Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Multidrug resistance protein 1

Gene

ABCB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Catalytic activityi

ATP + H2O + xenobiotic(In) = ADP + phosphate + xenobiotic(Out).

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi427 – 434ATP 1PROSITE-ProRule annotation8
Nucleotide bindingi1070 – 1077ATP 2PROSITE-ProRule annotation8

GO - Molecular functioni

  • ATPase activity, coupled to transmembrane movement of substances Source: ProtInc
  • ATP binding Source: ProtInc
  • ceramide-translocating ATPase activity Source: BHF-UCL
  • phosphatidylcholine-translocating ATPase activity Source: BHF-UCL
  • phosphatidylethanolamine-translocating ATPase activity Source: BHF-UCL
  • transporter activity Source: ProtInc
  • xenobiotic-transporting ATPase activity Source: Reactome

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Transport

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS01500-MONOMER.
BRENDAi3.6.3.44. 2681.
ReactomeiR-HSA-2161517. Abacavir transmembrane transport.
R-HSA-382556. ABC-family proteins mediated transport.

Protein family/group databases

MoonProtiP08183.
TCDBi3.A.1.201.1. the atp-binding cassette (abc) superfamily.

Chemistry databases

SwissLipidsiSLP:000000385.

Names & Taxonomyi

Protein namesi
Recommended name:
Multidrug resistance protein 1 (EC:3.6.3.44)
Alternative name(s):
ATP-binding cassette sub-family B member 1
P-glycoprotein 1
CD_antigen: CD243
Gene namesi
Name:ABCB1
Synonyms:MDR1, PGY1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:40. ABCB1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 44CytoplasmicBy similarityAdd BLAST44
Transmembranei45 – 67HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini68 – 116ExtracellularBy similarityAdd BLAST49
Transmembranei117 – 137HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini138 – 186CytoplasmicBy similarityAdd BLAST49
Transmembranei187 – 208HelicalPROSITE-ProRule annotationAdd BLAST22
Topological domaini209 – 215ExtracellularBy similarity7
Transmembranei216 – 236HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini237 – 292CytoplasmicBy similarityAdd BLAST56
Transmembranei293 – 316HelicalPROSITE-ProRule annotationAdd BLAST24
Topological domaini317 – 330ExtracellularBy similarityAdd BLAST14
Transmembranei331 – 352HelicalPROSITE-ProRule annotationAdd BLAST22
Topological domaini353 – 711CytoplasmicBy similarityAdd BLAST359
Transmembranei712 – 732HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini733 – 756ExtracellularBy similarityAdd BLAST24
Transmembranei757 – 777HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini778 – 832CytoplasmicBy similarityAdd BLAST55
Transmembranei833 – 853HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini854ExtracellularBy similarity1
Transmembranei855 – 874HelicalPROSITE-ProRule annotationAdd BLAST20
Topological domaini875 – 934CytoplasmicBy similarityAdd BLAST60
Transmembranei935 – 957HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini958 – 973ExtracellularBy similarityAdd BLAST16
Transmembranei974 – 995HelicalPROSITE-ProRule annotationAdd BLAST22
Topological domaini996 – 1280CytoplasmicBy similarityAdd BLAST285

GO - Cellular componenti

  • apical plasma membrane Source: BHF-UCL
  • cell surface Source: DFLAT
  • extracellular exosome Source: UniProtKB
  • integral component of membrane Source: ProtInc
  • membrane Source: ProtInc
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Inflammatory bowel disease 13 (IBD13)
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
See also OMIM:612244
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_013361893S → A Common allele; associated with susceptibility to IBD13; has decreased enzyme activity. 8 PublicationsCorresponds to variant rs2032582dbSNPEnsembl.1

Organism-specific databases

DisGeNETi5243.
MalaCardsiABCB1.
MIMi612244. phenotype.
OpenTargetsiENSG00000085563.
Orphaneti771. Ulcerative colitis.
PharmGKBiPA267.

Chemistry databases

ChEMBLiCHEMBL4302.
DrugBankiDB01193. Acebutolol.
DB00316. Acetaminophen.
DB00945. Acetylsalicylic acid.
DB00171. Adenosine triphosphate.
DB05773. ado-trastuzumab emtansine.
DB08916. Afatinib.
DB00518. Albendazole.
DB11363. Alectinib.
DB00802. Alfentanil.
DB00523. Alitretinoin.
DB00915. Amantadine.
DB06403. Ambrisentan.
DB00345. Aminohippurate.
DB01118. Amiodarone.
DB00321. Amitriptyline.
DB00381. Amlodipine.
DB00701. Amprenavir.
DB00276. Amsacrine.
DB06605. Apixaban.
DB01169. Arsenic trioxide.
DB00637. Astemizole.
DB01072. Atazanavir.
DB00335. Atenolol.
DB01076. Atorvastatin.
DB06626. Axitinib.
DB00972. Azelastine.
DB00207. Azithromycin.
DB01086. Benzocaine.
DB01244. Bepridil.
DB00443. Betamethasone.
DB00810. Biperiden.
DB08873. Boceprevir.
DB06616. Bosutinib.
DB08870. Brentuximab vedotin.
DB01200. Bromocriptine.
DB00921. Buprenorphine.
DB00490. Buspirone.
DB06772. Cabazitaxel.
DB00201. Caffeine.
DB08907. Canagliflozin.
DB00796. Candesartan.
DB01197. Captopril.
DB00564. Carbamazepine.
DB08889. Carfilzomib.
DB01136. Carvedilol.
DB00520. Caspofungin.
DB09063. Ceritinib.
DB00608. Chloroquine.
DB00477. Chlorpromazine.
DB00672. Chlorpropamide.
DB01239. Chlorprothixene.
DB02659. Cholic Acid.
DB01340. Cilazapril.
DB00501. Cimetidine.
DB00537. Ciprofloxacin.
DB00515. Cisplatin.
DB00215. Citalopram.
DB01211. Clarithromycin.
DB00349. Clobazam.
DB00845. Clofazimine.
DB00882. Clomifene.
DB01242. Clomipramine.
DB00575. Clonidine.
DB00758. Clopidogrel.
DB00257. Clotrimazole.
DB00363. Clozapine.
DB09065. Cobicistat.
DB05239. Cobimetinib.
DB01394. Colchicine.
DB00286. Conjugated Estrogens.
DB08865. Crizotinib.
DB00531. Cyclophosphamide.
DB00091. Cyclosporine.
DB06695. Dabigatran etexilate.
DB08912. Dabrafenib.
DB09102. Daclatasvir.
DB00970. Dactinomycin.
DB06292. Dapagliflozin.
DB01254. Dasatinib.
DB00694. Daunorubicin.
DB04840. Debrisoquin.
DB01151. Desipramine.
DB00967. Desloratadine.
DB01234. Dexamethasone.
DB00514. Dextromethorphan.
DB00829. Diazepam.
DB00586. Diclofenac.
DB00255. Diethylstilbestrol.
DB01396. Digitoxin.
DB00390. Digoxin.
DB00320. Dihydroergotamine.
DB00343. Diltiazem.
DB00975. Dipyridamole.
DB01248. Docetaxel.
DB01184. Domperidone.
DB00590. Doxazosin.
DB01142. Doxepin.
DB00997. Doxorubicin.
DB00470. Dronabinol.
DB04855. Dronedarone.
DB09075. Edoxaban.
DB00216. Eletriptan.
DB00584. Enalapril.
DB08899. Enzalutamide.
DB00751. Epinastine.
DB01253. Ergonovine.
DB00696. Ergotamine.
DB00530. Erlotinib.
DB00199. Erythromycin.
DB00783. Estradiol.
DB01196. Estramustine.
DB04573. Estriol.
DB00655. Estrone.
DB00977. Ethinyl Estradiol.
DB00773. Etoposide.
DB06414. Etravirine.
DB00973. Ezetimibe.
DB01023. Felodipine.
DB00813. Fentanyl.
DB06702. Fesoterodine.
DB00950. Fexofenadine.
DB08874. Fidaxomicin.
DB00196. Fluconazole.
DB00472. Fluoxetine.
DB00875. Flupentixol.
DB00623. Fluphenazine.
DB00690. Flurazepam.
DB08906. Fluticasone furoate.
DB00176. Fluvoxamine.
DB00317. Gefitinib.
DB00441. Gemcitabine.
DB01016. Glyburide.
DB00027. Gramicidin D.
DB00502. Haloperidol.
DB00741. Hydrocortisone.
DB01050. Ibuprofen.
DB09054. Idelalisib.
DB00619. Imatinib.
DB00458. Imipramine.
DB05039. Indacaterol.
DB00224. Indinavir.
DB00328. Indomethacin.
DB00762. Irinotecan.
DB06636. Isavuconazonium.
DB01167. Itraconazole.
DB08820. Ivacaftor.
DB00602. Ivermectin.
DB01221. Ketamine.
DB01587. Ketazolam.
DB01026. Ketoconazole.
DB00709. Lamivudine.
DB00555. Lamotrigine.
DB00448. Lansoprazole.
DB01259. Lapatinib.
DB00480. Lenalidomide.
DB09078. Lenvatinib.
DB01202. Levetiracetam.
DB01137. Levofloxacin.
DB08918. Levomilnacipran.
DB00451. Levothyroxine.
DB00281. Lidocaine.
DB08882. Linagliptin.
DB00279. Liothyronine.
DB01583. Liotrix.
DB00722. Lisinopril.
DB08827. Lomitapide.
DB00836. Loperamide.
DB01601. Lopinavir.
DB00455. Loratadine.
DB00678. Losartan.
DB00227. Lovastatin.
DB00742. Mannitol.
DB00934. Maprotiline.
DB00643. Mebendazole.
DB00358. Mefloquine.
DB00351. Megestrol acetate.
DB00371. Meprobamate.
DB00333. Methadone.
DB00563. Methotrexate.
DB00959. Methylprednisolone.
DB00264. Metoprolol.
DB01110. Miconazole.
DB00683. Midazolam.
DB00834. Mifepristone.
DB08893. Mirabegron.
DB00305. Mitomycin.
DB01204. Mitoxantrone.
DB00295. Morphine.
DB00688. Mycophenolate mofetil.
DB01203. Nadolol.
DB01183. Naloxone.
DB00704. Naltrexone.
DB01149. Nefazodone.
DB00220. Nelfinavir.
DB01400. Neostigmine.
DB00622. Nicardipine.
DB01115. Nifedipine.
DB04868. Nilotinib.
DB09079. Nintedanib.
DB00401. Nisoldipine.
DB01595. Nitrazepam.
DB01054. Nitrendipine.
DB00585. Nizatidine.
DB00717. Norethisterone.
DB00334. Olanzapine.
DB00338. Omeprazole.
DB09330. Osimertinib.
DB01229. Paclitaxel.
DB06603. Panobinostat.
DB00213. Pantoprazole.
DB00715. Paroxetine.
DB06589. Pazopanib.
DB00790. Perindopril.
DB01174. Phenobarbital.
DB00252. Phenytoin.
DB01100. Pimozide.
DB08860. Pitavastatin.
DB08910. Pomalidomide.
DB08901. Ponatinib.
DB01263. Posaconazole.
DB00175. Pravastatin.
DB00457. Prazosin.
DB00860. Prednisolone.
DB00635. Prednisone.
DB01032. Probenecid.
DB00396. Progesterone.
DB01069. Promethazine.
DB01182. Propafenone.
DB00571. Propranolol.
DB00344. Protriptyline.
DB01224. Quetiapine.
DB01103. Quinacrine.
DB00908. Quinidine.
DB00468. Quinine.
DB00863. Ranitidine.
DB00234. Reboxetine.
DB08896. Regorafenib.
DB00206. Reserpine.
DB01045. Rifampicin.
DB08864. Rilpivirine.
DB00734. Risperidone.
DB00503. Ritonavir.
DB06228. Rivaroxaban.
DB09291. Rolapitant.
DB06176. Romidepsin.
DB00778. Roxithromycin.
DB00936. Salicylic acid.
DB01232. Saquinavir.
DB00747. Scopolamine.
DB01037. Selegiline.
DB11362. Selexipag.
DB01104. Sertraline.
DB06207. Silodosin.
DB06290. Simeprevir.
DB00641. Simvastatin.
DB00877. Sirolimus.
DB01261. Sitagliptin.
DB08934. Sofosbuvir.
DB00398. Sorafenib.
DB01208. Sparfloxacin.
DB00421. Spironolactone.
DB00428. Streptozocin.
DB01138. Sulfinpyrazone.
DB00669. Sumatriptan.
DB01268. Sunitinib.
DB00864. Tacrolimus.
DB00675. Tamoxifen.
DB05521. Telaprevir.
DB00966. Telmisartan.
DB06287. Temsirolimus.
DB01162. Terazosin.
DB00624. Testosterone.
DB08816. Ticagrelor.
DB00373. Timolol.
DB06212. Tolvaptan.
DB01030. Topotecan.
DB00539. Toremifene.
DB00656. Trazodone.
DB00831. Trifluoperazine.
DB00508. Triflupromazine.
DB00440. Trimethoprim.
DB00726. Trimipramine.
DB01361. Troleandomycin.
DB08867. Ulipristal.
DB09076. Umeclidinium.
DB01339. Vecuronium.
DB00285. Venlafaxine.
DB00661. Verapamil.
DB00570. Vinblastine.
DB00541. Vincristine.
DB00361. Vinorelbine.
DB08828. Vismodegib.
DB04877. Voacamine.
DB00495. Zidovudine.

Polymorphism and mutation databases

BioMutaiABCB1.
DMDMi238054374.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000933321 – 1280Multidrug resistance protein 1Add BLAST1280

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi91N-linked (GlcNAc...)Sequence analysis1
Glycosylationi94N-linked (GlcNAc...)Sequence analysis1
Glycosylationi99N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiP08183.
MaxQBiP08183.
PaxDbiP08183.
PeptideAtlasiP08183.
PRIDEiP08183.

PTM databases

iPTMnetiP08183.
PhosphoSitePlusiP08183.

Expressioni

Tissue specificityi

Expressed in liver, kidney, small intestine and brain.

Gene expression databases

BgeeiENSG00000085563.
CleanExiHS_ABCB1.
ExpressionAtlasiP08183. baseline and differential.
GenevisibleiP08183. HS.

Organism-specific databases

HPAiCAB001716.
HPA002199.

Interactioni

Subunit structurei

Interacts with PSMB5. Finds in a complex with ABCB1, TFPI2 and PPP2R3C; leading to the dephosphorylation of ABCB1.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
LAPTM4BQ86VI42EBI-1057359,EBI-3267258
RNF2Q994962EBI-1057359,EBI-722416

Protein-protein interaction databases

BioGridi111262. 14 interactors.
IntActiP08183. 6 interactors.
MINTiMINT-5000901.
STRINGi9606.ENSP00000265724.

Chemistry databases

BindingDBiP08183.

Structurei

3D structure databases

ProteinModelPortaliP08183.
SMRiP08183.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini51 – 357ABC transmembrane type-1 1PROSITE-ProRule annotationAdd BLAST307
Domaini392 – 628ABC transporter 1PROSITE-ProRule annotationAdd BLAST237
Domaini711 – 1000ABC transmembrane type-1 2PROSITE-ProRule annotationAdd BLAST290
Domaini1035 – 1273ABC transporter 2PROSITE-ProRule annotationAdd BLAST239

Sequence similaritiesi

Contains 2 ABC transmembrane type-1 domains.PROSITE-ProRule annotation
Contains 2 ABC transporter domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0055. Eukaryota.
COG1132. LUCA.
GeneTreeiENSGT00530000062896.
HOVERGENiHBG080809.
InParanoidiP08183.
KOiK05658.
OMAiSQGQDRK.
OrthoDBiEOG091G0HVA.
PhylomeDBiP08183.
TreeFamiTF105193.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR011527. ABC1_TM_dom.
IPR003439. ABC_transporter-like.
IPR017871. ABC_transporter_CS.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00664. ABC_membrane. 2 hits.
PF00005. ABC_tran. 2 hits.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
SSF90123. SSF90123. 2 hits.
PROSITEiPS50929. ABC_TM1F. 2 hits.
PS00211. ABC_TRANSPORTER_1. 2 hits.
PS50893. ABC_TRANSPORTER_2. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P08183-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLEGDRNGG AKKKNFFKLN NKSEKDKKEK KPTVSVFSMF RYSNWLDKLY
60 70 80 90 100
MVVGTLAAII HGAGLPLMML VFGEMTDIFA NAGNLEDLMS NITNRSDIND
110 120 130 140 150
TGFFMNLEED MTRYAYYYSG IGAGVLVAAY IQVSFWCLAA GRQIHKIRKQ
160 170 180 190 200
FFHAIMRQEI GWFDVHDVGE LNTRLTDDVS KINEGIGDKI GMFFQSMATF
210 220 230 240 250
FTGFIVGFTR GWKLTLVILA ISPVLGLSAA VWAKILSSFT DKELLAYAKA
260 270 280 290 300
GAVAEEVLAA IRTVIAFGGQ KKELERYNKN LEEAKRIGIK KAITANISIG
310 320 330 340 350
AAFLLIYASY ALAFWYGTTL VLSGEYSIGQ VLTVFFSVLI GAFSVGQASP
360 370 380 390 400
SIEAFANARG AAYEIFKIID NKPSIDSYSK SGHKPDNIKG NLEFRNVHFS
410 420 430 440 450
YPSRKEVKIL KGLNLKVQSG QTVALVGNSG CGKSTTVQLM QRLYDPTEGM
460 470 480 490 500
VSVDGQDIRT INVRFLREII GVVSQEPVLF ATTIAENIRY GRENVTMDEI
510 520 530 540 550
EKAVKEANAY DFIMKLPHKF DTLVGERGAQ LSGGQKQRIA IARALVRNPK
560 570 580 590 600
ILLLDEATSA LDTESEAVVQ VALDKARKGR TTIVIAHRLS TVRNADVIAG
610 620 630 640 650
FDDGVIVEKG NHDELMKEKG IYFKLVTMQT AGNEVELENA ADESKSEIDA
660 670 680 690 700
LEMSSNDSRS SLIRKRSTRR SVRGSQAQDR KLSTKEALDE SIPPVSFWRI
710 720 730 740 750
MKLNLTEWPY FVVGVFCAII NGGLQPAFAI IFSKIIGVFT RIDDPETKRQ
760 770 780 790 800
NSNLFSLLFL ALGIISFITF FLQGFTFGKA GEILTKRLRY MVFRSMLRQD
810 820 830 840 850
VSWFDDPKNT TGALTTRLAN DAAQVKGAIG SRLAVITQNI ANLGTGIIIS
860 870 880 890 900
FIYGWQLTLL LLAIVPIIAI AGVVEMKMLS GQALKDKKEL EGSGKIATEA
910 920 930 940 950
IENFRTVVSL TQEQKFEHMY AQSLQVPYRN SLRKAHIFGI TFSFTQAMMY
960 970 980 990 1000
FSYAGCFRFG AYLVAHKLMS FEDVLLVFSA VVFGAMAVGQ VSSFAPDYAK
1010 1020 1030 1040 1050
AKISAAHIIM IIEKTPLIDS YSTEGLMPNT LEGNVTFGEV VFNYPTRPDI
1060 1070 1080 1090 1100
PVLQGLSLEV KKGQTLALVG SSGCGKSTVV QLLERFYDPL AGKVLLDGKE
1110 1120 1130 1140 1150
IKRLNVQWLR AHLGIVSQEP ILFDCSIAEN IAYGDNSRVV SQEEIVRAAK
1160 1170 1180 1190 1200
EANIHAFIES LPNKYSTKVG DKGTQLSGGQ KQRIAIARAL VRQPHILLLD
1210 1220 1230 1240 1250
EATSALDTES EKVVQEALDK AREGRTCIVI AHRLSTIQNA DLIVVFQNGR
1260 1270 1280
VKEHGTHQQL LAQKGIYFSM VSVQAGTKRQ
Length:1,280
Mass (Da):141,479
Last modified:May 26, 2009 - v3
Checksum:iF0230744AB288C73
GO
Isoform 2 (identifier: P08183-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-177: RYAYYYSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTD → S

Show »
Length:1,216
Mass (Da):134,032
Checksum:i227233F5F2259A8C
GO

Sequence cautioni

The sequence AAM49149 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti23S → R in CAA41558 (PubMed:2568832).Curated1
Sequence conflicti336Missing in AAB69423 (PubMed:9038218).Curated1

Polymorphismi

Genetic variation in ABCB1 may play a role in patients who do not respond to drug treatment.3 Publications

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02227617F → L.1 PublicationCorresponds to variant rs28381804dbSNPEnsembl.1
Natural variantiVAR_01470421N → D.5 PublicationsCorresponds to variant rs9282564dbSNPEnsembl.1
Natural variantiVAR_05542344N → S.Corresponds to variant rs1202183dbSNPEnsembl.1
Natural variantiVAR_05542480A → E.Corresponds to variant rs9282565dbSNPEnsembl.1
Natural variantiVAR_015001103F → L Rare polymorphism. 1 Publication1
Natural variantiVAR_018351108E → K.1 Publication1
Natural variantiVAR_015002185G → V in a colchicine-selected multidrug-resistant cell line; confers increased resistance to colchicine. 3 PublicationsCorresponds to variant rs1128501dbSNPEnsembl.1
Natural variantiVAR_055425261I → V.Corresponds to variant rs36008564dbSNPEnsembl.1
Natural variantiVAR_015003400S → N.3 PublicationsCorresponds to variant rs2229109dbSNPEnsembl.1
Natural variantiVAR_022277566E → K.1 PublicationCorresponds to variant rs28381902dbSNPEnsembl.1
Natural variantiVAR_022278593R → C.1 PublicationCorresponds to variant rs28381914dbSNPEnsembl.1
Natural variantiVAR_055426599A → T.Corresponds to variant rs2235036dbSNPEnsembl.1
Natural variantiVAR_055427669R → C.Corresponds to variant rs35023033dbSNPEnsembl.1
Natural variantiVAR_055428801V → M.Corresponds to variant rs2235039dbSNPEnsembl.1
Natural variantiVAR_055429829I → V.Corresponds to variant rs2032581dbSNPEnsembl.1
Natural variantiVAR_022279836I → V.1 PublicationCorresponds to variant rs28381967dbSNPEnsembl.1
Natural variantiVAR_035737887K → N in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_013361893S → A Common allele; associated with susceptibility to IBD13; has decreased enzyme activity. 8 PublicationsCorresponds to variant rs2032582dbSNPEnsembl.1
Natural variantiVAR_013362893S → T Rare allele. 3 PublicationsCorresponds to variant rs2032582dbSNPEnsembl.1
Natural variantiVAR_018352986M → V.1
Natural variantiVAR_015004999A → T.1 PublicationCorresponds to variant rs72552784dbSNPEnsembl.1
Natural variantiVAR_0222801051P → A.1 PublicationCorresponds to variant rs28401798dbSNPEnsembl.1
Natural variantiVAR_0150051107Q → P.1 PublicationCorresponds to variant rs55852620dbSNPEnsembl.1
Natural variantiVAR_0222811141S → T.1 PublicationCorresponds to variant rs2229107dbSNPEnsembl.1
Natural variantiVAR_0183531251V → I.2 PublicationsCorresponds to variant rs28364274dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055769113 – 177RYAYY…TRLTD → S in isoform 2. 1 PublicationAdd BLAST65

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M14758 mRNA. Translation: AAA59575.1.
M29447
, M29424, M29425, M29426, M29427, M29428, M29429, M29430, M29431, M29432, M29433, M29434, M29435, M29436, M29437, M29438, M29439, M29440, M29441, M29442, M29443, M29444, M29445, M29446 Genomic DNA. Translation: AAA59576.1.
AF016535 mRNA. Translation: AAB69423.1.
EU854148 mRNA. Translation: ACF94688.1.
AY910577 Genomic DNA. Translation: AAW82430.1.
AK290159 mRNA. Translation: BAF82848.1.
AC002457 Genomic DNA. Translation: AAM49149.1. Sequence problems.
AC005068 Genomic DNA. No translation available.
M37724 Genomic DNA. Translation: AAA88047.1.
M37725 Genomic DNA. Translation: AAA88048.1.
X58723 Genomic DNA. Translation: CAA41558.1.
CCDSiCCDS5608.1. [P08183-1]
PIRiA34914. DVHU1.
RefSeqiNP_000918.2. NM_000927.4. [P08183-1]
UniGeneiHs.489033.
Hs.689936.
Hs.737655.

Genome annotation databases

EnsembliENST00000265724; ENSP00000265724; ENSG00000085563. [P08183-1]
ENST00000543898; ENSP00000444095; ENSG00000085563. [P08183-2]
ENST00000622132; ENSP00000478255; ENSG00000085563. [P08183-1]
GeneIDi5243.
KEGGihsa:5243.
UCSCiuc003uiz.3. human. [P08183-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
NIEHS-SNPs
SHMPD

The Singapore human mutation and polymorphism database

Wikipedia

P-glycoprotein entry

ABCMdb

Database for mutations in ABC proteins

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M14758 mRNA. Translation: AAA59575.1.
M29447
, M29424, M29425, M29426, M29427, M29428, M29429, M29430, M29431, M29432, M29433, M29434, M29435, M29436, M29437, M29438, M29439, M29440, M29441, M29442, M29443, M29444, M29445, M29446 Genomic DNA. Translation: AAA59576.1.
AF016535 mRNA. Translation: AAB69423.1.
EU854148 mRNA. Translation: ACF94688.1.
AY910577 Genomic DNA. Translation: AAW82430.1.
AK290159 mRNA. Translation: BAF82848.1.
AC002457 Genomic DNA. Translation: AAM49149.1. Sequence problems.
AC005068 Genomic DNA. No translation available.
M37724 Genomic DNA. Translation: AAA88047.1.
M37725 Genomic DNA. Translation: AAA88048.1.
X58723 Genomic DNA. Translation: CAA41558.1.
CCDSiCCDS5608.1. [P08183-1]
PIRiA34914. DVHU1.
RefSeqiNP_000918.2. NM_000927.4. [P08183-1]
UniGeneiHs.489033.
Hs.689936.
Hs.737655.

3D structure databases

ProteinModelPortaliP08183.
SMRiP08183.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111262. 14 interactors.
IntActiP08183. 6 interactors.
MINTiMINT-5000901.
STRINGi9606.ENSP00000265724.

Chemistry databases

BindingDBiP08183.
ChEMBLiCHEMBL4302.
DrugBankiDB01193. Acebutolol.
DB00316. Acetaminophen.
DB00945. Acetylsalicylic acid.
DB00171. Adenosine triphosphate.
DB05773. ado-trastuzumab emtansine.
DB08916. Afatinib.
DB00518. Albendazole.
DB11363. Alectinib.
DB00802. Alfentanil.
DB00523. Alitretinoin.
DB00915. Amantadine.
DB06403. Ambrisentan.
DB00345. Aminohippurate.
DB01118. Amiodarone.
DB00321. Amitriptyline.
DB00381. Amlodipine.
DB00701. Amprenavir.
DB00276. Amsacrine.
DB06605. Apixaban.
DB01169. Arsenic trioxide.
DB00637. Astemizole.
DB01072. Atazanavir.
DB00335. Atenolol.
DB01076. Atorvastatin.
DB06626. Axitinib.
DB00972. Azelastine.
DB00207. Azithromycin.
DB01086. Benzocaine.
DB01244. Bepridil.
DB00443. Betamethasone.
DB00810. Biperiden.
DB08873. Boceprevir.
DB06616. Bosutinib.
DB08870. Brentuximab vedotin.
DB01200. Bromocriptine.
DB00921. Buprenorphine.
DB00490. Buspirone.
DB06772. Cabazitaxel.
DB00201. Caffeine.
DB08907. Canagliflozin.
DB00796. Candesartan.
DB01197. Captopril.
DB00564. Carbamazepine.
DB08889. Carfilzomib.
DB01136. Carvedilol.
DB00520. Caspofungin.
DB09063. Ceritinib.
DB00608. Chloroquine.
DB00477. Chlorpromazine.
DB00672. Chlorpropamide.
DB01239. Chlorprothixene.
DB02659. Cholic Acid.
DB01340. Cilazapril.
DB00501. Cimetidine.
DB00537. Ciprofloxacin.
DB00515. Cisplatin.
DB00215. Citalopram.
DB01211. Clarithromycin.
DB00349. Clobazam.
DB00845. Clofazimine.
DB00882. Clomifene.
DB01242. Clomipramine.
DB00575. Clonidine.
DB00758. Clopidogrel.
DB00257. Clotrimazole.
DB00363. Clozapine.
DB09065. Cobicistat.
DB05239. Cobimetinib.
DB01394. Colchicine.
DB00286. Conjugated Estrogens.
DB08865. Crizotinib.
DB00531. Cyclophosphamide.
DB00091. Cyclosporine.
DB06695. Dabigatran etexilate.
DB08912. Dabrafenib.
DB09102. Daclatasvir.
DB00970. Dactinomycin.
DB06292. Dapagliflozin.
DB01254. Dasatinib.
DB00694. Daunorubicin.
DB04840. Debrisoquin.
DB01151. Desipramine.
DB00967. Desloratadine.
DB01234. Dexamethasone.
DB00514. Dextromethorphan.
DB00829. Diazepam.
DB00586. Diclofenac.
DB00255. Diethylstilbestrol.
DB01396. Digitoxin.
DB00390. Digoxin.
DB00320. Dihydroergotamine.
DB00343. Diltiazem.
DB00975. Dipyridamole.
DB01248. Docetaxel.
DB01184. Domperidone.
DB00590. Doxazosin.
DB01142. Doxepin.
DB00997. Doxorubicin.
DB00470. Dronabinol.
DB04855. Dronedarone.
DB09075. Edoxaban.
DB00216. Eletriptan.
DB00584. Enalapril.
DB08899. Enzalutamide.
DB00751. Epinastine.
DB01253. Ergonovine.
DB00696. Ergotamine.
DB00530. Erlotinib.
DB00199. Erythromycin.
DB00783. Estradiol.
DB01196. Estramustine.
DB04573. Estriol.
DB00655. Estrone.
DB00977. Ethinyl Estradiol.
DB00773. Etoposide.
DB06414. Etravirine.
DB00973. Ezetimibe.
DB01023. Felodipine.
DB00813. Fentanyl.
DB06702. Fesoterodine.
DB00950. Fexofenadine.
DB08874. Fidaxomicin.
DB00196. Fluconazole.
DB00472. Fluoxetine.
DB00875. Flupentixol.
DB00623. Fluphenazine.
DB00690. Flurazepam.
DB08906. Fluticasone furoate.
DB00176. Fluvoxamine.
DB00317. Gefitinib.
DB00441. Gemcitabine.
DB01016. Glyburide.
DB00027. Gramicidin D.
DB00502. Haloperidol.
DB00741. Hydrocortisone.
DB01050. Ibuprofen.
DB09054. Idelalisib.
DB00619. Imatinib.
DB00458. Imipramine.
DB05039. Indacaterol.
DB00224. Indinavir.
DB00328. Indomethacin.
DB00762. Irinotecan.
DB06636. Isavuconazonium.
DB01167. Itraconazole.
DB08820. Ivacaftor.
DB00602. Ivermectin.
DB01221. Ketamine.
DB01587. Ketazolam.
DB01026. Ketoconazole.
DB00709. Lamivudine.
DB00555. Lamotrigine.
DB00448. Lansoprazole.
DB01259. Lapatinib.
DB00480. Lenalidomide.
DB09078. Lenvatinib.
DB01202. Levetiracetam.
DB01137. Levofloxacin.
DB08918. Levomilnacipran.
DB00451. Levothyroxine.
DB00281. Lidocaine.
DB08882. Linagliptin.
DB00279. Liothyronine.
DB01583. Liotrix.
DB00722. Lisinopril.
DB08827. Lomitapide.
DB00836. Loperamide.
DB01601. Lopinavir.
DB00455. Loratadine.
DB00678. Losartan.
DB00227. Lovastatin.
DB00742. Mannitol.
DB00934. Maprotiline.
DB00643. Mebendazole.
DB00358. Mefloquine.
DB00351. Megestrol acetate.
DB00371. Meprobamate.
DB00333. Methadone.
DB00563. Methotrexate.
DB00959. Methylprednisolone.
DB00264. Metoprolol.
DB01110. Miconazole.
DB00683. Midazolam.
DB00834. Mifepristone.
DB08893. Mirabegron.
DB00305. Mitomycin.
DB01204. Mitoxantrone.
DB00295. Morphine.
DB00688. Mycophenolate mofetil.
DB01203. Nadolol.
DB01183. Naloxone.
DB00704. Naltrexone.
DB01149. Nefazodone.
DB00220. Nelfinavir.
DB01400. Neostigmine.
DB00622. Nicardipine.
DB01115. Nifedipine.
DB04868. Nilotinib.
DB09079. Nintedanib.
DB00401. Nisoldipine.
DB01595. Nitrazepam.
DB01054. Nitrendipine.
DB00585. Nizatidine.
DB00717. Norethisterone.
DB00334. Olanzapine.
DB00338. Omeprazole.
DB09330. Osimertinib.
DB01229. Paclitaxel.
DB06603. Panobinostat.
DB00213. Pantoprazole.
DB00715. Paroxetine.
DB06589. Pazopanib.
DB00790. Perindopril.
DB01174. Phenobarbital.
DB00252. Phenytoin.
DB01100. Pimozide.
DB08860. Pitavastatin.
DB08910. Pomalidomide.
DB08901. Ponatinib.
DB01263. Posaconazole.
DB00175. Pravastatin.
DB00457. Prazosin.
DB00860. Prednisolone.
DB00635. Prednisone.
DB01032. Probenecid.
DB00396. Progesterone.
DB01069. Promethazine.
DB01182. Propafenone.
DB00571. Propranolol.
DB00344. Protriptyline.
DB01224. Quetiapine.
DB01103. Quinacrine.
DB00908. Quinidine.
DB00468. Quinine.
DB00863. Ranitidine.
DB00234. Reboxetine.
DB08896. Regorafenib.
DB00206. Reserpine.
DB01045. Rifampicin.
DB08864. Rilpivirine.
DB00734. Risperidone.
DB00503. Ritonavir.
DB06228. Rivaroxaban.
DB09291. Rolapitant.
DB06176. Romidepsin.
DB00778. Roxithromycin.
DB00936. Salicylic acid.
DB01232. Saquinavir.
DB00747. Scopolamine.
DB01037. Selegiline.
DB11362. Selexipag.
DB01104. Sertraline.
DB06207. Silodosin.
DB06290. Simeprevir.
DB00641. Simvastatin.
DB00877. Sirolimus.
DB01261. Sitagliptin.
DB08934. Sofosbuvir.
DB00398. Sorafenib.
DB01208. Sparfloxacin.
DB00421. Spironolactone.
DB00428. Streptozocin.
DB01138. Sulfinpyrazone.
DB00669. Sumatriptan.
DB01268. Sunitinib.
DB00864. Tacrolimus.
DB00675. Tamoxifen.
DB05521. Telaprevir.
DB00966. Telmisartan.
DB06287. Temsirolimus.
DB01162. Terazosin.
DB00624. Testosterone.
DB08816. Ticagrelor.
DB00373. Timolol.
DB06212. Tolvaptan.
DB01030. Topotecan.
DB00539. Toremifene.
DB00656. Trazodone.
DB00831. Trifluoperazine.
DB00508. Triflupromazine.
DB00440. Trimethoprim.
DB00726. Trimipramine.
DB01361. Troleandomycin.
DB08867. Ulipristal.
DB09076. Umeclidinium.
DB01339. Vecuronium.
DB00285. Venlafaxine.
DB00661. Verapamil.
DB00570. Vinblastine.
DB00541. Vincristine.
DB00361. Vinorelbine.
DB08828. Vismodegib.
DB04877. Voacamine.
DB00495. Zidovudine.
SwissLipidsiSLP:000000385.

Protein family/group databases

MoonProtiP08183.
TCDBi3.A.1.201.1. the atp-binding cassette (abc) superfamily.

PTM databases

iPTMnetiP08183.
PhosphoSitePlusiP08183.

Polymorphism and mutation databases

BioMutaiABCB1.
DMDMi238054374.

Proteomic databases

EPDiP08183.
MaxQBiP08183.
PaxDbiP08183.
PeptideAtlasiP08183.
PRIDEiP08183.

Protocols and materials databases

DNASUi5243.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265724; ENSP00000265724; ENSG00000085563. [P08183-1]
ENST00000543898; ENSP00000444095; ENSG00000085563. [P08183-2]
ENST00000622132; ENSP00000478255; ENSG00000085563. [P08183-1]
GeneIDi5243.
KEGGihsa:5243.
UCSCiuc003uiz.3. human. [P08183-1]

Organism-specific databases

CTDi5243.
DisGeNETi5243.
GeneCardsiABCB1.
H-InvDBHIX0033521.
HGNCiHGNC:40. ABCB1.
HPAiCAB001716.
HPA002199.
MalaCardsiABCB1.
MIMi171050. gene.
612244. phenotype.
neXtProtiNX_P08183.
OpenTargetsiENSG00000085563.
Orphaneti771. Ulcerative colitis.
PharmGKBiPA267.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0055. Eukaryota.
COG1132. LUCA.
GeneTreeiENSGT00530000062896.
HOVERGENiHBG080809.
InParanoidiP08183.
KOiK05658.
OMAiSQGQDRK.
OrthoDBiEOG091G0HVA.
PhylomeDBiP08183.
TreeFamiTF105193.

Enzyme and pathway databases

BioCyciZFISH:HS01500-MONOMER.
BRENDAi3.6.3.44. 2681.
ReactomeiR-HSA-2161517. Abacavir transmembrane transport.
R-HSA-382556. ABC-family proteins mediated transport.

Miscellaneous databases

ChiTaRSiABCB1. human.
GeneWikiiP-glycoprotein.
GenomeRNAii5243.
PROiP08183.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000085563.
CleanExiHS_ABCB1.
ExpressionAtlasiP08183. baseline and differential.
GenevisibleiP08183. HS.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR011527. ABC1_TM_dom.
IPR003439. ABC_transporter-like.
IPR017871. ABC_transporter_CS.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00664. ABC_membrane. 2 hits.
PF00005. ABC_tran. 2 hits.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
SSF90123. SSF90123. 2 hits.
PROSITEiPS50929. ABC_TM1F. 2 hits.
PS00211. ABC_TRANSPORTER_1. 2 hits.
PS50893. ABC_TRANSPORTER_2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMDR1_HUMAN
AccessioniPrimary (citable) accession number: P08183
Secondary accession number(s): A8K294
, B5AK60, Q12755, Q14812
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1988
Last sequence update: May 26, 2009
Last modified: November 2, 2016
This is version 198 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.