Reviewed,
UniProtKB/Swiss-Prot P08235 (MCR_HUMAN)
Last modified
February 9, 2010.
Version 124.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Mineralocorticoid receptor Short name=MR Alternative name(s): Nuclear receptor subfamily 3 group C member 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 984 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. Binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion and water transport and thus raise extracellular fluid volume and blood pressure and lower potassium levels. Ref.1 |
| Subunit structure | Heteromultimeric cytoplasmic complex with HSP90, HSP70, and FKBP4, in the absence of ligand. After ligand binding, it translocates to the nucleus and binds to DNA as a homodimer and as a heterodimer with NR3C1. May interact with HSD11B2 in the absence of ligand. Binds the coactivators NCOA1, NCOA2, TIF1 and NRIP1. Ref.14 |
| Subcellular location | Cytoplasm. Nucleus. Endoplasmic reticulum membrane; Peripheral membrane protein. Note: Cytoplasmic and nuclear in the absence of ligand; nuclear after ligand-binding. When bound to HSD11B2, it is found associated with the endoplasmic reticulum membrane. Ref.5 Ref.12 |
| Tissue specificity | Ubiquitous. Highly expressed in distal tubules, convoluted tubules and cortical collecting duct in kidney, and in sweat glands. Detected at lower levels in cardiomyocytes, in epidermis and in colon enterocytes. Ref.2 Ref.7 |
| Domain | Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal steroid-binding domain. |
| Post-translational modification | Phosphorylated. Ref.5 |
| Involvement in disease | Defects in NR3C2 are a cause of autosomal dominant pseudohypoaldosteronism type I (PHA1) [MIM:177735]. PHA1 is characterized by urinary salt wasting, resulting from target organ unresponsiveness to mineralocorticoids. There are 2 forms of PHA1: the autosomal dominant form that is mild, and the recessive form which is more severe and due to defects in any of the epithelial sodium channel subunits. In autosomal dominant PHA1 the target organ defect is confined to kidney. Clinical expression can vary from asymptomatic to moderate. It may be severe at birth, but symptoms remit with age. Familial and sporadic cases have been reported. Ref.4 Ref.17 Ref.20 Ref.21 Ref.23 Defects in NR3C2 are a cause of early-onset hypertension with severe exacerbation in pregnancy [MIM:605115]. Inheritance is autosomal dominant. The disease is characterized by the onset of severe hypertension before the age of 20, and by suppression of aldosterone secretion. Ref.4 |
| Sequence similarities | Belongs to the nuclear hormone receptor family. NR3 subfamily. Contains 1 nuclear receptor DNA-binding domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P08235-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P08235-2) The sequence of this isoform differs from the canonical sequence as follows: 672-706: ARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEE → ERRCISLPCMNYARGCTKSAFSSFDCSSPLKNTPS 707-984: Missing. | ||||||
| Note: Lacks steroid-binding activity and acts as ligand-independent transactivator. | ||||||
| Isoform 3 (identifier: P08235-3) The sequence of this isoform differs from the canonical sequence as follows: 633-633: G → GKCSW | ||||||
| Isoform 4 (identifier: P08235-4) Also known as: Delta; The sequence of this isoform differs from the canonical sequence as follows: 672-788: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 984 | 984 | Mineralocorticoid receptor | PRO_0000053682 | |||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||
| DNA binding | 603 – 668 | 66 | Nuclear receptor | ||||||||||||||||||||||||||||||||||||||
| Zinc finger | 603 – 623 | 21 | NR C4-type | ||||||||||||||||||||||||||||||||||||||
| Zinc finger | 639 – 663 | 25 | NR C4-type | ||||||||||||||||||||||||||||||||||||||
| Region | 1 – 602 | 602 | Modulating | ||||||||||||||||||||||||||||||||||||||
| Region | 669 – 732 | 64 | Hinge | ||||||||||||||||||||||||||||||||||||||
| Region | 733 – 984 | 252 | Steroid-binding | ||||||||||||||||||||||||||||||||||||||
| Region | 782 – 785 | 4 | Important for coactivator binding | ||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||
| Binding site | 770 | 1 | Steroid | ||||||||||||||||||||||||||||||||||||||
| Binding site | 776 | 1 | Steroid | ||||||||||||||||||||||||||||||||||||||
| Binding site | 817 | 1 | Steroid | ||||||||||||||||||||||||||||||||||||||
| Binding site | 945 | 1 | Steroid | ||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 633 | 1 | G → GKCSW in isoform 3. | VSP_007357 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 672 – 788 | 117 | Missing in isoform 4. | VSP_007360 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 672 – 706 | 35 | ARKSK…QSPEE → ERRCISLPCMNYARGCTKSA FSSFDCSSPLKNTPS in isoform 2. | VSP_007358 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 707 – 984 | 278 | Missing in isoform 2. | VSP_007359 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 7 | 1 | H → Q in a colorectal cancer sample; somatic mutation. Ref.22 | VAR_036063 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 180 | 1 | I → V High frequency in healthy individuals; found in a patient with sporadic pseudohypoaldosteronism type I; increases transcription transactivation at low aldosterone concentrations. dbSNP rs5522. Ref.2 Ref.3 Ref.16 Ref.19 | VAR_014623 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 241 | 1 | A → V High frequency in healthy individuals; found in a patient with sporadic pseudohypoaldosteronism type I; reduces transcription transactivation upon aldosterone binding. Ref.2 Ref.3 Ref.19 | VAR_015625 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 444 | 1 | N → T: dbSNP rs5523. Ref.16 | VAR_014624 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 537 | 1 | R → Q: dbSNP rs5526. Ref.16 | VAR_014625 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 554 | 1 | N → S: dbSNP rs5527. Ref.16 | VAR_014626 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 633 | 1 | G → R in PHA1; reduces transcription transactivation upon aldosterone binding. Ref.20 | VAR_031268 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 645 | 1 | C → S in PHA1. Ref.23 | VAR_031269 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 659 | 1 | R → S in PHA1. Ref.23 | VAR_031270 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 759 | 1 | P → S in PHA1. Ref.23 | VAR_031271 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 769 | 1 | L → P in PHA1. Ref.23 | VAR_031272 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 770 | 1 | N → K in PHA1. Ref.23 | VAR_031273 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 776 | 1 | Q → R in PHA1; reduces aldosterone binding. Ref.20 | VAR_031274 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 805 | 1 | S → P in PHA1. Ref.23 | VAR_031275 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 810 | 1 | S → L in early onset hypertension; alters receptor specificity and leads to constitutive activation. dbSNP rs41511344. Ref.13 Ref.15 Ref.18 | VAR_015626 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 815 | 1 | S → R in PHA1. Ref.23 | VAR_031276 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 818 | 1 | S → L in PHA1; abolishes translocation to the nucleus and transcription transactivation upon aldosterone binding. Ref.21 | VAR_031277 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 826 | 1 | F → Y: dbSNP rs13306592. | VAR_029311 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 924 | 1 | L → P in PHA1; abolishes transcription transactivation upon aldosterone binding. Ref.17 Ref.20 | VAR_015627 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 972 | 1 | E → G in PHA1; reduces affinity for aldosterone and transcription transactivation. Ref.21 | VAR_031278 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 979 | 1 | L → P in PHA1; loss of aldosterone binding and transcription transactivation. Ref.20 | VAR_031279 | |||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 767 | 1 | S → N: Loss of transcription transactivation. Ref.13 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 767 | 1 | S → Q: Strong decrease of transcription transactivation. Ref.13 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 770 | 1 | N → A, D, H, Q, S or T: Abolishes aldosterone binding and transcription transactivation. Ref.13 Ref.10 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 776 | 1 | Q → A: Reduces aldosterone binding and transcription transactivation. Ref.15 Ref.10 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 782 | 1 | K → E: Decreased coactivator binding. Ref.14 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 785 | 1 | K → E: Loss of coactivator binding. Ref.14 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 796 | 1 | E → R: Decreased coactivator binding. Ref.14 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 808 | 1 | C → S: Increases aldosterone-binding. Ref.9 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 810 | 1 | S → M: Alters receptor specificity. Ref.18 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 817 | 1 | R → A: Reduces aldosterone binding and transcription transactivation. Ref.15 Ref.10 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 849 | 1 | C → S: Strongly decreases affinity for aldosterone and transcription transactivation. Ref.9 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 942 | 1 | C → S: Abolishes steroid binding and transcription transactivation. Ref.9 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 945 | 1 | T → A: Decreases aldosterone-binding and cortisol-binding. Ref.13 Ref.10 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 952 | 1 | L → A: Reduces transcription transactivation. Ref.11 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 953 | 1 | K → A: Slightly reduces aldosterone binding and abolishes transcription transactivation. Ref.11 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 954 | 1 | V → A: Reduces aldosterone binding and abolishes transcription transactivation. Ref.11 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 956 | 1 | F → A: Abolishes aldosterone binding and transcription transactivation. Ref.11 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 957 | 1 | P → A: Slightly reduces aldosterone binding and transcription transactivation. Ref.11 | ||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||
| Helix | 738 – 745 | 8 | |||||||||||||||||||||||||||||||||||||||
| Helix | 762 – 784 | 23 | |||||||||||||||||||||||||||||||||||||||
| Helix | 790 – 792 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 795 – 822 | 28 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 825 – 830 | 6 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 833 – 835 | 3 | |||||||||||||||||||||||||||||||||||||||
| Turn | 837 – 840 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 841 – 843 | 3 | |||||||||||||||||||||||||||||||||||||||
| Turn | 846 – 848 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 849 – 862 | 14 | |||||||||||||||||||||||||||||||||||||||
| Helix | 866 – 877 | 12 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 879 – 882 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 889 – 907 | 19 | |||||||||||||||||||||||||||||||||||||||
| Helix | 918 – 947 | 30 | |||||||||||||||||||||||||||||||||||||||
| Helix | 949 – 952 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 961 – 971 | 11 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 976 – 978 | 3 | |||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of human mineralocorticoid receptor complementary DNA: structural and functional kinship with the glucocorticoid receptor." Arriza J.L., Weinberger C., Cerelli G., Glaser T.M., Handelin B.L., Housman D.E., Evans R.M. Science 237:268-275(1987) [PubMed: 3037703] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION. Tissue: Kidney. |
| [2] | "A new human MR splice variant is a ligand-independent transactivator modulating corticosteroid action." Zennaro M.-C., Souque A., Viengchareun S., Poisson E., Lombes M. Mol. Endocrinol. 15:1586-1598(2001) [PubMed: 11518808] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4), TISSUE SPECIFICITY, INTERACTION WITH NCOA1; TIF1 AND NRIP1, VARIANTS VAL-180 AND VAL-241. Tissue: Heart. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS VAL-180 AND VAL-241. |
| [4] | "Mutations in the mineralocorticoid receptor gene cause autosomal dominant pseudohypoaldosteronism type I." Geller D.S., Rodriguez-Soriano J., Vallo Boado A., Schifter S., Bayer M., Chang S.S., Lifton R.P. Nat. Genet. 19:279-281(1998) [PubMed: 9662404] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 545-984, DISEASE. |
| [5] | "Overexpression and characterization of the human mineralocorticoid receptor." Alnemri E.S., Maksymowych A.B., Robertson N.M., Litwack G. J. Biol. Chem. 266:18072-18081(1991) [PubMed: 1655735] [Abstract] Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION. |
| [6] | "Identification of a splice variant of the rat and human mineralocorticoid receptor genes." Bloem L.J., Guo C., Pratt J.H. J. Steroid Biochem. Mol. Biol. 55:159-162(1995) [PubMed: 7495694] [Abstract] Cited for: IDENTIFICATION (ISOFORM 3). Tissue: Leukocyte. |
| [7] | "Tissue-specific expression of alpha and beta messenger ribonucleic acid isoforms of the human mineralocorticoid receptor in normal and pathological states." Zennaro M.-C., Farman N., Bonvalet J.-P., Lombes M. J. Clin. Endocrinol. Metab. 82:1345-1352(1997) [PubMed: 9141514] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [8] | "The unliganded mineralocorticoid receptor is associated with heat shock proteins 70 and 90 and the immunophilin FKBP-52." Bruner K.L., Derfoul A., Robertson N.M., Guerriero G., Fernandes-Alnemri T., Alnemri E.S., Litwack G. Recept. Signal Transduct. 7:85-98(1997) [PubMed: 9392437] [Abstract] Cited for: TERNARY COMPLEX WITH HSP90; HSP70 AND FKBP4, DISSOCIATION UPON ALDOSTERONE BINDING. |
| [9] | "Cysteines 849 and 942 of human mineralocorticoid receptor are crucial for steroid binding." Lupo B., Mesnier D., Auzou G. Biochemistry 37:12153-12159(1998) [PubMed: 9724527] [Abstract] Cited for: MUTAGENESIS OF CYS-808; CYS-849 AND CYS-942. |
| [10] | "Mechanistic aspects of mineralocorticoid receptor activation." Hellal-Levy C., Fagart J., Souque A., Rafestin-Oblin M.-E. Kidney Int. 57:1250-1255(2000) [PubMed: 10760050] [Abstract] Cited for: MUTAGENESIS OF ASN-770; GLN-776; ARG-817 AND THR-945. |
| [11] | "Crucial role of the H11-H12 loop in stabilizing the active conformation of the human mineralocorticoid receptor." Hellal-Levy C., Fagart J., Souque A., Wurtz J.-M., Moras D., Rafestin-Oblin M.-E. Mol. Endocrinol. 14:1210-1221(2000) [PubMed: 10935545] [Abstract] Cited for: INTERACTION WITH NCOA1; TIF1 AND NRIP1, MUTAGENESIS OF LEU-952; LYS-953; VAL-954; PHE-956 AND PRO-957. |
| [12] | "The intracellular localization of the mineralocorticoid receptor is regulated by 11beta-hydroxysteroid dehydrogenase type 2." Odermatt A., Arnold P., Frey F.J. J. Biol. Chem. 276:28484-28492(2001) [PubMed: 11350956] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH HSD11B2. |
| [13] | "A ligand-mediated hydrogen bond network required for the activation of the mineralocorticoid receptor." Bledsoe R.K., Madauss K.P., Holt J.A., Apolito C.J., Lambert M.H., Pearce K.H., Stanley T.B., Stewart E.L., Trump R.P., Willson T.M., Williams S.P. J. Biol. Chem. 280:31283-31293(2005) [PubMed: 15967794] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 712-984 OF MUTANT SER-808 IN COMPLEXES WITH AGONIST AND ANTAGONISTS, CHARACTERIZATION OF VARIANT EARLY ONSET HYPERTENSION LEU-810, MUTAGENESIS OF SER-767; ASN-770 AND THR-945. |
| [14] | "Structural and biochemical mechanisms for the specificity of hormone binding and coactivator assembly by mineralocorticoid receptor." Li Y., Suino K., Daugherty J., Xu H.E. Mol. Cell 19:367-380(2005) [PubMed: 16061183] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) OF 732-984 OF MUTANT SER-808 IN COMPLEX WITH STEROID LIGAND AND NCOA2, SUBUNIT, MUTAGENESIS OF LYS-782; LYS-785 AND GLU-796. |
| [15] | "Crystal structure of a mutant mineralocorticoid receptor responsible for hypertension." Fagart J., Huyet J., Pinon G.M., Rochel M., Mayer C., Rafestin-Oblin M.-E. Nat. Struct. Mol. Biol. 12:554-555(2005) [PubMed: 15908963] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.96 ANGSTROMS) OF 731-984 OF MUTANT LEU-810 IN COMPLEXES WITH STEROID AGONISTS, CHARACTERIZATION OF VARIANT EARLY ONSET HYPERTENSION LEU-810, MUTAGENESIS OF GLN-776 AND ARG-817. |
| [16] | "Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis." Halushka M.K., Fan J.-B., Bentley K., Hsie L., Shen N., Weder A., Cooper R., Lipshutz R., Chakravarti A. Nat. Genet. 22:239-247(1999) [PubMed: 10391210] [Abstract] Cited for: VARIANTS VAL-180; THR-444; GLN-537 AND SER-554. |
| [17] | "A novel missense mutation of mineralocorticoid receptor gene in one Japanese family with a renal form of pseudohypoaldosteronism type 1." Tajima T., Kitagawa H., Yokoya S., Tachibana K., Adachi M., Nakae J., Suwa S., Katoh S., Fujieda K. J. Clin. Endocrinol. Metab. 85:4690-4694(2000) [PubMed: 11134129] [Abstract] Cited for: CHARACTERIZATION OF VARIANT PHA1 PRO-924. |
| [18] | "Activating mineralocorticoid receptor mutation in hypertension exacerbated by pregnancy." Geller D.S., Farhi A., Pinkerton N., Fradley M., Moritz M., Spitzer A., Meinke G., Tsai F.T.F., Sigler P.B., Lifton R.P. Science 289:119-123(2000) [PubMed: 10884226] [Abstract] Cited for: VARIANT EARLY ONSET HYPERTENSION LEU-810, MUTAGENESIS OF SER-810. |
| [19] | "Functional polymorphisms in the mineralocorticoid receptor and amirolide-sensitive sodium channel genes in a patient with sporadic pseudohypoaldosteronism." Arai K., Nakagomi Y., Iketani M., Shimura Y., Amemiya S., Ohyama K., Shibasaki T. Hum. Genet. 112:91-97(2003) [PubMed: 12483305] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS VAL-180 AND VAL-241. |
| [20] | "Different inactivating mutations of the mineralocorticoid receptor in fourteen families affected by type I pseudohypoaldosteronism." Sartorato P., Lapeyraque A.-L., Armanini D., Kuhnle U., Khaldi Y., Salomon R., Abadie V., Di Battista E., Naselli A., Racine A., Bosio M., Caprio M., Poulet-Young V., Chabrolle J.-P., Niaudet P., De Gennes C., Lecornec M.-H., Poisson E. Zennaro M.-C.J. Clin. Endocrinol. Metab. 88:2508-2517(2003) [PubMed: 12788847] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS PHA1 ARG-633; ARG-776; PRO-924 AND PRO-979. |
| [21] | "Elucidating the underlying molecular pathogenesis of NR3C2 mutants causing autosomal dominant pseudohypoaldosteronism type 1." Riepe F.G., Finkeldei J., de Sanctis L., Einaudi S., Testa A., Karges B., Peter M., Viemann M., Groetzinger J., Sippell W.G., Fejes-Toth G., Krone N. J. Clin. Endocrinol. Metab. 91:4552-4561(2006) [PubMed: 16954160] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS PHA1 LEU-818 AND GLY-972. |
| [22] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] GLN-7. |
| [23] | "Mineralocorticoid receptor mutations are the principal cause of renal type 1 pseudohypoaldosteronism." Pujo L., Fagart J., Gary F., Papadimitriou D.T., Claes A., Jeunemaitre X., Zennaro M.-C. Hum. Mutat. 28:33-40(2007) [PubMed: 16972228] [Abstract] Cited for: VARIANTS PHA1 SER-645; SER-659; SER-759; PRO-769; LYS-770; PRO-805 AND ARG-815. |
| + | Additional computationally mapped references. |
Web resources
| Atlas of Genetics and Cytogenetics in Oncology and Haematology |
| GeneReviews |
| Wikipedia Mineralocorticoid receptor entry |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M16801 mRNA. Translation: AAA59571.1. AJ315514 mRNA. Translation: CAC67405.1. AJ315515 mRNA. Translation: CAC67406.1. AC069272 Genomic DNA. No translation available. AC093678 Genomic DNA. No translation available. AC093881 Genomic DNA. No translation available. AC104691 Genomic DNA. No translation available. AC106899 Genomic DNA. No translation available. AF068623 AF068622 Genomic DNA. Translation: AAC63513.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00027744. IPI00248972. IPI00248973. IPI00248974. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | A29513. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000892.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.163924 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P08235. Positions 599-676. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P08235. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P08235. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P08235. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000358102; ENSP00000350815; ENSG00000151623; Homo sapiens. [Genome view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 4306. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC04M149219. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0024570. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:7979. NR3C2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB009155. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 177735. phenotype. 600983. gene. 605115. phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 88660. Hypertension due to gain-of-function mutations in the mineralocorticoid receptor. 756. Pseudohypoaldosteronism, type 1. 171871. Renal pseudohypoaldosteronism type 1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA242. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG09421. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | P08235. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_71. Gene Expression. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P08235. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P08235. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_NR3C2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P08235. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000151623. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR008946. Nucl_hormone_rcpt_ligand-bd. IPR000536. Nucl_hrmn_rcpt_lig-bd_core. IPR001628. Znf_hrmn_rcpt. IPR013088. Znf_NHR/GATA. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:3.30.50.10. Znf_NHR/GATA. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00104. Hormone_recep. 1 hit. PF00105. zf-C4. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00047. STROIDFINGER. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00430. HOLI. 1 hit. SM00399. ZnF_C4. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00031. NUCLEAR_REC_DBD_1. 1 hit. PS51030. NUCLEAR_REC_DBD_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | P08235. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB01134. Desoxycorticosterone Pivalate. DB00700. Eplerenone. DB00687. Fludrocortisone. DB00421. Spironolactone. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 16949. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | MCR_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P08235 Secondary accession number(s): Q96KQ8, Q96KQ9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


