P08237 (K6PF_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 153.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 6-phosphofructokinase, muscle type EC=2.7.1.11 Alternative name(s): Phosphofructo-1-kinase isozyme A Short name=PFK-A Short name=Phosphofructokinase-M Phosphofructokinase 1 Phosphohexokinase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 780 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the third step of glycolysis, the phosphorylation of fructose-6-phosphate (F6P) by ATP to generate fructose-1,6-bisphosphate (FBP) and ADP. |
| Catalytic activity | ATP + D-fructose 6-phosphate = ADP + D-fructose 1,6-bisphosphate. |
| Cofactor | Magnesium. |
| Enzyme regulation | Allosteric enzyme activated by ADP, AMP, or fructose bisphosphate and inhibited by ATP or citrate. |
| Pathway | |
| Subunit structure | Tetramer. Muscle is M4, liver is L4, and red cell is M3L, M2L2, or ML3. |
| Post-translational modification | GlcNAcylation decreases enzyme activity By similarity. |
| Involvement in disease | Glycogen storage disease 7 (GSD7) [MIM:232800]: A metabolic disorder characterized by exercise intolerance with associated nausea and vomiting, muscle cramping, exertional myopathy and compensated hemolysis. Short bursts of intense activity are particularly difficult. Severe muscle cramps and myoglobinuria develop after vigorous exercise. |
| Miscellaneous | In human PFK exists as a system of 3 types of subunits, PFKM (muscle), PFKL (liver) and PFKP (platelet) isoenzymes. |
| Sequence similarities | Belongs to the phosphofructokinase family. Two domains subfamily. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 2 | EBI-514788,EBI-514788 | ||
| PFKL | P17858 | 6 | EBI-514788,EBI-487243 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P08237-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P08237-2) The sequence of this isoform differs from the canonical sequence as follows: 282-312: Missing. | ||||||
| Isoform 3 (identifier: P08237-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MHKDEFHLKFFMCVIQSRQLVRTPQRTAGEASTSSMLIPKPPPKTDILKSLDTMDDPDTVGSIPVFKTEWIM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 780 | 779 | 6-phosphofructokinase, muscle type | PRO_0000112016 | |||||
Regions | |||||||||
| Nucleotide binding | 35 – 39 | 5 | ATP By similarity | ||||||
| Nucleotide binding | 193 – 197 | 5 | ATP By similarity | ||||||
| Nucleotide binding | 210 – 226 | 17 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 166 | 1 | Proton acceptor By similarity | ||||||
| Metal binding | 224 | 1 | Magnesium; via carbonyl oxygen By similarity | ||||||
| Binding site | 201 | 1 | Substrate By similarity | ||||||
| Binding site | 292 | 1 | Substrate By similarity | ||||||
| Binding site | 298 | 1 | Substrate By similarity | ||||||
| Binding site | 301 | 1 | Substrate By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylthreonine By similarity | ||||||
| Modified residue | 667 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 775 | 1 | Phosphoserine By similarity | ||||||
| Glycosylation | 530 | 1 | O-linked (GlcNAc...) By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MHKDEFHLKFFMCVIQSRQL VRTPQRTAGEASTSSMLIPK PPPKTDILKSLDTMDDPDTV GSIPVFKTEWIM in isoform 3. | VSP_046125 | |||||
| Alternative sequence | 282 – 312 | 31 | Missing in isoform 2. | VSP_004667 | |||||
| Natural variant | 39 | 1 | R → L in GSD7; Ashkenazi. | VAR_006063 | |||||
| Natural variant | 39 | 1 | R → P in GSD7; Italian. Ref.12 | VAR_006064 | |||||
| Natural variant | 100 | 1 | R → Q in GSD7; Swiss. Ref.13 Corresponds to variant rs2228500 [ dbSNP | Ensembl ]. | VAR_006065 | |||||
| Natural variant | 209 | 1 | G → D in GSD7; French Canadian. Ref.13 | VAR_006066 | |||||
| Natural variant | 543 | 1 | D → A in GSD7; Italian. Ref.12 | VAR_006067 | |||||
| Natural variant | 686 | 1 | W → C in GSD7; Japanese. Ref.14 | VAR_006068 | |||||
| Natural variant | 696 | 1 | R → H in GSD7; Swiss. Ref.13 Corresponds to variant rs41291971 [ dbSNP | Ensembl ]. | VAR_006069 | |||||
Experimental info | |||||||||
| Sequence conflict | 670 | 1 | P → S in BAC86498. Ref.4 | ||||||
| Isoform 3: | |||||||||
| Sequence conflict | 2 | 1 | H → L in BAC86498. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure of the entire human muscle phosphofructokinase-encoding gene: a two-promoter system." Yamasaki T., Nakajima H., Kono N., Hotta K., Yamada K., Imai E., Kuwajima M., Noguchi T., Tanaka T., Tarui S. Gene 104:277-282(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Muscle. |
| [2] | "Cloning and expression of a human muscle phosphofructokinase cDNA." Sharma P.M., Reddy G.R., Vora S., Babior B.M., McLachlan A. Gene 77:177-183(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Muscle. |
| [3] | "Cloning of human muscle phosphofructokinase cDNA." Nakajima H., Noguchi T., Yamasaki T., Kono N., Tanaka T., Tarui S. FEBS Lett. 223:113-116(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Muscle. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Thymus. |
| [5] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Muscle. |
| [7] | "Alternative splicing of the transcript encoding the human muscle isoenzyme of phosphofructokinase." Sharma P.M., Reddy G.R., Babior B.M., McLachlan A. J. Biol. Chem. 265:9006-9010(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 272-681 (ISOFORM 2). Tissue: Muscle. |
| [8] | "Human 6-phosphofructo-1-kinase gene has an additional intron upstream of start codon." Valdez B.C., Chen Z., Sosa M.G., Younathan E.S., Chang S.H. Gene 76:167-169(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-28. Tissue: Muscle. |
| [9] | "Mutations in muscle phosphofructokinase gene." Raben N., Sherman J.B. Hum. Mutat. 6:1-6(1995) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON GSD7 VARIANTS. |
| [10] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-667, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [12] | "Identification of three novel mutations in non-Ashkenazi Italian patients with muscle phosphofructokinase deficiency." Tsujino S., Servidei S., Tonin P., Shanske S., Azan G., DiMauro S. Am. J. Hum. Genet. 54:812-819(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS GSD7 PRO-39 AND ALA-543. |
| [13] | "Functional expression of human mutant phosphofructokinase in yeast: genetic defects in French Canadian and Swiss patients with phosphofructokinase deficiency." Raben N., Exelbert R., Spiegel R., Sherman J.B., Plotz P., Heinisch J.J. Am. J. Hum. Genet. 56:131-141(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS GSD7 GLN-100; ASP-209 AND HIS-696. |
| [14] | "Novel missense mutation (W686C) of the phosphofructokinase-M gene in a Japanese patient with a mild form of glycogenosis VII." Hamaguchi T., Nakajima H., Noguchi T., Nakagawa C., Kuwajima M., Kono N., Tarui S., Matsuzawa Y. Hum. Mutat. 8:273-275(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GSD7 CYS-686. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M59741 M59740 Genomic DNA. Translation: AAA82938.1.M26066 mRNA. Translation: AAA60068.1. Y00698 mRNA. Translation: CAA68692.1. AK126229 mRNA. Translation: BAC86498.1. AC004801 Genomic DNA. No translation available. AC074029 Genomic DNA. No translation available. BC000534 mRNA. Translation: AAH00534.1. BC012799 mRNA. Translation: AAH12799.1. BC013298 mRNA. Translation: AAH13298.1. BC021203 mRNA. Translation: AAH21203.1. J05533 mRNA. Translation: AAA79220.1. M24925 Genomic DNA. Translation: AAA36436.1. |
| IPI | IPI00219585. IPI00465179. IPI00743142. |
| PIR | KIHUFM. A91605. |
| RefSeq | NP_000280.1. NM_000289.5. NP_001160158.1. NM_001166686.1. NP_001160159.1. NM_001166687.1. NP_001160160.1. NM_001166688.1. |
| UniGene | Hs.75160. |
3D structure databases | |
| ProteinModelPortal | P08237. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P08237. 5 interactions. |
| STRING | 9606.ENSP00000352842. |
PTM databases | |
| PhosphoSite | P08237. |
Polymorphism databases | |
| DMDM | 125126. |
2D gel databases | |
| UCD-2DPAGE | P08237. |
Proteomic databases | |
| PaxDb | P08237. |
| PRIDE | P08237. |
Protocols and materials databases | |
| DNASU | 5213. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000312352; ENSP00000309438; ENSG00000152556. ENST00000340802; ENSP00000345771; ENSG00000152556. ENST00000359794; ENSP00000352842; ENSG00000152556. ENST00000395233; ENSP00000378656; ENSG00000152556. ENST00000547587; ENSP00000449426; ENSG00000152556. ENST00000551804; ENSP00000448177; ENSG00000152556. |
| GeneID | 5213. |
| KEGG | hsa:5213. |
| UCSC | uc001rra.2. human. uc001rrg.2. human. |
Organism-specific databases | |
| CTD | 5213. |
| GeneCards | GC12P048501. |
| HGNC | HGNC:8877. PFKM. |
| HPA | HPA002117. |
| MIM | 232800. phenotype. 610681. gene. |
| neXtProt | NX_P08237. |
| Orphanet | 371. Muscle phosphofructokinase deficiency. |
| PharmGKB | PA33216. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0205. |
| HOGENOM | HOG000200154. |
| HOVERGEN | HBG000976. |
| InParanoid | P08237. |
| KO | K00850. |
| OrthoDB | EOG4RJG0W. |
| PhylomeDB | P08237. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. |
| SABIO-RK | P08237. |
| UniPathway | UPA00109; UER00182. |
Gene expression databases | |
| ArrayExpress | P08237. |
| Bgee | P08237. |
| CleanEx | HS_PFKM. |
| Genevestigator | P08237. |
| GermOnline | ENSG00000152556. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR009161. 6-phosphofructokinase_euk. IPR022953. Phosphofructokinase. IPR015912. Phosphofructokinase_CS. IPR000023. Phosphofructokinase_dom. [Graphical view] |
| Pfam | PF00365. PFK. 2 hits. [Graphical view] |
| PIRSF | PIRSF000533. ATP_PFK_euk. 1 hit. |
| PRINTS | PR00476. PHFRCTKINASE. |
| SUPFAM | SSF53784. Ppfruckinase. 2 hits. |
| TIGRFAMs | TIGR02478. 6PF1K_euk. 1 hit. |
| PROSITE | PS00433. PHOSPHOFRUCTOKINASE. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P08237. |
| ChEMBL | CHEMBL3291. |
| ChiTaRS | PFKM. human. |
| GenomeRNAi | 5213. |
| NextBio | 20164. |
| PMAP-CutDB | P08237. |
| SOURCE | Search... |
Entry information
| Entry name | K6PF_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P08237 Secondary accession number(s): J3KNX3 Q6ZTT1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
