P08559 (ODPA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 168.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial EC=1.2.4.1 Alternative name(s): PDHE1-A type I | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 390 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2, and thereby links the glycolytic pathway to the tricarboxylic cycle. Ref.16 Ref.30 |
| Catalytic activity | Pyruvate + [dihydrolipoyllysine-residue acetyltransferase] lipoyllysine = [dihydrolipoyllysine-residue acetyltransferase] S-acetyldihydrolipoyllysine + CO2. Ref.16 Ref.29 Ref.30 |
| Cofactor | |
| Enzyme regulation | Pyruvate dehydrogenase activity is inhibited by phosphorylation of PDHA1; it is reactivated by dephosphorylation. Ref.16 Ref.29 Ref.30 |
| Subunit structure | Heterotetramer of two PDHA1 and two PDHB subunits. The heterotetramer interacts with DLAT, and is part of the multimeric pyruvate dehydrogenase complex that contains multiple copies of pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (DLAT, E2) and lipoamide dehydrogenase (DLD, E3). These subunits are bound to an inner core composed of about 48 DLAT and 12 PDHX molecules. Ref.18 Ref.30 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. |
| Post-translational modification | Phosphorylation at Ser-232, Ser-293 and Ser-300 by PDK family kinases inactivates the enzyme; for this phosphorylation at a single site is sufficient. Dephosphorylation at all three sites, i.e. at Ser-232, Ser-293 and Ser-300, is required for reactivation. |
| Involvement in disease | Pyruvate dehydrogenase E1-alpha deficiency (PDHAD) [MIM:312170]: An enzymatic defect causing primary lactic acidosis in children. It is associated with a broad clinical spectrum ranging from fatal lactic acidosis in the newborn to chronic neurologic dysfunction with structural abnormalities in the central nervous system without systemic acidosis. X-linked Leigh syndrome (X-LS) [MIM:308930]: Early-onset progressive neurodegenerative disorder with a characteristic neuropathology consisting of focal, bilateral lesions in one or more areas of the central nervous system, including the brainstem, thalamus, basal ganglia, cerebellum, and spinal cord. The lesions are areas of demyelination, gliosis, necrosis, spongiosis, or capillary proliferation. Clinical symptoms depend on which areas of the central nervous system are involved. The most common underlying cause is a defect in oxidative phosphorylation. LS may be a feature of a deficiency of any of the mitochondrial respiratory chain complexes. |
| Sequence caution | The sequence AAA60055.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence AAB59581.1 differs from that shown. Reason: Frameshift at positions 106 and 175. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P08559-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P08559-2) The sequence of this isoform differs from the canonical sequence as follows: 96-96: G → GQFLLPLT | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P08559-3) The sequence of this isoform differs from the canonical sequence as follows: 170-200: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: P08559-4) The sequence of this isoform differs from the canonical sequence as follows: 19-19: P → PRHGLATLPSLVSISRLKQSSHLGLPKCWDYSHSLKTRQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 29 | 29 | Mitochondrion | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 30 – 390 | 361 | Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial | PRO_0000020440 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 232 | 1 | Phosphoserine; by PDK1 Ref.17 Ref.24 Ref.26 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 289 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 293 | 1 | Phosphoserine; by PDK1, PDK2, PDK3 and PDK4 Ref.17 Ref.29 Ref.30 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 295 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 300 | 1 | Phosphoserine; by PDK1, PDK2, PDK3 and PDK4 Ref.17 Ref.30 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 301 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 321 | 1 | N6-acetyllysine Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 19 | 1 | P → PRHGLATLPSLVSISRLKQS SHLGLPKCWDYSHSLKTRQ in isoform 4. | VSP_043363 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 96 | 1 | G → GQFLLPLT in isoform 2. | VSP_042569 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 170 – 200 | 31 | Missing in isoform 3. | VSP_042570 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 10 | 1 | R → P in PDHAD; affects mitochondrial import of precursor protein. Ref.41 | VAR_010238 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 72 | 1 | R → C in PDHAD. Ref.40 Ref.43 | VAR_004949 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 113 | 1 | H → D in PDHAD. Ref.43 | VAR_004950 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 162 | 1 | G → R in PDHAD. Ref.43 | VAR_004951 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 167 | 1 | V → M in PDHAD. Ref.35 | VAR_004952 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 199 | 1 | A → T in PDHAD. Ref.35 | VAR_004953 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 205 | 1 | F → L in X-LS; PDHAD. Ref.38 Ref.40 | VAR_004954 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 210 | 1 | M → V in PDHAD. Ref.44 | VAR_004955 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 217 | 1 | P → L in PDHAD. Ref.42 | VAR_004956 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 231 | 1 | T → A in PDHAD. Ref.35 | VAR_004957 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 243 | 1 | Y → N in PDHAD. Ref.36 | VAR_021053 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 258 | 1 | D → A in X-LS; PDHAD. Ref.34 | VAR_004958 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 263 | 1 | R → G in PDHAD and X-LS. Ref.35 Ref.40 Ref.43 Ref.45 Corresponds to variant rs28936081 [ dbSNP | Ensembl ]. | VAR_004959 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 263 | 1 | R → Q in PDHAD. Ref.39 | VAR_004960 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 282 | 1 | M → L. Ref.10 Ref.14 Ref.36 Corresponds to variant rs2229137 [ dbSNP | Ensembl ]. | VAR_021054 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 288 | 1 | R → H in PDHAD. Ref.43 | VAR_021055 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 292 | 1 | H → L in PDHAD. Ref.35 | VAR_004961 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 302 | 1 | R → C in PDHAD; loss of activity; common mutation. Ref.33 Ref.43 Ref.46 | VAR_004962 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 302 | 1 | R → H in PDHAD. Ref.46 | VAR_004963 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 305 | 1 | E → EDSYRTRE in PDHAD. | VAR_020908 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 307 | 1 | I → IPPHSYRTREEI in PDHAD. | VAR_020909 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 311 | 1 | Missing in PDHAD. Ref.40 Ref.44 | VAR_004964 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 313 | 1 | Missing in PDHAD. Ref.31 | VAR_004965 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 315 | 1 | D → N in PDHAD. Ref.36 Corresponds to variant rs28935187 [ dbSNP | Ensembl ]. | VAR_021056 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 333 | 1 | E → D. Corresponds to variant rs2228067 [ dbSNP | Ensembl ]. | VAR_050436 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 378 | 1 | R → H in X-LS; PDHAD. Ref.31 Ref.36 Ref.40 | VAR_004966 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 232 | 1 | S → A: Abolishes inactivation by phosphorylation; when associated with A-293 and A-300. Ref.16 Ref.29 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 293 | 1 | S → A: Reduces enzyme activity. Abolishes inactivation by phosphorylation; when associated with A-232 and A-300. Ref.16 Ref.29 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 293 | 1 | S → E: Interferes with substrate binding. Ref.16 Ref.29 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 300 | 1 | S → A: Abolishes inactivation by phosphorylation; when associated with A-232 and A-293. Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 301 | 1 | Y → S in AAD23857. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 306 | 1 | E → D in AAD23857. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 349 | 1 | A → P in AAA60055. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 354 | 1 | T → A in AAA60055. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 32 – 37 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 42 – 45 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 52 – 57 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 58 – 83 | 26 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 85 – 87 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 98 – 106 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 112 – 115 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 121 – 126 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 131 – 138 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 145 – 148 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 151 – 153 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 167 – 169 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 170 – 184 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 190 – 195 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 198 – 200 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 202 – 213 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 218 – 224 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 226 – 228 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 233 – 236 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 242 – 244 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 245 – 248 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 251 – 255 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 259 – 274 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 275 – 277 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 280 – 285 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 300 – 302 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 304 – 314 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 316 – 326 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 332 – 355 | 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 361 – 363 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 367 – 371 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 375 – 378 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 385 – 388 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization and nucleotide sequence of the gene encoding the human pyruvate dehydrogenase alpha-subunit." Koike K., Urata Y., Matsuo S., Koike M. Gene 93:307-311(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Leukocyte. |
| [2] | "Characterization of cDNAs encoding human pyruvate dehydrogenase alpha subunit." Ho L., Wexler I.D., Liu T.C., Thekkumkara T.J., Patel M.S. Proc. Natl. Acad. Sci. U.S.A. 86:5330-5334(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | Huh T.L., Chi Y.T., Casazza J.P., Veech R.L., Song B.J. Submitted (APR-1990) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain and Liver. |
| [4] | "The human pyruvate dehydrogenase complex. Isolation of cDNA clones for the E1 alpha subunit, sequence analysis, and characterization of the mRNA." Dahl H.-H.M., Hunt S.M., Hutchison W.M., Brown G.K. J. Biol. Chem. 262:7398-7403(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [5] | "Structural organization of the gene for the E1 alpha subunit of the human pyruvate dehydrogenase complex." Maragos C., Hutchinson W.M., Hayasaki K., Brown G.K., Dahl H.-H.M. J. Biol. Chem. 264:12294-12298(1989) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [6] | "Isolation of a full-length complementary DNA coding for human E1 alpha subunit of the pyruvate dehydrogenase complex." de Meirleir L., MacKay N., Wah A.M.L.H., Robinson B.H. J. Biol. Chem. 263:1991-1995(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [7] | "Cloning and sequencing of cDNAs encoding alpha and beta subunits of human pyruvate dehydrogenase." Koike K., Ohta S., Urata Y., Kagawa Y., Koike M. Proc. Natl. Acad. Sci. U.S.A. 85:41-45(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [8] | Okajima K. Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [9] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4). Tissue: Thalamus. |
| [10] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-282. Tissue: Dermoid cancer. |
| [11] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [12] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [13] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle. |
| [14] | "X chromosome evidence for ancient human histories." Harris E.E., Hey J. Proc. Natl. Acad. Sci. U.S.A. 96:3320-3324(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 202-336, VARIANT LEU-282. |
| [15] | "Mutation of E1 alpha gene in a female patient with pyruvate dehydrogenase deficiency due to rapid degradation of E1 protein." Ito M., Huq A.H., Naito E., Saijo T., Takeda E., Kuroda Y. J. Inherit. Metab. Dis. 15:848-856(1992) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN PDHAD. |
| [16] | "Mutagenesis studies of the phosphorylation sites of recombinant human pyruvate dehydrogenase. Site-specific regulation." Korotchkina L.G., Patel M.S. J. Biol. Chem. 270:14297-14304(1995) [PubMed] [Europe PMC] [Abstract] Cited for: CATALYTIC ACTIVITY, FUNCTION, ENZYME REGULATION, MUTAGENESIS OF SER-232; SER-293 AND SER-300. |
| [17] | "Site specificity of four pyruvate dehydrogenase kinase isoenzymes toward the three phosphorylation sites of human pyruvate dehydrogenase." Korotchkina L.G., Patel M.S. J. Biol. Chem. 276:37223-37229(2001) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-232; SER-293 AND SER-300. |
| [18] | "Organization of the cores of the mammalian pyruvate dehydrogenase complex formed by E2 and E2 plus the E3-binding protein and their capacities to bind the E1 and E3 components." Hiromasa Y., Fujisawa T., Aso Y., Roche T.E. J. Biol. Chem. 279:6921-6933(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT. |
| [19] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [20] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Platelet. |
| [21] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [22] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [23] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-321, MASS SPECTROMETRY. |
| [24] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-232, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [25] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [26] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-232, MASS SPECTROMETRY. |
| [27] | "Structural basis for flip-flop action of thiamin pyrophosphate-dependent enzymes revealed by human pyruvate dehydrogenase." Ciszak E.M., Korotchkina L.G., Dominiak P.M., Sidhu S., Patel M.S. J. Biol. Chem. 278:21240-21246(2003) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) IN COMPLEX WITH THIAMINE PYROPHOSPHATE, COFACTOR. |
| [28] | "Mutations and polymorphisms in the pyruvate dehydrogenase E1 alpha gene." Dahl H.-H.M., Brown G.K., Brown R.M., Hansen L.L., Kerr D.S., Wexler I.D., Patel M.S., de Meirleir L., Lissens W., Chun K., McKay N., Robinson B.H. Hum. Mutat. 1:97-102(1992) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON VARIANTS. |
| [29] | "Phosphorylation of serine 264 impedes active site accessibility in the E1 component of the human pyruvate dehydrogenase multienzyme complex." Seifert F., Ciszak E., Korotchkina L., Golbik R., Spinka M., Dominiak P., Sidhu S., Brauer J., Patel M.S., Tittmann K. Biochemistry 46:6277-6287(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 30-390, ENZYME REGULATION, CATALYTIC ACTIVITY, MUTAGENESIS OF SER-293, PHOSPHORYLATION AT SER-293. |
| [30] | "Structural basis for inactivation of the human pyruvate dehydrogenase complex by phosphorylation: role of disordered phosphorylation loops." Kato M., Wynn R.M., Chuang J.L., Tso S.C., Machius M., Li J., Chuang D.T. Structure 16:1849-1859(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.98 ANGSTROMS) OF 30-390 IN COMPLEX WITH PDHB, SUBUNIT, FUNCTION, CATALYTIC ACTIVITY, COFACTOR, ENZYME REGULATION, PHOSPHORYLATION AT SER-293 AND SER-300 BY PDK4. |
| [31] | "Characterization of the mutations in three patients with pyruvate dehydrogenase E1 alpha deficiency." Hansen L.L., Brown G.K., Kirby D.M., Dahl H.-H.M. J. Inherit. Metab. Dis. 14:140-151(1991) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PDHAD LYS-313 DEL, VARIANT X-LS HIS-378. |
| [32] | "Pyruvate dehydrogenase (PDH) deficiency caused by a 21-base pair insertion mutation in the E1 alpha subunit." De Meirleir L., Lissens W., Vamos E., Liebaers I. Hum. Genet. 88:649-652(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PDHAD ASP-SER-TYR-ARG-THR-ARG-GLU-305 INS. |
| [33] | "X-linked pyruvate dehydrogenase E1 alpha subunit deficiency in heterozygous females: variable manifestation of the same mutation." Dahl H.-H.M., Hansen L.L., Brown R.M., Danks D.M., Rogers J.G., Brown G.K. J. Inherit. Metab. Dis. 15:835-847(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PDHAD CYS-302. |
| [34] | "Molecular genetic characterization of an X-linked form of Leigh's syndrome." Matthews P.M., Marchington D.R., Squier M., Land J., Brown R.M., Brown G.K. Ann. Neurol. 33:652-655(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT X-LS ALA-258. |
| [35] | "Mutations in the X-linked E1 alpha subunit of pyruvate dehydrogenase leading to deficiency of the pyruvate dehydrogenase complex." Chun K., McKay N., Petrova-Benedict R., Robinson B.H. Hum. Mol. Genet. 2:449-454(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PDHAD MET-167; THR-199; ALA-231; GLY-263 AND LEU-292. |
| [36] | "Pyruvate dehydrogenase deficiency. Clinical presentation and molecular genetic characterization of five new patients." Matthews P.M., Brown R.M., Otero L.J., Marchington D.R., LeGris M., Howes R., Meadows L.S., Shevell M., Scriver C.R., Brown G.K. Brain 117:435-443(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PDHAD ASN-243; ASN-315 AND HIS-378, VARIANT LEU-282. |
| [37] | "Pyruvate dehydrogenase deficiency caused by a 33 base pair duplication in the PDH E1 alpha subunit." Hansen L.L., Horn N., Dahl H.-H.M., Kruse T.A. Hum. Mol. Genet. 3:1021-1022(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PDHAD PRO-PRO-HIS-SER-TYR-ARG-THR-ARG-GLU-GLU-ILE-307 INS. |
| [38] | "Pyruvate dehydrogenase deficiency in a male caused by a point mutation (F205L) in the E1 alpha subunit." Dahl H.-H.M., Brown G.K. Hum. Mutat. 3:152-155(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT X-LS LEU-205. |
| [39] | "Characterization of a point mutation in the pyruvate dehydrogenase E1 alpha gene from two boys with primary lactic acidaemia." Awata H., Endo F., Tanoue A., Kitano A., Matsuda I. J. Inherit. Metab. Dis. 17:189-195(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PDHAD GLN-263. |
| [40] | "Mutations in the X-linked E1 alpha subunit of pyruvate dehydrogenase: exon skipping, insertion of duplicate sequence, and missense mutations leading to the deficiency of the pyruvate dehydrogenase complex." Chun K., MacKay N., Petrova-Benedict R., Federico A., Fois A., Cole D.E.C., Robertson E., Robinson B.H. Am. J. Hum. Genet. 56:558-569(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PDHAD CYS-72; GLY-263 AND ARG-311 DEL, VARIANTS X-LS LEU-205 AND HIS-378. |
| [41] | "An amino acid substitution in the pyruvate dehydrogenase E1 alpha gene, affecting mitochondrial import of the precursor protein." Takakubo F., Cartwright P., Hoogenraad N., Thorburn D.R., Collins F., Lithgow T., Dahl H.-H.M. Am. J. Hum. Genet. 57:772-780(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PDHAD PRO-10. |
| [42] | "Pyruvate dehydrogenase complex deficiency due to a point mutation (P188L) within the thiamine pyrophosphate binding loop of the E1 alpha subunit." Hemalatha S.G., Kerr D.S., Wexler I.D., Lusk M.M., Kaung M., Du Y., Kolli M., Schelper R.L., Patel M.S. Hum. Mol. Genet. 4:315-318(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PDHAD LEU-217. |
| [43] | "Mutation analysis of the pyruvate dehydrogenase E1 alpha gene in eight patients with a pyruvate dehydrogenase complex deficiency." Lissens W., de Meirleir L., Seneca S., Benelli C., Marsac C., Poll-The B.T., Briones P., Ruitenbeek W., van Diggelen O., Chaigne D., Ramaekers V., Liebaers I. Hum. Mutat. 7:46-51(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PDHAD CYS-72; ASP-113; ARG-162; GLY-263; HIS-288 AND CYS-302. |
| [44] | "Three new mutations of the pyruvate dehydrogenase alpha subunit: a point mutation (M181V), 3 bp deletion (-R282), and 16 bp insertion/frameshift (K358SVS-->TVDQS)." Tripatara A., Kerr D.S., Lusk M.M., Kolli M., Tan J., Patel M.S. Hum. Mutat. 8:180-182(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PDHAD VAL-210 AND ARG-311 DEL. |
| [45] | "Biochemical and molecular analysis of an X-linked case of Leigh syndrome associated with thiamin-responsive pyruvate dehydrogenase deficiency." Naito E., Ito M., Yokota I., Saijo T., Matsuda J., Osaka H., Kimura S., Kuroda Y. J. Inherit. Metab. Dis. 20:539-548(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT X-LS GLY-263. |
| [46] | "Arginine 302 mutations in the pyruvate dehydrogenase E1alpha subunit gene: identification of further patients and in vitro demonstration of pathogenicity." Otero L.J., Brown R.M., Brown G.K. Hum. Mutat. 12:114-121(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PDHAD CYS-302 AND HIS-302. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | D90084 Genomic DNA. Translation: BAA14121.1. M24848 mRNA. Translation: AAA36533.1. X52709 mRNA. Translation: CAA36933.1. X52710 mRNA. Translation: CAA36934.1. M27257 M29164 Genomic DNA. Translation: AAA60051.1.L13318 mRNA. Translation: AAA60227.1. J03503 mRNA. Translation: AAA60055.1. Different initiation. J03575 mRNA. Translation: AAA60050.1. L48690 mRNA. Translation: AAB59581.1. Frameshift. EF590117 mRNA. Translation: ABQ59099.1. AK293250 mRNA. Translation: BAH11476.1. AK296457 mRNA. Translation: BAH12361.1. AK296341 mRNA. Translation: BAH12323.1. AK222740 mRNA. Translation: BAD96460.1. AL732326 Genomic DNA. Translation: CAI41291.1. CH471074 Genomic DNA. Translation: EAW98960.1. BC002406 mRNA. Translation: AAH02406.1. AF125053 Genomic DNA. Translation: AAD23841.1. AF125054 Genomic DNA. Translation: AAD23842.1. AF125055 Genomic DNA. Translation: AAD23843.1. AF125056 Genomic DNA. Translation: AAD23844.1. AF125057 Genomic DNA. Translation: AAD23845.1. AF125058 Genomic DNA. Translation: AAD23846.1. AF125059 Genomic DNA. Translation: AAD23847.1. AF125060 Genomic DNA. Translation: AAD23848.1. AF125061 Genomic DNA. Translation: AAD23849.1. AF125062 Genomic DNA. Translation: AAD23850.1. AF125063 Genomic DNA. Translation: AAD23851.1. AF125064 Genomic DNA. Translation: AAD23852.1. AF125065 Genomic DNA. Translation: AAD23853.1. AF125066 Genomic DNA. Translation: AAD23854.1. AF125067 Genomic DNA. Translation: AAD23855.1. AF125068 Genomic DNA. Translation: AAD23856.1. AF125069 Genomic DNA. Translation: AAD23857.1. AF125070 Genomic DNA. Translation: AAD23858.1. AF125071 Genomic DNA. Translation: AAD23859.1. AF125072 Genomic DNA. Translation: AAD23860.1. AF125073 Genomic DNA. Translation: AAD23861.1. AF125074 Genomic DNA. Translation: AAD23862.1. AF125075 Genomic DNA. Translation: AAD23863.1. AF125076 Genomic DNA. Translation: AAD23864.1. AF125078 Genomic DNA. Translation: AAD23866.1. AF125079 Genomic DNA. Translation: AAD23867.1. AF125080 Genomic DNA. Translation: AAD23868.1. AF125081 Genomic DNA. Translation: AAD23869.1. AF125082 Genomic DNA. Translation: AAD23870.1. AF125083 Genomic DNA. Translation: AAD23871.1. AF125084 Genomic DNA. Translation: AAD23872.1. AF125085 Genomic DNA. Translation: AAD23873.1. AF125086 Genomic DNA. Translation: AAD23874.1. AF125087 Genomic DNA. Translation: AAD23875.1. AF125088 Genomic DNA. Translation: AAD23876.1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00306301. IPI00643575. IPI00922697. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | DEHUPA. JQ0770. | ||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000275.1. NM_000284.3. NP_001166925.1. NM_001173454.1. NP_001166926.1. NM_001173455.1. NP_001166927.1. NM_001173456.1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.530331. | ||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-37652N. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P08559. 6 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000394382. | ||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 129063. | ||||||||||||||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| REPRODUCTION-2DPAGE | IPI00306301. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UCD-2DPAGE | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PeptideAtlas | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 5160. | ||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000379806; ENSP00000369134; ENSG00000131828. ENST00000422285; ENSP00000394382; ENSG00000131828. ENST00000540249; ENSP00000440761; ENSG00000131828. ENST00000545074; ENSP00000438550; ENSG00000131828. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5160. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5160. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc004czg.4. human. | ||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 5160. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC0XP019271. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:8806. PDHA1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 300502. gene. 308930. phenotype. 312170. phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 70474. Leigh syndrome with cardiomyopathy. 79243. Pyruvate dehydrogenase E1-alpha deficiency. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA33150. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG1071. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000281336. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG001863. | ||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K00161. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | FAQNDPE. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4W0XD6. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| BioCyc | MetaCyc:HS05573-MONOMER. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SABIO-RK | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PDHA1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000131828. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001017. DH_E1. IPR017597. Pyrv_DH_E1_asu_subgrp-y. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00676. E1_dh. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR03182. PDH_E1_alph_y. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL2092. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | PDHA1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00157. NADH. | ||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P08559. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 5160. | ||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 19962. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | ODPA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P08559 Secondary accession number(s): A5YVE9 Q9UNG5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |

Clusters with
