enzyme activity to 70% of normal. Ref.55 | VAR_026082 | |||||
| Natural variant | 483 | 1 | R → P in AH3; moderate; 1-2% of activity. Ref.25 Ref.26 Ref.31 Ref.43 Ref.45 Ref.51 Ref.56 | VAR_001301 | |||||
| Natural variant | 483 | 1 | R → Q in AH3. Ref.52 | VAR_018368 | |||||
| Natural variant | 483 | 1 | R → W in AH3; salt wasting form. Ref.53 | VAR_026083 | |||||
| Natural variant | 493 | 1 | N → S in allele CYP21A2*6. Ref.3 Ref.5 Ref.10 Ref.26 Ref.38 Ref.40 Corresponds to variant rs6473 [ dbSNP | Ensembl ]. | VAR_001302 | |||||
Experimental info | |||||||||
| Mutagenesis | 268 | 1 | S → C, M or T: No loss of function. Ref.15 | ||||||
| Mutagenesis | 281 | 1 | V → I: Normal KM but 50% reduced Vmax. | ||||||
| Mutagenesis | 281 | 1 | V → T: Normal KM but 10% reduced Vmax. | ||||||
| Mutagenesis | 428 | 1 | C → M, S or T: Loss of activity and loss of P450 absorption. Ref.15 | ||||||
| Sequence conflict | 155 | 1 | G → D in BAB70774. Ref.7 | ||||||
| Sequence conflict | 242 | 1 | R → G in BAB70774. Ref.7 | ||||||
| Sequence conflict | 277 | 1 | L → Q in BAB70774. Ref.7 | ||||||
| Sequence conflict | 304 | 1 | V → A in BAB70774. Ref.7 | ||||||
| Sequence conflict | 311 | 1 | P → L in AAA59985. Ref.14 | ||||||
| Sequence conflict | 346 | 1 | N → I in AAA59985. Ref.14 | ||||||
| Sequence conflict | 426 | 1 | R → P in AAB59440. Ref.1 | ||||||
| Sequence conflict | 437 | 1 | E → D in AAB59440. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete nucleotide sequence of two steroid 21-hydroxylase genes tandemly arranged in human chromosome: a pseudogene and a genuine gene." Higashi Y., Yoshioka H., Yamane M., Gotoh O., Fujii-Kuriyama Y. Proc. Natl. Acad. Sci. U.S.A. 83:2841-2845(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ALLELE CYP21A2*1A). |
| [2] | "Structure of human steroid 21-hydroxylase genes." White P.C., New M.I., Dupont B. Proc. Natl. Acad. Sci. U.S.A. 83:5111-5115(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ALLELE CYP21A2*1B) (ISOFORM 1). |
| [3] | "Molecular characterization of the HLA-linked steroid 21-hydroxylase B gene from an individual with congenital adrenal hyperplasia." Rodrigues N.R., Dunham I., Yu C.Y., Carroll M.C., Porter R.R., Campbell R.D. EMBO J. 6:1653-1661(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT AH3 THR-268, VARIANTS LEU-9 INS; ARG-102 AND SER-493. |
| [4] | "Nonsense mutation causing steroid 21-hydroxylase deficiency." Globerman H., Amor M., Parker K.L., New M.I., White P.C. J. Clin. Invest. 82:139-144(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT AH3 LEU-281, VARIANT LEU-9 INS. |
| [5] | "R339H and P453S: CYP21 mutations associated with nonclassic steroid 21-hydroxylase deficiency that are not apparent gene conversions." Helmberg A., Tusie-Luna M.-T., Tabarelli M., Kofler R., White P.C. Mol. Endocrinol. 6:1318-1322(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-9 INS; ARG-102 AND SER-493, VARIANTS AH3 HIS-339 AND SER-453. Tissue: Peripheral blood. |
| [6] | "Linkage analysis of the C4A/C4B copy number variation and polymorphisms of the adjacent steroid 21-hydroxylase gene in a healthy population." Blasko B., Banlaki Z., Gyapay G., Pozsonyi E., Sasvari-Szekely M., Rajczy K., Fust G., Szilagyi A. Mol. Immunol. 46:2623-2629(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ALLELE CYP21A2*6) (ISOFORM 2). Tissue: Adrenal gland. |
| [8] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-493. |
| [11] | "A de novo pathological point mutation at the 21-hydroxylase locus: implications for gene conversion in the human genome." Collier S., Tassabehji M., Sinnott P., Strachan T. Nat. Genet. 3:260-265(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 109-185, VARIANT ASN-172. |
| [12] | "Mapping of steroid 21-hydroxylase genes adjacent to complement component C4 genes in HLA, the major histocompatibility complex in man." Carroll M.C., Campbell R.D., Porter R.R. Proc. Natl. Acad. Sci. U.S.A. 82:521-525(1985) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 149-182, VARIANT AH3 ASN-172. |
| [13] | "Mutation in the CYP21B gene (Ile-172-->Asn) causes steroid 21-hydroxylase deficiency." Amor M., Parker K.L., Globerman H., New M.I., White P.C. Proc. Natl. Acad. Sci. U.S.A. 85:1600-1604(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 149-182, VARIANT AH3 ASN-172. |
| [14] | "P450XXI (steroid 21-hydroxylase) gene deletions are not found in family studies of congenital adrenal hyperplasia." Matteson K.J., Phillips J.A. III, Miller W.L., Chung B.C., Orlando P.J., Frisch H., Ferrandez A., Burr I.M. Proc. Natl. Acad. Sci. U.S.A. 84:5858-5862(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 265-494 (ISOFORM 1), VARIANT AH3 LEU-281. |
| [15] | "Mutations of P450c21 (steroid 21-hydroxylase) at Cys428, Val281, and Ser268 result in complete, partial, or no loss of enzymatic activity, respectively." Wu D.-A., Chung B.-C. J. Clin. Invest. 88:519-523(1991) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF VARIANT AH3 LEU-281, MUTAGENESIS OF SER-268 AND CYS-428. |
| [16] | "Molecular genetics of 21-hydroxylase deficient late-onset adrenal hyperplasia." Gunn S.K., Sherman L.D., Therrell B.L., Owerbach D.I. Semin. Reprod. Endocrinol. 11:347-352(1993) Cited for: REVIEW ON AH3 VARIANTS. |
| [17] | "Mutations in steroid 21-hydroxylase (CYP21)." White P.C., Tusie-Luna M.-T., New M.I., Speiser P.W. Hum. Mutat. 3:373-378(1994) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON AH3 VARIANTS, GENE CONVERSION. |
| [18] | "Molecular genetic analysis of nonclassic steroid 21-hydroxylase deficiency associated with HLA-B14,DR1." Speiser P.W., New M.I., White P.C. N. Engl. J. Med. 319:19-23(1988) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-211 AND LEU-281. |
| [19] | "A missense mutation at Ile172-->Asn or Arg356-->Trp causes steroid 21-hydroxylase deficiency." Chiou S.-H., Hu M.-C., Chung B.-C. J. Biol. Chem. 265:3549-3552(1990) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 ASN-172 AND TRP-356, VARIANT LEU-9 INS. |
| [20] | "Substitution of Ile-172 to Asn in the steroid 21-hydroxylase B (P450c21B) gene in a Finnish patient with the simple virilizing form of congenital adrenal hyperplasia." Partanen J., Campbell R.D. Hum. Genet. 87:716-720(1991) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT AH3 ASN-172. |
| [21] | "A mutation (Pro-30 to Leu) in CYP21 represents a potential nonclassic steroid 21-hydroxylase deficiency allele." Tusie-Luna M.T., Speiser P.W., Dumic M., New M.I., White P.C. Mol. Endocrinol. 5:685-692(1991) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT AH3 LEU-30, VARIANT THR-268. |
| [22] | "Disease expression and molecular genotype in congenital adrenal hyperplasia due to 21-hydroxylase deficiency." Speiser P.W., Dupont J., Zhu D., Serrat J., Buegeleisen M., Tusie-Luna M.-T., Lesser M., New M.I., White P.C. J. Clin. Invest. 90:584-595(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; ASN-172; ASN-236; GLU-237; LYS-239; LEU-281 AND TRP-356. |
| [23] | "Pro-453 to Ser mutation in CYP21 is associated with nonclassic steroid 21-hydroxylase deficiency." Owerbach D., Sherman L., Ballard A.L., Azziz R. Mol. Endocrinol. 6:1211-1215(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT AH3 SER-453. |
| [24] | "Steroid 21-hydroxylase deficiency: three additional mutated alleles and establishment of phenotype-genotype relationships of common mutations." Wedell A., Ritzen E.M., Haglund-Stengler B., Luthman H. Proc. Natl. Acad. Sci. U.S.A. 89:7232-7236(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-105; SER-291 AND SER-453. |
| [25] | "Steroid 21-hydroxylase (P450c21): a new allele and spread of mutations through the pseudogene." Wedell A., Luthman H. Hum. Genet. 91:236-240(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT AH3 PRO-483. |
| [26] | "Screening of CYP21 gene mutations in 129 French patients affected by steroid 21-hydroxylase deficiency." Barbat B., Bogyo A., Raux-Demay M.-C., Kuttenn F., Boue J., Simon-Bouy B., Serre J.-L., Boue A., Mornet E. Hum. Mutat. 5:126-130(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 ASN-172; ASN-236; LEU-281 AND PRO-483, VARIANT SER-493. |
| [27] | "E380D: a novel point mutation of CYP21 in an HLA-homozygous patient with salt-losing congenital adrenal hyperplasia due to 21-hydroxylase deficiency." Kirby-Keyser L., Porter C.C., Donohoue P.A. Hum. Mutat. 9:181-182(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT AH3 ASP-380. |
| [28] | "A cluster of missense mutations at Arg356 of human steroid 21-hydroxylase may impair redox partner interaction." Lajic S., Levo A., Nikoshkov A., Lundberg Y., Partanen J., Wedell A. Hum. Genet. 99:704-709(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 PRO-356 AND GLN-356. |
| [29] | "Synergistic effect of partially inactivating mutations in steroid 21-hydroxylase deficiency." Nikoshkov A., Lajic S., Holst M., Wedell A., Luthman H. J. Clin. Endocrinol. Metab. 82:194-199(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-105 AND SER-453. |
| [30] | "Molecular genetic analysis of patients carrying steroid 21-hydroxylase deficiency in the Mexican population: identification of possible new mutations and high prevalence of apparent germ-line mutations." Ordonez-Sanchez M.L., Ramirez-Jimenez S., Lopez-Gutierrez A.U., Riba L., Gamboa-Cardiel S., Cerrillo-Hinojosa M., Altamirano-Bustamante N., Calzada-Leon R., Robles-Valdes C., Mendoza-Morfin F., Tusie-Luna M.T. Hum. Genet. 102:170-177(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3, VARIANTS. |
| [31] | "Naturally occurring mutants of human steroid 21-hydroxylase (P450c21) pinpoint residues important for enzyme activity and stability." Nikoshkov A., Lajic S., Vlamis-Gardikas A., Tranebjaerg L., Holst M., Wedell A., Luthman H. J. Biol. Chem. 273:6163-6165(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 GLU-196 DEL; SER-291 AND PRO-483. |
| [32] | "Effects of missense mutations and deletions on membrane anchoring and enzyme function of human steroid 21-hydroxylase (P450c21)." Lajic S., Nikoshkov A., Holst M., Wedell A. Biochem. Biophys. Res. Commun. 257:384-390(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT AH3 GLN-30, CHARACTERIZATION OF VARIANT AH3 GLN-30. |
| [33] | "Mutation analysis in patients with congenital adrenal hyperplasia in the Spanish population: identification of putative novel steroid 21-hydroxylase deficiency alleles associated with the classic form of the disease." Lobato M.N., Ordonez-Sanchez M.L., Tusie-Luna M.T., Meseguer A. Hum. Hered. 49:169-175(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; VAL-90; ASN-172; ALA-178; LEU-281; CYS-291; HIS-354; TRP-356 AND SER-453. |
| [34] | "Identification of CYP21 mutations, one novel, by single strand conformational polymorphism (SSCP) analysis." Witchel S.F., Smith R., Suda-Hartman M. Hum. Mutat. 13:172-172(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 TYR-169; LEU-281 AND GLN-356. |
| [35] | "Steroid 21-hydroxylase deficiency: mutational spectrum in Denmark, three novel mutations, and in vitro expression analysis." Ohlsson G., Mueller J., Skakkebaek N.E., Schwartz M. Hum. Mutat. 13:482-486(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; GLU-64; ASN-172; ASN-236; LEU-281; SER-291; TRP-356 AND VAL-362. |
| [36] | "A rapid screening for steroid 21-hydroxylase mutations in patients with congenital adrenal hyperplasia." Kapelari K., Ghanaati Z., Wollmann H., Ventz M., Ranke M.B., Kofler R., Peters H. Hum. Mutat. 13:505-505(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; ASN-172; ASN-236; GLU-237; LYS-239; LEU-281 AND TRP-356. |
| [37] | "A novel missense mutation, GLY424SER, in Brazilian patients with 21-hydroxylase deficiency." Billerbeck A.E.C., Bachega T.A.S.S., Frazatto E.T., Nishi M.Y., Goldberg A.C., Marin M.L.C., Madureira G., Monte O., Arnhold I.J.P., Mendonca B.B. J. Clin. Endocrinol. Metab. 84:2870-2872(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-281; TRP-356 AND SER-424. |
| [38] | "Molecular analysis of Japanese patients with steroid 21-hydroxylase deficiency." Asanuma A., Ohura T., Ogawa E., Sato S., Igarashi Y., Matsubara Y., Iinuma K. J. Hum. Genet. 44:312-317(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; ASN-172; LEU-281; TRP-356 AND SER-493, VARIANT THR-268. |
| [39] | "Mutation screening in British 21-hydroxylase deficiency families and development of novel microsatellite based approaches to prenatal diagnosis." Lako M., Ramsden S., Campbell R.D., Strachan T. J. Med. Genet. 36:119-124(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 ASN-172 AND TRP-356. |
| [40] | "Characterization of single-nucleotide polymorphisms in coding regions of human genes." Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 22:231-238(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-281 AND SER-453, VARIANTS THR-268 AND SER-493. |
| [41] | Erratum Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 23:373-373(1999) |
| [42] | "Predicting phenotype in steroid 21-hydroxylase deficiency? Comprehensive genotyping in 155 unrelated, well defined patients from southern Germany." Krone N., Braun A., Roscher A.A., Knorr D., Schwarz H.P. J. Clin. Endocrinol. Metab. 85:1059-1065(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; ASN-172; LEU-281; GLY-281; PHE-300; CYS-354; TRP-356 AND SER-453. |
| [43] | "Molecular analysis of CYP-21 mutations for congenital adrenal hyperplasia in Singapore." Loke K.Y., Lee Y.S., Lee W.W.R., Poh L.K.S. Horm. Res. 55:179-184(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; ASN-172; PRO-261; TRP-356 AND PRO-483. |
| [44] | "Phenotype-genotype correlation in 56 women with nonclassical congenital adrenal hyperplasia due to 21-hydroxylase deficiency." Deneux C., Tardy V., Dib A., Mornet E., Billaud L., Charron D., Morel Y., Kuttenn F. J. Clin. Endocrinol. Metab. 86:207-213(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; ASN-172; LEU-281; MET-317; TRP-356; CYS-435 AND SER-453. |
| [45] | "Mutational spectrum of the steroid 21-hydroxylase gene in Austria: identification of a novel missense mutation." Baumgartner-Parzer S.M., Schulze E., Waldhaeusl W., Pauschenwein S., Rondot S., Nowotny P., Meyer K., Frisch H., Waldhauser F., Vierhapper H. J. Clin. Endocrinol. Metab. 86:4771-4775(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; ASN-172; LEU-281; SER-291; TRP-356; SER-424; HIS-426; SER-453 AND PRO-483, CHARACTERIZATION OF VARIANT AH3 HIS-426. |
| [46] | "Novel mutations in the human CYP21 gene." Levo A., Partanen J. Prenat. Diagn. 21:885-889(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT AH3 TRP-363. |
| [47] | "Non-classical 21-hydroxylase deficiency in children: association of adrenocorticotropic hormone-stimulated 17-hydroxyprogesterone with the risk of compound heterozygosity with severe mutations." Ezquieta B., Cueva E., Varela J., Oliver A., Fernandez J., Jariego C. Acta Paediatr. 91:892-898(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; ASN-172; LEU-281; LEU-283; TRP-356 AND SER-453. |
| [48] | "Novel mutations in CYP21 detected in individuals with hyperandrogenism." Lajic S., Clauin S., Robins T., Vexiau P., Blanche H., Bellanne-Chantelot C., Wedell A. J. Clin. Endocrinol. Metab. 87:2824-2829(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HYPERANDROGENISM MET-304; SER-375 AND SER-453, CHARACTERIZATION OF VARIANTS HYPERANDROGENISM MET-304; SER-375 AND SER-453. |
| [49] | "Three novel mutations in CYP21 gene in Brazilian patients with the classical form of 21-hydroxylase deficiency due to a founder effect." Billerbeck A.E.C., Mendonca B.B., Pinto E.M., Madureira G., Arnhold I.J.P., Bachega T.A.S.S. J. Clin. Endocrinol. Metab. 87:4314-4317(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 CYS-408 AND SER-424. |
| [50] | "Mutational spectrum of congenital adrenal hyperplasia in Slovenian patients: a novel Ala15Thr mutation and Pro30Leu within a larger gene conversion associated with a severe form of the disease." Dolzan V., Stopar-Obreza M., Zerjav-Tansek M., Breskvar K., Krzisnik C., Battelino T. Eur. J. Endocrinol. 149:137-144(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 THR-15; LEU-30; ASN-172; LEU-281 AND SER-453. |
| [51] | "Follow-up of 68 children with congenital adrenal hyperplasia due to 21-hydroxylase deficiency: relevance of genotype for management." Pinto G., Tardy V., Trivin C., Thalassinos C., Lortat-Jacob S., Nihoul-Fekete C., Morel Y., Brauner R. J. Clin. Endocrinol. Metab. 88:2624-2633(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; LEU-62; ASN-172; LEU-281; PRO-341; TRP-356; SER-453 AND PRO-483. |
| [52] | "CYP21 gene mutation analysis in 198 patients with 21-hydroxylase deficiency in The Netherlands: six novel mutations and a specific cluster of four mutations." Stikkelbroeck N.M., Hoefsloot L.H., de Wijs I.J., Otten B.J., Hermus A.R., Sistermans E.A. J. Clin. Endocrinol. Metab. 88:3852-3859(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 ASN-172; LEU-281; ARG-291; TYR-301; PRO-341; TRP-356 AND GLN-483. |
| [53] | "Molecular genetic analysis of Tunisian patients with a classic form of 21-hydroxylase deficiency: identification of four novel mutations and high prevalence of Q318X mutation." Kharrat M., Tardy V., M'Rad R., Maazoul F., Jemaa L.B., Refai M., Morel Y., Chaabouni H. J. Clin. Endocrinol. Metab. 89:368-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 ASN-172; TRP-356 AND TRP-483. |
| [54] | "Three novel mutations in Japanese patients with 21-hydroxylase deficiency." Usui T., Nishisho K., Kaji M., Ikuno N., Yorifuji T., Yasuda T., Kuzuya H., Shimatsu A. Horm. Res. 61:126-132(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT AH3 HIS-124. |
| [55] | "Functional analysis of two recurrent amino acid substitutions in the CYP21 gene from Italian patients with congenital adrenal hyperplasia." Barbaro M., Lajic S., Baldazzi L., Balsamo A., Pirazzoli P., Cicognani A., Wedell A., Cacciari E. J. Clin. Endocrinol. Metab. 89:2402-2407(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 THR-15; LEU-30; LEU-281 AND SER-482, CHARACTERIZATION OF VARIANTS AH3 THR-15 AND SER-482. |
| [56] | "Detection and assignment of CYP21 mutations using peptide mass signature genotyping." Zeng X., Witchel S.F., Dobrowolski S.F., Moulder P.V., Jarvik J.W., Telmer C.A. Mol. Genet. Metab. 82:38-47(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; ASN-172; ASN-236; GLU-237; LYS-239; LEU-281; SER-291; GLN-356; TRP-356; TYR-365; SER-453; LEU-479 AND PRO-483, VARIANT ARG-102. |
| [57] | "21-Hydroxylase and 11beta-hydroxylase mutations in Romanian patients with classic congenital adrenal hyperplasia." Grigorescu Sido A., Weber M.M., Grigorescu Sido P., Clausmeyer S., Heinrich U., Schulze E. J. Clin. Endocrinol. Metab. 90:5769-5773(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; ASN-172 AND TRP-356. |
| [58] | "p.H62L, a rare mutation of the CYP21 gene identified in two forms of 21-hydroxylase deficiency." Menassa R., Tardy V., Despert F., Bouvattier-Morel C., Brossier J.P., Cartigny M., Morel Y. J. Clin. Endocrinol. Metab. 93:1901-1908(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 LEU-30; LEU-62; ASN-172; TRP-356 AND SER-453, CHARACTERIZATION OF VARIANTS AH3 LEU-62 AND SER-453. |
| [59] | "Inhibition of CYP21A2 enzyme activity caused by novel missense mutations identified in Brazilian and Scandinavian patients." Soardi F.C., Barbaro M., Lau I.F., Lemos-Marini S.H., Baptista M.T., Guerra-Junior G., Wedell A., Lajic S., de Mello M.P. J. Clin. Endocrinol. Metab. 93:2416-2420(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 ARG-56; LEU-62; ARG-107; PRO-142; ASN-172; TRP-356; CYS-408 AND SER-453, CHARACTERIZATION OF VARIANTS AH3 ARG-56; LEU-62; ARG-107; PRO-142; CYS-408 AND SER-453. |
| [60] | "Functional and structural consequences of a novel point mutation in the CYP21A2 gene causing congenital adrenal hyperplasia: potential relevance of helix C for P450 oxidoreductase-21-hydroxylase interaction." Riepe F.G., Hiort O., Grotzinger J., Sippell W.G., Krone N., Holterhus P.M. J. Clin. Endocrinol. Metab. 93:2891-2895(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 GLN-121 AND SER-453, CHARACTERIZATION OF VARIANT AH3 GLN-121. |
| [61] | "Phenotype-genotype correlations of 13 rare CYP21A2 mutations detected in 46 patients affected with 21-hydroxylase deficiency and in one carrier." Tardy V., Menassa R., Sulmont V., Lienhardt-Roussie A., Lecointre C., Brauner R., David M., Morel Y. J. Clin. Endocrinol. Metab. 95:1288-1300(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS AH3 THR-77; PRO-167; ASN-172; THR-230; LYS-233; LEU-281; SER-291; ASP-292; LYS-320; PRO-341; HIS-354; TRP-356; TRP-369; CYS-408; SER-424; HIS-426 AND SER-453, CHARACTERIZATION OF VARIANTS AH3 PRO-167; ASN-172; LEU-281; ASP-292; LYS-320; TRP-369 AND SER-424. |
| + | Additional computationally mapped references. |
Web resources
| Cytochrome P450 Allele Nomenclature Committee CYP21A2 alleles |
| GeneReviews |
| SHMPD The Singapore human mutation and polymorphism database |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M12792 Genomic DNA. Translation: AAB59440.1. M13936 Genomic DNA. Translation: AAA59695.1. M26856 Genomic DNA. Translation: AAA52064.1. X58906 Genomic DNA. Translation: CAA41709.1. GQ222286 Genomic DNA. Translation: ACT35412.1. GQ222296 Genomic DNA. Translation: ACT35422.1. GQ222301 Genomic DNA. Translation: ACT35427.1. AK054616 mRNA. Translation: BAB70774.1. AL645922 Genomic DNA. No translation available. AL662828 Genomic DNA. No translation available. AL662849 Genomic DNA. No translation available. AL844853 Genomic DNA. No translation available. AL929593 Genomic DNA. No translation available. BX679671 Genomic DNA. Translation: CAM26070.1. CR753845 Genomic DNA. No translation available. CH471081 Genomic DNA. Translation: EAX03570.1. CR936924 Genomic DNA. Translation: CAQ07659.1. BC125182 mRNA. Translation: AAI25183.1. K02771 Genomic DNA. Translation: AAA59706.1. M19711 Genomic DNA. Translation: AAA83248.1. M17252 mRNA. Translation: AAA59985.1. | ||||||||||||
| IPI | IPI00332799. IPI00894349. | ||||||||||||
| PIR | O4HUC2. A25446. | ||||||||||||
| RefSeq | NP_000491.4. NM_000500.7. NP_001122062.3. NM_001128590.3. | ||||||||||||
| UniGene | Hs.654479. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P08686. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | 9606.ENSP00000364304. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P08686. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 117275. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P08686. | ||||||||||||
| PRIDE | P08686. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000383321; ENSP00000372811; ENSG00000206338. ENST00000436607; ENSP00000403721; ENSG00000235134. ENST00000448314; ENSP00000398594; ENSG00000198457. | ||||||||||||
| GeneID | 1589. | ||||||||||||
| KEGG | hsa:1589. | ||||||||||||
| UCSC | uc021zxa.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 1589. | ||||||||||||
| GeneCards | GC06P032077. | ||||||||||||
| H-InvDB | HIX0057724. HIX0166983. | ||||||||||||
| HGNC | HGNC:2600. CYP21A2. | ||||||||||||
| HPA | HPA048979. | ||||||||||||
| MIM | 201910. phenotype. 613815. gene. | ||||||||||||
| neXtProt | NX_P08686. | ||||||||||||
| Orphanet | 90794. Congenital adrenal hyperplasia due to 21-hydroxylase deficiency, classic form. 95698. Nonclassic congenital adrenal hyperplasia due to 21-hydroxylase deficiency. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG2124. | ||||||||||||
| HOVERGEN | HBG106944. | ||||||||||||
| InParanoid | P08686. | ||||||||||||
| KO | K00513. | ||||||||||||
| OrthoDB | EOG4TB4B5. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BioCyc | MetaCyc:HS09769-MONOMER. | ||||||||||||
| Reactome | REACT_111217. Metabolism. REACT_15493. Steroid hormones. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P08686. | ||||||||||||
| CleanEx | HS_CYP21A2. | ||||||||||||
| Genevestigator | P08686. | ||||||||||||
| GermOnline | ENSG00000198457. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.630.10. 1 hit. | ||||||||||||
| InterPro | IPR001128. Cyt_P450. IPR017972. Cyt_P450_CS. IPR002401. Cyt_P450_E_grp-I. [Graphical view] | ||||||||||||
| Pfam | PF00067. p450. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00463. EP450I. PR00385. P450. | ||||||||||||
| SUPFAM | SSF48264. Cytochrome_P450. 1 hit. | ||||||||||||
| PROSITE | PS00086. CYTOCHROME_P450. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | P08686. | ||||||||||||
| ChEMBL | CHEMBL2759. | ||||||||||||
| GenomeRNAi | 1589. | ||||||||||||
| NextBio | 6532. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | CP21A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P08686 Secondary accession number(s): A2BHY6 Q96NU8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
