P08510 (KCNAS_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 155.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Potassium voltage-gated channel protein Shaker Alternative name(s): Protein minisleep | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 655 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Voltage-dependent potassium channel involved in regulation of sleep need or efficiency. Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Ref.12 |
| Subunit structure | The voltage-dependent potassium channel is a heterotetramer of potassium channel proteins By similarity. |
| Subcellular location | |
| Domain | The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position. |
| Disruption phenotype | Reduced sleep. Flies sleep for one-third of the wild-type amount. They perform normally in a number of tasks, have preserved sleep homeostasis, but are not impaired by sleep deprivation. They also have a reduced lifespan. Ref.12 |
| Sequence similarities | Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Shaker sub-subfamily. [View classification] |
| RNA editing | Edited at positions 178, 360, 464, 489 and 491. |
| Sequence caution | The sequence AAA70217.1 differs from that shown. Reason: Frameshift at several positions. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform E (identifier: P08510-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Alpha (identifier: P08510-2) Also known as: B; G; Adult; The sequence of this isoform differs from the canonical sequence as follows: 453-463: VWGKIVGSLCA → FWGKIVGSLCV 506-655: PYLPGTLGQH...ALAVSIETDV → SYLPGALGQH...AMAVSIETDV | ||||||
| Isoform Beta (identifier: P08510-3) Also known as: C; Late population; The sequence of this isoform differs from the canonical sequence as follows: 1-61: MAAVAGLYGL...LQRNSLDGYG → MTMWQSGGMG...SGSNERNLNQ | ||||||
| Isoform Gamma (identifier: P08510-4) The sequence of this isoform differs from the canonical sequence as follows: 1-61: MAAVAGLYGLGEDRQHRKKQQQQQQHQKEQLEQKEEQKKIAERKLQLREQQLQRNSLDGYG → MQMILVAGG 506-655: PYLPGTLGQH...ALAVSIETDV → SYLPGALGQH...AMAVSIETDV | ||||||
| Isoform Delta (identifier: P08510-5) Also known as: Larval; A; The sequence of this isoform differs from the canonical sequence as follows: 1-61: MAAVAGLYGL...LQRNSLDGYG → MAHITTTHGSLSQATR 349-349: D → V 350-655: Missing. | ||||||
| Isoform Epsilon (identifier: P08510-6) Also known as: Larval; F; The sequence of this isoform differs from the canonical sequence as follows: 349-349: D → V 350-655: Missing. | ||||||
| Isoform D (identifier: P08510-7) The sequence of this isoform differs from the canonical sequence as follows: 1-61: MAAVAGLYGL...LQRNSLDGYG → MAHITTTHGSLSQATR 453-463: VWGKIVGSLCA → FWGKIVGSLCV 506-655: PYLPGTLGQH...ALAVSIETDV → SYLPGALGQH...AMAVSIETDV | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 655 | 655 | Potassium voltage-gated channel protein Shaker | PRO_0000053963 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 227 | 227 | Cytoplasmic Potential | ||||||||
| Transmembrane | 228 – 246 | 19 | Helical; Name=Segment S1 | ||||||||
| Topological domain | 247 – 278 | 32 | Extracellular Potential | ||||||||
| Transmembrane | 279 – 300 | 22 | Helical; Name=Segment S2 | ||||||||
| Topological domain | 301 – 311 | 11 | Cytoplasmic Potential | ||||||||
| Transmembrane | 312 – 332 | 21 | Helical; Name=Segment S3 | ||||||||
| Topological domain | 333 – 360 | 28 | Extracellular Potential | ||||||||
| Transmembrane | 361 – 380 | 20 | Helical; Voltage-sensor; Name=Segment S4 | ||||||||
| Topological domain | 381 – 395 | 15 | Cytoplasmic Potential | ||||||||
| Transmembrane | 396 – 415 | 20 | Helical; Name=Segment S5 | ||||||||
| Transmembrane | 457 – 478 | 22 | Helical; Name=Segment S6 | ||||||||
| Topological domain | 479 – 616 | 138 | Cytoplasmic Potential | ||||||||
| Motif | 442 – 447 | 6 | Selectivity filter | ||||||||
| Compositional bias | 15 – 53 | 39 | Gln-rich | ||||||||
| Compositional bias | 558 – 619 | 62 | Gln-rich | ||||||||
| Compositional bias | 625 – 630 | 6 | Poly-Ala | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 259 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 263 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 61 | 61 | MAAVA…LDGYG → MTMWQSGGMGGHGSQNNPWM KLMGIVHKERRHTENVQSQS GSNERNLNQ in isoform Beta. | VSP_000954 | |||||||
| Alternative sequence | 1 – 61 | 61 | MAAVA…LDGYG → MAHITTTHGSLSQATR in isoform Delta and isoform D. | VSP_000956 | |||||||
| Alternative sequence | 1 – 61 | 61 | MAAVA…LDGYG → MQMILVAGG in isoform Gamma. | VSP_000955 | |||||||
| Alternative sequence | 349 | 1 | D → V in isoform Delta and isoform Epsilon. | VSP_000957 | |||||||
| Alternative sequence | 350 – 655 | 306 | Missing in isoform Delta and isoform Epsilon. | VSP_000958 | |||||||
| Alternative sequence | 453 – 463 | 11 | VWGKIVGSLCA → FWGKIVGSLCV in isoform Alpha and isoform D. | VSP_017889 | |||||||
| Alternative sequence | 506 – 655 | 150 | PYLPG…IETDV → SYLPGALGQHLKKSSLSESS SDIMDLDDGIDATTPGLTDH TGRHMVPFLRTQQSFEKQQL QLQLQLQQQSQSPHGQQMTQ QQQLGQNGLRSTNSLQLRHN NAMAVSIETDV in isoform Alpha, isoform Gamma and isoform D. | VSP_000959 | |||||||
| Natural variant | 178 | 1 | K → E in RNA edited version. | ||||||||
| Natural variant | 178 | 1 | K → G in RNA edited version. | ||||||||
| Natural variant | 178 | 1 | K → R in RNA edited version. | ||||||||
| Natural variant | 360 | 1 | I → M in RNA edited version. | ||||||||
| Natural variant | 464 | 1 | I → V in RNA edited version. | ||||||||
| Natural variant | 489 | 1 | T → A in RNA edited version. | ||||||||
| Natural variant | 491 | 1 | Q → R in RNA edited version. | ||||||||
Experimental info | |||||||||||
| Mutagenesis | 248 | 1 | T → I in mns; flies display reduced sleep. Ref.12 | ||||||||
| Sequence conflict | 563 | 1 | Q → QQ in CAA29917. Ref.4 | ||||||||
| Sequence conflict | 583 – 584 | 2 | QL → HV in CAA29917. Ref.4 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 380 – 394 | 15 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence of a probable potassium channel component encoded at Shaker locus of Drosophila." Tempel B.L., Papazian D.M., Schwarz T.L., Jan Y.N., Jan L.Y. Science 237:770-775(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), RNA EDITING OF POSITIONS 464; 489 AND 491. |
| [2] | "Molecular organization of the maternal effect region of the Shaker complex of Drosophila: characterization of an I(A) channel transcript with homology to vertebrate Na(+) channel." Baumann A., Krah-Jentgens I., Mueller R., Mueller-Holtkamp F., Seidel R., Kecskemethy N., Casal J., Ferrus A., Pongs O. EMBO J. 6:3419-3429(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM DELTA). Strain: Canton-S and Oregon-R. |
| [3] | "Shaker encodes a family of putative potassium channel proteins in the nervous system of Drosophila." Pongs O., Kecskemethy N., Mueller R., Krah-Jentgens I., Baumann A., Kiltz H.H., Canal I., Llamazares S., Ferrus A. EMBO J. 7:1087-1096(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA; DELTA; GAMMA AND EPSILON), RNA EDITING OF POSITIONS 464; 489 AND 491. Strain: Canton-S. Tissue: Larva. |
| [4] | "Multiple potassium-channel components are produced by alternative splicing at the Shaker locus in Drosophila." Schwarz T.L., Tempel B.L., Papazian D.M., Jan Y.N., Jan L.Y. Nature 331:137-142(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA; GAMMA AND E). |
| [5] | Erratum Schwarz T.L., Tempel B.L., Papazian D.M., Jan Y.N., Jan L.Y. Nature 332:740-740(1988) |
| [6] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [7] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [8] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM D), RNA EDITING OF POSITION 360. Strain: Berkeley. Tissue: Embryo. |
| [9] | "Molecular characterization of Shaker, a Drosophila gene that encodes a potassium channel." Kamb A., Iverson L.E., Tanouye M.A. Cell 50:405-413(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-257 (ISOFORM BETA). Tissue: Larva. |
| [10] | "Multiple products of the Drosophila Shaker gene may contribute to potassium channel diversity." Kamb A., Tseng-Crank J., Tanouye M.A. Neuron 1:421-430(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 450-534. Strain: H4. |
| [11] | "Nervous system targets of RNA editing identified by comparative genomics." Hoopengardner B., Bhalla T., Staber C., Reenan R. Science 301:832-836(2003) [PubMed] [Europe PMC] [Abstract] Cited for: RNA EDITING. |
| [12] | "Reduced sleep in Drosophila Shaker mutants." Cirelli C., Bushey D., Hill S., Huber R., Kreber R., Ganetzky B., Tononi G. Nature 434:1087-1092(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE, MUTAGENESIS OF THR-248. |
| [13] | "Identification of N-glycosylated proteins from the central nervous system of Drosophila melanogaster." Koles K., Lim J.-M., Aoki K., Porterfield M., Tiemeyer M., Wells L., Panin V. Glycobiology 17:1388-1403(2007) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-259 AND ASN-263, MASS SPECTROMETRY. Strain: Oregon-R. Tissue: Head. |
| [14] | "Three-dimensional structure of the S4-S5 segment of the Shaker potassium channel." Ohlenschlaeger O., Hojo H., Ramachandran R., Goerlach M., Haris P.I. Biophys. J. 82:2995-3002(2002) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 378-397. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M17211 mRNA. Translation: AAA28417.1. X06184 mRNA. Translation: CAA29549.1. X07131 mRNA. Translation: CAA30143.1. X07132 mRNA. Translation: CAA30144.1. X07133 mRNA. Translation: CAA30145.1. X07134 mRNA. Translation: CAA30146.1. X06742 mRNA. Translation: CAA29917.1. AE014298 Genomic DNA. Translation: AAF48785.3. AE014298 Genomic DNA. Translation: AAF48786.3. AE014298 Genomic DNA. Translation: AAF48790.2. AE014298 Genomic DNA. Translation: AAN09451.1. AE014298 Genomic DNA. Translation: AAN09452.1. AE014298 Genomic DNA. Translation: AAS65395.1. AE014298 Genomic DNA. Translation: AAS65396.1. AY118398 mRNA. Translation: AAM48427.1. M17155 mRNA. Translation: AAA70217.1. Frameshift. X78908 Genomic DNA. Translation: CAA55519.1. | ||||||||||||||||||
| PIR | A27159. JH0193. S00480. S02284. | ||||||||||||||||||
| RefSeq | NP_001162788.1. NM_001169317.1. NP_001188668.1. NM_001201739.1. NP_523393.3. NM_078669.5. NP_728120.1. NM_167592.4. NP_728122.1. NM_167594.3. NP_728123.1. NM_167595.4. NP_728124.1. NM_167596.4. NP_996497.1. NM_206774.2. NP_996498.2. NM_206775.4. | ||||||||||||||||||
| UniGene | Dm.7088. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| DisProt | DP00267. | ||||||||||||||||||
| ProteinModelPortal | P08510. | ||||||||||||||||||
| SMR | P08510. Positions 96-489. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | P08510. 5 interactions. | ||||||||||||||||||
| MINT | MINT-317832. | ||||||||||||||||||
Protein family/group databases | |||||||||||||||||||
| TCDB | 1.A.1.2.6. voltage-gated ion channel (VIC) superfamily. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | P08510. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| EnsemblMetazoa | FBtr0089657; FBpp0088599; FBgn0003380. | ||||||||||||||||||
| GeneID | 32780. | ||||||||||||||||||
| KEGG | dme:Dmel_CG12348. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 32780. | ||||||||||||||||||
| FlyBase | FBgn0003380. Sh. | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG1226. | ||||||||||||||||||
| GeneTree | ENSGT00560000076957. | ||||||||||||||||||
| InParanoid | P08510. | ||||||||||||||||||
| KO | K05318. | ||||||||||||||||||
| OMA | SERIIIN. | ||||||||||||||||||
| OrthoDB | EOG4KD52H. | ||||||||||||||||||
| PhylomeDB | P08510. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| Bgee | P08510. | ||||||||||||||||||
| GermOnline | CG12348. Drosophila melanogaster. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 3.30.710.10. 1 hit. | ||||||||||||||||||
| InterPro | IPR000210. BTB/POZ-like. IPR011333. BTB/POZ_fold. IPR005821. Ion_trans_dom. IPR003091. K_chnl. IPR003968. K_chnl_volt-dep_Kv. IPR003972. K_chnl_volt-dep_Kv1. IPR003131. T1-type_BTB. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR11537. PTHR11537. 1 hit. | ||||||||||||||||||
| Pfam | PF00520. Ion_trans. 1 hit. PF02214. K_tetra. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00169. KCHANNEL. PR01491. KVCHANNEL. PR01496. SHAKERCHANEL. | ||||||||||||||||||
| SMART | SM00225. BTB. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF54695. BTB/POZ_fold. 1 hit. | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | Sh. drosophila. | ||||||||||||||||||
| EvolutionaryTrace | P08510. | ||||||||||||||||||
| GenomeRNAi | 32780. | ||||||||||||||||||
| NextBio | 780331. | ||||||||||||||||||
Entry information
| Entry name | KCNAS_DROME | ||||||||
| Accession | Primary (citable) accession number: P08510 Secondary accession number(s): A4V4Q2 Q9VX00 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
