Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P08183

- MDR1_HUMAN

UniProt

P08183 - MDR1_HUMAN

Protein

Multidrug resistance protein 1

Gene

ABCB1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 174 (01 Oct 2014)
      Sequence version 3 (26 May 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

    Catalytic activityi

    ATP + H2O + xenobiotic(In) = ADP + phosphate + xenobiotic(Out).

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi427 – 4348ATP 1PROSITE-ProRule annotation
    Nucleotide bindingi1070 – 10778ATP 2PROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATPase activity, coupled to transmembrane movement of substances Source: RefGenome
    2. ATP binding Source: ProtInc
    3. protein binding Source: IntAct
    4. transporter activity Source: ProtInc
    5. xenobiotic-transporting ATPase activity Source: UniProtKB-EC

    GO - Biological processi

    1. drug transmembrane transport Source: Reactome
    2. G2/M transition of mitotic cell cycle Source: DFLAT
    3. response to drug Source: ProtInc
    4. small molecule metabolic process Source: Reactome
    5. stem cell proliferation Source: DFLAT
    6. transmembrane transport Source: RefGenome
    7. transport Source: ProtInc

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Biological processi

    Transport

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_120801. Abacavir transmembrane transport.
    REACT_15480. ABC-family proteins mediated transport.

    Protein family/group databases

    TCDBi3.A.1.201.1. the atp-binding cassette (abc) superfamily.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Multidrug resistance protein 1 (EC:3.6.3.44)
    Alternative name(s):
    ATP-binding cassette sub-family B member 1
    P-glycoprotein 1
    CD_antigen: CD243
    Gene namesi
    Name:ABCB1
    Synonyms:MDR1, PGY1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:40. ABCB1.

    Subcellular locationi

    Cell membrane By similarity; Multi-pass membrane protein PROSITE-ProRule annotation

    GO - Cellular componenti

    1. cell surface Source: DFLAT
    2. extracellular vesicular exosome Source: UniProt
    3. integral component of membrane Source: RefGenome
    4. membrane Source: ProtInc
    5. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Inflammatory bowel disease 13 (IBD13) [MIM:612244]: A chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
    Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti893 – 8931S → A Common allele; associated with susceptibility to IBD13; has decreased enzyme activity. 8 Publications
    Corresponds to variant rs2032582 [ dbSNP | Ensembl ].
    VAR_013361

    Organism-specific databases

    MIMi612244. phenotype.
    Orphaneti771. Ulcerative colitis.
    PharmGKBiPA267.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12801280Multidrug resistance protein 1PRO_0000093332Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi91 – 911N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi94 – 941N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi99 – 991N-linked (GlcNAc...)Sequence Analysis
    Modified residuei660 – 6601PhosphoserineBy similarity

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiP08183.
    PaxDbiP08183.
    PRIDEiP08183.

    PTM databases

    PhosphoSiteiP08183.

    Expressioni

    Tissue specificityi

    Expressed in liver, kidney, small intestine and brain.

    Gene expression databases

    ArrayExpressiP08183.
    BgeeiP08183.
    CleanExiHS_ABCB1.
    GenevestigatoriP08183.

    Organism-specific databases

    HPAiCAB001716.
    HPA002199.

    Interactioni

    Subunit structurei

    Interacts with PSMB5.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    LAPTM4BQ86VI42EBI-1057359,EBI-3267258
    RNF2Q994962EBI-1057359,EBI-722416

    Protein-protein interaction databases

    BioGridi111262. 10 interactions.
    IntActiP08183. 6 interactions.
    MINTiMINT-5000901.
    STRINGi9606.ENSP00000265724.

    Structurei

    3D structure databases

    ProteinModelPortaliP08183.
    SMRiP08183. Positions 32-630.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 4444CytoplasmicBy similarityAdd
    BLAST
    Topological domaini68 – 11649ExtracellularBy similarityAdd
    BLAST
    Topological domaini138 – 18649CytoplasmicBy similarityAdd
    BLAST
    Topological domaini209 – 2157ExtracellularBy similarity
    Topological domaini237 – 29256CytoplasmicBy similarityAdd
    BLAST
    Topological domaini317 – 33014ExtracellularBy similarityAdd
    BLAST
    Topological domaini353 – 711359CytoplasmicBy similarityAdd
    BLAST
    Topological domaini733 – 75624ExtracellularBy similarityAdd
    BLAST
    Topological domaini778 – 83255CytoplasmicBy similarityAdd
    BLAST
    Topological domaini854 – 8541ExtracellularBy similarity
    Topological domaini875 – 93460CytoplasmicBy similarityAdd
    BLAST
    Topological domaini958 – 97316ExtracellularBy similarityAdd
    BLAST
    Topological domaini996 – 1280285CytoplasmicBy similarityAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei45 – 6723HelicalPROSITE-ProRule annotationAdd
    BLAST
    Transmembranei117 – 13721HelicalPROSITE-ProRule annotationAdd
    BLAST
    Transmembranei187 – 20822HelicalPROSITE-ProRule annotationAdd
    BLAST
    Transmembranei216 – 23621HelicalPROSITE-ProRule annotationAdd
    BLAST
    Transmembranei293 – 31624HelicalPROSITE-ProRule annotationAdd
    BLAST
    Transmembranei331 – 35222HelicalPROSITE-ProRule annotationAdd
    BLAST
    Transmembranei712 – 73221HelicalPROSITE-ProRule annotationAdd
    BLAST
    Transmembranei757 – 77721HelicalPROSITE-ProRule annotationAdd
    BLAST
    Transmembranei833 – 85321HelicalPROSITE-ProRule annotationAdd
    BLAST
    Transmembranei855 – 87420HelicalPROSITE-ProRule annotationAdd
    BLAST
    Transmembranei935 – 95723HelicalPROSITE-ProRule annotationAdd
    BLAST
    Transmembranei974 – 99522HelicalPROSITE-ProRule annotationAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini51 – 357307ABC transmembrane type-1 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini392 – 628237ABC transporter 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini711 – 1000290ABC transmembrane type-1 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1035 – 1273239ABC transporter 2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 2 ABC transmembrane type-1 domains.PROSITE-ProRule annotation
    Contains 2 ABC transporter domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1132.
    HOVERGENiHBG080809.
    InParanoidiP08183.
    KOiK05658.
    OMAiITQNVAN.
    OrthoDBiEOG7Z3F4H.
    PhylomeDBiP08183.
    TreeFamiTF105193.

    Family and domain databases

    Gene3Di3.40.50.300. 2 hits.
    InterProiIPR003593. AAA+_ATPase.
    IPR011527. ABC1_TM_dom.
    IPR003439. ABC_transporter-like.
    IPR017871. ABC_transporter_CS.
    IPR001140. ABC_transptr_TM_dom.
    IPR027417. P-loop_NTPase.
    [Graphical view]
    PfamiPF00664. ABC_membrane. 2 hits.
    PF00005. ABC_tran. 2 hits.
    [Graphical view]
    SMARTiSM00382. AAA. 2 hits.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 2 hits.
    SSF90123. SSF90123. 2 hits.
    PROSITEiPS50929. ABC_TM1F. 2 hits.
    PS00211. ABC_TRANSPORTER_1. 2 hits.
    PS50893. ABC_TRANSPORTER_2. 2 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P08183-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDLEGDRNGG AKKKNFFKLN NKSEKDKKEK KPTVSVFSMF RYSNWLDKLY     50
    MVVGTLAAII HGAGLPLMML VFGEMTDIFA NAGNLEDLMS NITNRSDIND 100
    TGFFMNLEED MTRYAYYYSG IGAGVLVAAY IQVSFWCLAA GRQIHKIRKQ 150
    FFHAIMRQEI GWFDVHDVGE LNTRLTDDVS KINEGIGDKI GMFFQSMATF 200
    FTGFIVGFTR GWKLTLVILA ISPVLGLSAA VWAKILSSFT DKELLAYAKA 250
    GAVAEEVLAA IRTVIAFGGQ KKELERYNKN LEEAKRIGIK KAITANISIG 300
    AAFLLIYASY ALAFWYGTTL VLSGEYSIGQ VLTVFFSVLI GAFSVGQASP 350
    SIEAFANARG AAYEIFKIID NKPSIDSYSK SGHKPDNIKG NLEFRNVHFS 400
    YPSRKEVKIL KGLNLKVQSG QTVALVGNSG CGKSTTVQLM QRLYDPTEGM 450
    VSVDGQDIRT INVRFLREII GVVSQEPVLF ATTIAENIRY GRENVTMDEI 500
    EKAVKEANAY DFIMKLPHKF DTLVGERGAQ LSGGQKQRIA IARALVRNPK 550
    ILLLDEATSA LDTESEAVVQ VALDKARKGR TTIVIAHRLS TVRNADVIAG 600
    FDDGVIVEKG NHDELMKEKG IYFKLVTMQT AGNEVELENA ADESKSEIDA 650
    LEMSSNDSRS SLIRKRSTRR SVRGSQAQDR KLSTKEALDE SIPPVSFWRI 700
    MKLNLTEWPY FVVGVFCAII NGGLQPAFAI IFSKIIGVFT RIDDPETKRQ 750
    NSNLFSLLFL ALGIISFITF FLQGFTFGKA GEILTKRLRY MVFRSMLRQD 800
    VSWFDDPKNT TGALTTRLAN DAAQVKGAIG SRLAVITQNI ANLGTGIIIS 850
    FIYGWQLTLL LLAIVPIIAI AGVVEMKMLS GQALKDKKEL EGSGKIATEA 900
    IENFRTVVSL TQEQKFEHMY AQSLQVPYRN SLRKAHIFGI TFSFTQAMMY 950
    FSYAGCFRFG AYLVAHKLMS FEDVLLVFSA VVFGAMAVGQ VSSFAPDYAK 1000
    AKISAAHIIM IIEKTPLIDS YSTEGLMPNT LEGNVTFGEV VFNYPTRPDI 1050
    PVLQGLSLEV KKGQTLALVG SSGCGKSTVV QLLERFYDPL AGKVLLDGKE 1100
    IKRLNVQWLR AHLGIVSQEP ILFDCSIAEN IAYGDNSRVV SQEEIVRAAK 1150
    EANIHAFIES LPNKYSTKVG DKGTQLSGGQ KQRIAIARAL VRQPHILLLD 1200
    EATSALDTES EKVVQEALDK AREGRTCIVI AHRLSTIQNA DLIVVFQNGR 1250
    VKEHGTHQQL LAQKGIYFSM VSVQAGTKRQ 1280
    Length:1,280
    Mass (Da):141,479
    Last modified:May 26, 2009 - v3
    Checksum:iF0230744AB288C73
    GO
    Isoform 2 (identifier: P08183-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         113-177: RYAYYYSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTD → S

    Show »
    Length:1,216
    Mass (Da):134,032
    Checksum:i227233F5F2259A8C
    GO

    Sequence cautioni

    The sequence AAM49149.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti23 – 231S → R in CAA41558. (PubMed:2568832)Curated
    Sequence conflicti336 – 3361Missing in AAB69423. (PubMed:9038218)Curated

    Polymorphismi

    Genetic variation in ABCB1 may play a role in patients who do not respond to drug treatment.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti17 – 171F → L.1 Publication
    Corresponds to variant rs28381804 [ dbSNP | Ensembl ].
    VAR_022276
    Natural varianti21 – 211N → D.5 Publications
    Corresponds to variant rs9282564 [ dbSNP | Ensembl ].
    VAR_014704
    Natural varianti44 – 441N → S.
    Corresponds to variant rs1202183 [ dbSNP | Ensembl ].
    VAR_055423
    Natural varianti80 – 801A → E.
    Corresponds to variant rs9282565 [ dbSNP | Ensembl ].
    VAR_055424
    Natural varianti103 – 1031F → L Rare polymorphism. 1 Publication
    VAR_015001
    Natural varianti108 – 1081E → K.1 Publication
    VAR_018351
    Natural varianti185 – 1851G → V in a colchicine-selected multidrug-resistant cell line; confers increased resistance to colchicine. 3 Publications
    Corresponds to variant rs1128501 [ dbSNP | Ensembl ].
    VAR_015002
    Natural varianti261 – 2611I → V.
    Corresponds to variant rs36008564 [ dbSNP | Ensembl ].
    VAR_055425
    Natural varianti400 – 4001S → N.3 Publications
    Corresponds to variant rs2229109 [ dbSNP | Ensembl ].
    VAR_015003
    Natural varianti566 – 5661E → K.1 Publication
    Corresponds to variant rs28381902 [ dbSNP | Ensembl ].
    VAR_022277
    Natural varianti593 – 5931R → C.1 Publication
    Corresponds to variant rs28381914 [ dbSNP | Ensembl ].
    VAR_022278
    Natural varianti599 – 5991A → T.
    Corresponds to variant rs2235036 [ dbSNP | Ensembl ].
    VAR_055426
    Natural varianti669 – 6691R → C.
    Corresponds to variant rs35023033 [ dbSNP | Ensembl ].
    VAR_055427
    Natural varianti801 – 8011V → M.
    Corresponds to variant rs2235039 [ dbSNP | Ensembl ].
    VAR_055428
    Natural varianti829 – 8291I → V.
    Corresponds to variant rs2032581 [ dbSNP | Ensembl ].
    VAR_055429
    Natural varianti836 – 8361I → V.1 Publication
    Corresponds to variant rs28381967 [ dbSNP | Ensembl ].
    VAR_022279
    Natural varianti887 – 8871K → N in a colorectal cancer sample; somatic mutation. 1 Publication
    VAR_035737
    Natural varianti893 – 8931S → A Common allele; associated with susceptibility to IBD13; has decreased enzyme activity. 8 Publications
    Corresponds to variant rs2032582 [ dbSNP | Ensembl ].
    VAR_013361
    Natural varianti893 – 8931S → T Rare allele. 3 Publications
    Corresponds to variant rs2032582 [ dbSNP | Ensembl ].
    VAR_013362
    Natural varianti986 – 9861M → V.
    VAR_018352
    Natural varianti999 – 9991A → T.1 Publication
    VAR_015004
    Natural varianti1051 – 10511P → A.1 Publication
    Corresponds to variant rs28401798 [ dbSNP | Ensembl ].
    VAR_022280
    Natural varianti1107 – 11071Q → P.1 Publication
    Corresponds to variant rs55852620 [ dbSNP | Ensembl ].
    VAR_015005
    Natural varianti1141 – 11411S → T.1 Publication
    Corresponds to variant rs2229107 [ dbSNP | Ensembl ].
    VAR_022281
    Natural varianti1251 – 12511V → I.2 Publications
    Corresponds to variant rs28364274 [ dbSNP | Ensembl ].
    VAR_018353

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei113 – 17765RYAYY…TRLTD → S in isoform 2. 1 PublicationVSP_055769Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M14758 mRNA. Translation: AAA59575.1.
    M29447
    , M29424, M29425, M29426, M29427, M29428, M29429, M29430, M29431, M29432, M29433, M29434, M29435, M29436, M29437, M29438, M29439, M29440, M29441, M29442, M29443, M29444, M29445, M29446 Genomic DNA. Translation: AAA59576.1.
    AF016535 mRNA. Translation: AAB69423.1.
    EU854148 mRNA. Translation: ACF94688.1.
    AY910577 Genomic DNA. Translation: AAW82430.1.
    AK290159 mRNA. Translation: BAF82848.1.
    AC002457 Genomic DNA. Translation: AAM49149.1. Sequence problems.
    AC005068 Genomic DNA. No translation available.
    M37724 Genomic DNA. Translation: AAA88047.1.
    M37725 Genomic DNA. Translation: AAA88048.1.
    X58723 Genomic DNA. Translation: CAA41558.1.
    CCDSiCCDS5608.1.
    PIRiA34914. DVHU1.
    RefSeqiNP_000918.2. NM_000927.4.
    UniGeneiHs.489033.
    Hs.737655.

    Genome annotation databases

    EnsembliENST00000265724; ENSP00000265724; ENSG00000085563. [P08183-1]
    ENST00000543898; ENSP00000444095; ENSG00000085563. [P08183-2]
    GeneIDi5243.
    KEGGihsa:5243.
    UCSCiuc003uiz.2. human.

    Polymorphism databases

    DMDMi238054374.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology
    NIEHS-SNPs
    SHMPD

    The Singapore human mutation and polymorphism database

    Wikipedia

    P-glycoprotein entry

    ABCMdb

    Database for mutations in ABC proteins

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M14758 mRNA. Translation: AAA59575.1 .
    M29447
    , M29424 , M29425 , M29426 , M29427 , M29428 , M29429 , M29430 , M29431 , M29432 , M29433 , M29434 , M29435 , M29436 , M29437 , M29438 , M29439 , M29440 , M29441 , M29442 , M29443 , M29444 , M29445 , M29446 Genomic DNA. Translation: AAA59576.1 .
    AF016535 mRNA. Translation: AAB69423.1 .
    EU854148 mRNA. Translation: ACF94688.1 .
    AY910577 Genomic DNA. Translation: AAW82430.1 .
    AK290159 mRNA. Translation: BAF82848.1 .
    AC002457 Genomic DNA. Translation: AAM49149.1 . Sequence problems.
    AC005068 Genomic DNA. No translation available.
    M37724 Genomic DNA. Translation: AAA88047.1 .
    M37725 Genomic DNA. Translation: AAA88048.1 .
    X58723 Genomic DNA. Translation: CAA41558.1 .
    CCDSi CCDS5608.1.
    PIRi A34914. DVHU1.
    RefSeqi NP_000918.2. NM_000927.4.
    UniGenei Hs.489033.
    Hs.737655.

    3D structure databases

    ProteinModelPortali P08183.
    SMRi P08183. Positions 32-630.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111262. 10 interactions.
    IntActi P08183. 6 interactions.
    MINTi MINT-5000901.
    STRINGi 9606.ENSP00000265724.

    Chemistry

    BindingDBi P08183.
    ChEMBLi CHEMBL4302.
    DrugBanki DB01193. Acebutolol.
    DB00316. Acetaminophen.
    DB00945. Acetylsalicylic acid.
    DB00171. Adenosine triphosphate.
    DB05773. ado-trastuzumab emtansine.
    DB08916. Afatinib.
    DB00518. Albendazole.
    DB00802. Alfentanil.
    DB00523. Alitretinoin.
    DB00915. Amantadine.
    DB00345. Aminohippurate.
    DB01118. Amiodarone.
    DB00321. Amitriptyline.
    DB00381. Amlodipine.
    DB00701. Amprenavir.
    DB00276. Amsacrine.
    DB06605. Apixaban.
    DB01169. Arsenic trioxide.
    DB00637. Astemizole.
    DB01072. Atazanavir.
    DB00335. Atenolol.
    DB01076. Atorvastatin.
    DB06626. Axitinib.
    DB00972. Azelastine.
    DB00207. Azithromycin.
    DB01086. Benzocaine.
    DB01244. Bepridil.
    DB00443. Betamethasone.
    DB00810. Biperiden.
    DB08873. Boceprevir.
    DB06616. Bosutinib.
    DB08870. Brentuximab vedotin.
    DB01200. Bromocriptine.
    DB00921. Buprenorphine.
    DB00490. Buspirone.
    DB06772. Cabazitaxel.
    DB00201. Caffeine.
    DB08907. Canagliflozin.
    DB00796. Candesartan.
    DB01197. Captopril.
    DB00564. Carbamazepine.
    DB08889. Carfilzomib.
    DB01136. Carvedilol.
    DB00520. Caspofungin.
    DB00608. Chloroquine.
    DB00477. Chlorpromazine.
    DB00672. Chlorpropamide.
    DB01239. Chlorprothixene.
    DB01340. Cilazapril.
    DB00501. Cimetidine.
    DB00537. Ciprofloxacin.
    DB00515. Cisplatin.
    DB00215. Citalopram.
    DB01211. Clarithromycin.
    DB00349. Clobazam.
    DB00845. Clofazimine.
    DB00882. Clomifene.
    DB01242. Clomipramine.
    DB00575. Clonidine.
    DB00758. Clopidogrel.
    DB00257. Clotrimazole.
    DB00363. Clozapine.
    DB01394. Colchicine.
    DB00286. Conjugated Estrogens.
    DB08865. Crizotinib.
    DB00531. Cyclophosphamide.
    DB00091. Cyclosporine.
    DB06695. Dabigatran etexilate.
    DB08912. Dabrafenib.
    DB00970. Dactinomycin.
    DB06292. Dapagliflozin.
    DB01254. Dasatinib.
    DB00694. Daunorubicin.
    DB04840. Debrisoquin.
    DB01151. Desipramine.
    DB00967. Desloratadine.
    DB01234. Dexamethasone.
    DB00514. Dextromethorphan.
    DB00829. Diazepam.
    DB00586. Diclofenac.
    DB00255. Diethylstilbestrol.
    DB01396. Digitoxin.
    DB00390. Digoxin.
    DB00320. Dihydroergotamine.
    DB00343. Diltiazem.
    DB00975. Dipyridamole.
    DB01248. Docetaxel.
    DB01184. Domperidone.
    DB00590. Doxazosin.
    DB01142. Doxepin.
    DB00997. Doxorubicin.
    DB00470. Dronabinol.
    DB04855. Dronedarone.
    DB00216. Eletriptan.
    DB00584. Enalapril.
    DB08899. Enzalutamide.
    DB00751. Epinastine.
    DB01253. Ergonovine.
    DB00696. Ergotamine.
    DB00530. Erlotinib.
    DB00199. Erythromycin.
    DB00783. Estradiol.
    DB01196. Estramustine.
    DB04573. Estriol.
    DB00655. Estrone.
    DB00977. Ethinyl Estradiol.
    DB00773. Etoposide.
    DB06414. Etravirine.
    DB00973. Ezetimibe.
    DB01023. Felodipine.
    DB00813. Fentanyl.
    DB06702. Fesoterodine.
    DB00950. Fexofenadine.
    DB08874. Fidaxomicin.
    DB00196. Fluconazole.
    DB00472. Fluoxetine.
    DB00875. Flupentixol.
    DB00623. Fluphenazine.
    DB00690. Flurazepam.
    DB08906. Fluticasone furoate.
    DB00176. Fluvoxamine.
    DB00317. Gefitinib.
    DB00441. Gemcitabine.
    DB01016. Glyburide.
    DB00027. Gramicidin D.
    DB00502. Haloperidol.
    DB00741. Hydrocortisone.
    DB01050. Ibuprofen.
    DB00619. Imatinib.
    DB00458. Imipramine.
    DB05039. Indacaterol.
    DB00224. Indinavir.
    DB00328. Indomethacin.
    DB00762. Irinotecan.
    DB01167. Itraconazole.
    DB08820. Ivacaftor.
    DB00602. Ivermectin.
    DB01221. Ketamine.
    DB01587. Ketazolam.
    DB01026. Ketoconazole.
    DB00709. Lamivudine.
    DB00555. Lamotrigine.
    DB00448. Lansoprazole.
    DB01259. Lapatinib.
    DB00480. Lenalidomide.
    DB01202. Levetiracetam.
    DB01137. Levofloxacin.
    DB08918. Levomilnacipran.
    DB00451. Levothyroxine.
    DB00281. Lidocaine.
    DB08882. Linagliptin.
    DB00279. Liothyronine.
    DB01583. Liotrix.
    DB00722. Lisinopril.
    DB08827. Lomitapide.
    DB00836. Loperamide.
    DB01601. Lopinavir.
    DB00455. Loratadine.
    DB00678. Losartan.
    DB00227. Lovastatin.
    DB00742. Mannitol.
    DB00934. Maprotiline.
    DB00643. Mebendazole.
    DB00358. Mefloquine.
    DB00351. Megestrol acetate.
    DB00371. Meprobamate.
    DB00333. Methadone.
    DB00563. Methotrexate.
    DB00959. Methylprednisolone.
    DB00264. Metoprolol.
    DB01110. Miconazole.
    DB00683. Midazolam.
    DB00834. Mifepristone.
    DB08893. Mirabegron.
    DB00305. Mitomycin.
    DB01204. Mitoxantrone.
    DB00295. Morphine.
    DB00688. Mycophenolate mofetil.
    DB01203. Nadolol.
    DB01183. Naloxone.
    DB00704. Naltrexone.
    DB01149. Nefazodone.
    DB00220. Nelfinavir.
    DB01400. Neostigmine.
    DB00622. Nicardipine.
    DB01115. Nifedipine.
    DB04868. Nilotinib.
    DB00401. Nisoldipine.
    DB01595. Nitrazepam.
    DB01054. Nitrendipine.
    DB00585. Nizatidine.
    DB00717. Norethindrone.
    DB00334. Olanzapine.
    DB00338. Omeprazole.
    DB01229. Paclitaxel.
    DB00213. Pantoprazole.
    DB00715. Paroxetine.
    DB06589. Pazopanib.
    DB00790. Perindopril.
    DB01174. Phenobarbital.
    DB00252. Phenytoin.
    DB01100. Pimozide.
    DB08860. Pitavastatin.
    DB08910. Pomalidomide.
    DB08901. Ponatinib.
    DB01263. Posaconazole.
    DB00175. Pravastatin.
    DB00457. Prazosin.
    DB00860. Prednisolone.
    DB00635. Prednisone.
    DB01032. Probenecid.
    DB00396. Progesterone.
    DB01069. Promethazine.
    DB01182. Propafenone.
    DB00571. Propranolol.
    DB00344. Protriptyline.
    DB01224. Quetiapine.
    DB01103. Quinacrine.
    DB00908. Quinidine.
    DB00468. Quinine.
    DB00863. Ranitidine.
    DB00234. Reboxetine.
    DB08896. Regorafenib.
    DB00206. Reserpine.
    DB01045. Rifampicin.
    DB08864. Rilpivirine.
    DB00734. Risperidone.
    DB00503. Ritonavir.
    DB06228. Rivaroxaban.
    DB00778. Roxithromycin.
    DB00936. Salicylic acid.
    DB01232. Saquinavir.
    DB00747. Scopolamine.
    DB01037. Selegiline.
    DB01104. Sertraline.
    DB06207. Silodosin.
    DB06290. SIMEPREVIR.
    DB00641. Simvastatin.
    DB00877. Sirolimus.
    DB01261. Sitagliptin.
    DB08934. SOFOSBUVIR.
    DB00398. Sorafenib.
    DB01208. Sparfloxacin.
    DB00421. Spironolactone.
    DB00428. Streptozocin.
    DB01138. Sulfinpyrazone.
    DB00669. Sumatriptan.
    DB01268. Sunitinib.
    DB00864. Tacrolimus.
    DB00675. Tamoxifen.
    DB05521. Telaprevir.
    DB00966. Telmisartan.
    DB06287. Temsirolimus.
    DB01162. Terazosin.
    DB00624. Testosterone.
    DB08816. Ticagrelor.
    DB00373. Timolol.
    DB06212. Tolvaptan.
    DB01030. Topotecan.
    DB00539. Toremifene.
    DB00656. Trazodone.
    DB00831. Trifluoperazine.
    DB00508. Triflupromazine.
    DB00440. Trimethoprim.
    DB00726. Trimipramine.
    DB01361. Troleandomycin.
    DB01339. Vecuronium.
    DB00285. Venlafaxine.
    DB00661. Verapamil.
    DB00570. Vinblastine.
    DB00541. Vincristine.
    DB00361. Vinorelbine.
    DB08828. Vismodegib.
    DB04877. Voacamine.
    DB00495. Zidovudine.

    Protein family/group databases

    TCDBi 3.A.1.201.1. the atp-binding cassette (abc) superfamily.

    PTM databases

    PhosphoSitei P08183.

    Polymorphism databases

    DMDMi 238054374.

    Proteomic databases

    MaxQBi P08183.
    PaxDbi P08183.
    PRIDEi P08183.

    Protocols and materials databases

    DNASUi 5243.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000265724 ; ENSP00000265724 ; ENSG00000085563 . [P08183-1 ]
    ENST00000543898 ; ENSP00000444095 ; ENSG00000085563 . [P08183-2 ]
    GeneIDi 5243.
    KEGGi hsa:5243.
    UCSCi uc003uiz.2. human.

    Organism-specific databases

    CTDi 5243.
    GeneCardsi GC07M087132.
    H-InvDB HIX0033521.
    HGNCi HGNC:40. ABCB1.
    HPAi CAB001716.
    HPA002199.
    MIMi 171050. gene.
    612244. phenotype.
    neXtProti NX_P08183.
    Orphaneti 771. Ulcerative colitis.
    PharmGKBi PA267.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1132.
    HOVERGENi HBG080809.
    InParanoidi P08183.
    KOi K05658.
    OMAi ITQNVAN.
    OrthoDBi EOG7Z3F4H.
    PhylomeDBi P08183.
    TreeFami TF105193.

    Enzyme and pathway databases

    Reactomei REACT_120801. Abacavir transmembrane transport.
    REACT_15480. ABC-family proteins mediated transport.

    Miscellaneous databases

    GeneWikii P-glycoprotein.
    GenomeRNAii 5243.
    NextBioi 20254.
    PROi P08183.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P08183.
    Bgeei P08183.
    CleanExi HS_ABCB1.
    Genevestigatori P08183.

    Family and domain databases

    Gene3Di 3.40.50.300. 2 hits.
    InterProi IPR003593. AAA+_ATPase.
    IPR011527. ABC1_TM_dom.
    IPR003439. ABC_transporter-like.
    IPR017871. ABC_transporter_CS.
    IPR001140. ABC_transptr_TM_dom.
    IPR027417. P-loop_NTPase.
    [Graphical view ]
    Pfami PF00664. ABC_membrane. 2 hits.
    PF00005. ABC_tran. 2 hits.
    [Graphical view ]
    SMARTi SM00382. AAA. 2 hits.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 2 hits.
    SSF90123. SSF90123. 2 hits.
    PROSITEi PS50929. ABC_TM1F. 2 hits.
    PS00211. ABC_TRANSPORTER_1. 2 hits.
    PS50893. ABC_TRANSPORTER_2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Internal duplication and homology with bacterial transport proteins in the mdr1 (P-glycoprotein) gene from multidrug-resistant human cells."
      Chen C.-J., Chin J.E., Ueda K., Clark D.P., Pastan I., Gottesman M.M., Roninson I.B.
      Cell 47:381-389(1986) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-185 AND ALA-893.
    2. "Genomic organization of the human multidrug resistance (MDR1) gene and origin of P-glycoproteins."
      Chen C.-J., Clark D.P., Ueda K., Pastan I., Gottesman M.M., Roninson I.B.
      J. Biol. Chem. 265:506-514(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-893.
    3. "Multidrug-resistant human sarcoma cells with a mutant P-glycoprotein, altered phenotype, and resistance to cyclosporins."
      Chen G., Duran G.E., Steger K.A., Lacayo N.J., Jaffrezou J.P., Dumontet C., Sikic B.I.
      J. Biol. Chem. 272:5974-5982(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-185 AND ALA-893.
    4. "Cloning of P-glycoprotein cDNA sequence from breast cancer MCF7 cell line."
      Jiang Y., Sun Q., Xie Z., Liu F., Xu W., Wang Y.
      Submitted (JUN-2008) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    5. NIEHS SNPs program
      Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASP-21.
      Tissue: Thalamus.
    7. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "mdr1/P-glycoprotein gene segments analyzed from various human leukemic cell lines exhibiting different multidrug resistance profiles."
      Gekeler V., Weger S., Probst H.
      Biochem. Biophys. Res. Commun. 169:796-802(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 178-215 AND 800-856.
    9. "P-glycoprotein gene (MDR1) cDNA from human adrenal: normal P-glycoprotein carries Gly185 with an altered pattern of multidrug resistance."
      Kioka N., Tsubota J., Kakehi Y., Komano T., Gottesman M.M., Pastan I., Ueda K.
      Biochem. Biophys. Res. Commun. 162:224-231(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-23 (ISOFORM 1/2).
    10. "ABC drug transporters: hereditary polymorphisms and pharmacological impact in MDR1, MRP1 and MRP2."
      Kerb R., Hoffmeyer S., Brinkmann U.
      Pharmacogenomics 2:51-64(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW.
    11. "Cytoplasmic domains of the transporter associated with antigen processing and P-glycoprotein interact with subunits of the proteasome."
      Begley G.S., Horvath A.R., Taylor J.C., Higgins C.F.
      Mol. Immunol. 42:137-141(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH PSMB5.
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "An altered pattern of cross-resistance in multidrug-resistant human cells results from spontaneous mutations in the mdr1 (P-glycoprotein) gene."
      Choi K.H., Chen C.-J., Kriegler M., Roninson I.B.
      Cell 53:519-529(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT VAL-185.
    15. "Genetic polymorphism in MDR-1: a tool for examining allelic expression in normal cells, unselected and drug-selected cell lines, and human tumors."
      Mickley L.A., Lee J.-S., Weng Z., Zhan Z., Alvarez M., Wilson W., Bates S.E., Fojo T.
      Blood 91:1749-1756(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS ALA-893 AND THR-999.
    16. "A new polymorphism (N21D) in the exon 2 of the human MDR1 gene encoding the P-glycoprotein."
      Decleves X., Chevillard S., Charpentier C., Vielh P., Laplanche J.-L.
      Hum. Mutat. 15:486-486(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT ASP-21.
    17. "Functional polymorphisms of the human multidrug-resistance gene: multiple sequence variations and correlation of one allele with P-glycoprotein expression and activity in vivo."
      Hoffmeyer S., Burk O., von Richter O., Arnold H.P., Brockmoeller J., Johne A., Cascorbi I., Gerloff T., Roots I., Eichelbaum M., Brinkmann U.
      Proc. Natl. Acad. Sci. U.S.A. 97:3473-3478(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS ASP-21; LEU-103 AND ASN-400.
    18. "Frequency of single nucleotide polymorphisms in the P-glycoprotein drug transporter MDR1 gene in white subjects."
      Cascorbi I., Gerloff T., Johne A., Meisel C., Hoffmeyer S., Schwab M., Schaeffeler E., Eichelbaum M., Brinkmann U., Roots I.
      Clin. Pharmacol. Ther. 69:169-174(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS ASP-21; ASN-400; ALA-893; THR-893 AND PRO-1107.
    19. "Polymorphism of MDR1 gene in healthy Japanese subjects: a novel SNP with an amino acid substitution (Glu108Lys)."
      Honda T., Dan Y., Koyabu N., Ieiri I., Otsubo K., Higuchi S., Ohtani H., Sawada J.
      Drug Metab. Pharmacokinet. 17:479-481(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT LYS-108.
    20. "Twelve novel single nucleotide polymorphisms in ABCB1/MDR1 among Japanese patients with ventricular tachycardia who were administered amiodarone."
      Itoda M., Saito Y., Komamura K., Ueno K., Kamakura S., Ozawa S., Sawada J.
      Drug Metab. Pharmacokinet. 17:566-571(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT ILE-1251.
    21. "Three hundred twenty-six genetic variations in genes encoding nine members of ATP-binding cassette, subfamily B (ABCB/MDR/TAP), in the Japanese population."
      Saito S., Iida A., Sekine A., Miura Y., Ogawa C., Kawauchi S., Higuchi S., Nakamura Y.
      J. Hum. Genet. 47:38-50(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS ALA-893 AND THR-893.
    22. Cited for: VARIANTS ALA-893 AND THR-893, ASSOCIATION WITH SUSCEPTIBILITY TO IBD13.
    23. Cited for: VARIANT [LARGE SCALE ANALYSIS] ASN-887.

    Entry informationi

    Entry nameiMDR1_HUMAN
    AccessioniPrimary (citable) accession number: P08183
    Secondary accession number(s): A8K294
    , B5AK60, Q12755, Q14812
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 1, 1988
    Last sequence update: May 26, 2009
    Last modified: October 1, 2014
    This is version 174 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3