Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P08183

- MDR1_HUMAN

UniProt

P08183 - MDR1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Multidrug resistance protein 1

Gene

ABCB1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Catalytic activityi

ATP + H2O + xenobiotic(In) = ADP + phosphate + xenobiotic(Out).

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi427 – 4348ATP 1PROSITE-ProRule annotation
Nucleotide bindingi1070 – 10778ATP 2PROSITE-ProRule annotation

GO - Molecular functioni

  1. ATPase activity, coupled to transmembrane movement of substances Source: RefGenome
  2. ATP binding Source: ProtInc
  3. transporter activity Source: ProtInc
  4. xenobiotic-transporting ATPase activity Source: UniProtKB-EC

GO - Biological processi

  1. drug transmembrane transport Source: Reactome
  2. G2/M transition of mitotic cell cycle Source: DFLAT
  3. response to drug Source: ProtInc
  4. small molecule metabolic process Source: Reactome
  5. stem cell proliferation Source: DFLAT
  6. transmembrane transport Source: RefGenome
  7. transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Transport

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_120801. Abacavir transmembrane transport.
REACT_15480. ABC-family proteins mediated transport.

Protein family/group databases

TCDBi3.A.1.201.1. the atp-binding cassette (abc) superfamily.

Names & Taxonomyi

Protein namesi
Recommended name:
Multidrug resistance protein 1 (EC:3.6.3.44)
Alternative name(s):
ATP-binding cassette sub-family B member 1
P-glycoprotein 1
CD_antigen: CD243
Gene namesi
Name:ABCB1
Synonyms:MDR1, PGY1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:40. ABCB1.

Subcellular locationi

Cell membrane By similarity; Multi-pass membrane protein PROSITE-ProRule annotation

GO - Cellular componenti

  1. cell surface Source: DFLAT
  2. extracellular vesicular exosome Source: UniProtKB
  3. integral component of membrane Source: RefGenome
  4. membrane Source: ProtInc
  5. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Inflammatory bowel disease 13 (IBD13) [MIM:612244]: A chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti893 – 8931S → A Common allele; associated with susceptibility to IBD13; has decreased enzyme activity. 8 Publications
Corresponds to variant rs2032582 [ dbSNP | Ensembl ].
VAR_013361

Organism-specific databases

MIMi612244. phenotype.
Orphaneti771. Ulcerative colitis.
PharmGKBiPA267.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12801280Multidrug resistance protein 1PRO_0000093332Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi91 – 911N-linked (GlcNAc...)Sequence Analysis
Glycosylationi94 – 941N-linked (GlcNAc...)Sequence Analysis
Glycosylationi99 – 991N-linked (GlcNAc...)Sequence Analysis
Modified residuei660 – 6601PhosphoserineBy similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP08183.
PaxDbiP08183.
PRIDEiP08183.

PTM databases

PhosphoSiteiP08183.

Expressioni

Tissue specificityi

Expressed in liver, kidney, small intestine and brain.

Gene expression databases

BgeeiP08183.
CleanExiHS_ABCB1.
ExpressionAtlasiP08183. baseline and differential.
GenevestigatoriP08183.

Organism-specific databases

HPAiCAB001716.
HPA002199.

Interactioni

Subunit structurei

Interacts with PSMB5. Finds in a complex with ABCB1, TFPI2 and PPP2R3C; leading to the dephosphorylation of ABCB1.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
LAPTM4BQ86VI42EBI-1057359,EBI-3267258
RNF2Q994962EBI-1057359,EBI-722416

Protein-protein interaction databases

BioGridi111262. 11 interactions.
IntActiP08183. 6 interactions.
MINTiMINT-5000901.
STRINGi9606.ENSP00000265724.

Structurei

3D structure databases

ProteinModelPortaliP08183.
SMRiP08183. Positions 32-630.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4444CytoplasmicBy similarityAdd
BLAST
Topological domaini68 – 11649ExtracellularBy similarityAdd
BLAST
Topological domaini138 – 18649CytoplasmicBy similarityAdd
BLAST
Topological domaini209 – 2157ExtracellularBy similarity
Topological domaini237 – 29256CytoplasmicBy similarityAdd
BLAST
Topological domaini317 – 33014ExtracellularBy similarityAdd
BLAST
Topological domaini353 – 711359CytoplasmicBy similarityAdd
BLAST
Topological domaini733 – 75624ExtracellularBy similarityAdd
BLAST
Topological domaini778 – 83255CytoplasmicBy similarityAdd
BLAST
Topological domaini854 – 8541ExtracellularBy similarity
Topological domaini875 – 93460CytoplasmicBy similarityAdd
BLAST
Topological domaini958 – 97316ExtracellularBy similarityAdd
BLAST
Topological domaini996 – 1280285CytoplasmicBy similarityAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei45 – 6723HelicalPROSITE-ProRule annotationAdd
BLAST
Transmembranei117 – 13721HelicalPROSITE-ProRule annotationAdd
BLAST
Transmembranei187 – 20822HelicalPROSITE-ProRule annotationAdd
BLAST
Transmembranei216 – 23621HelicalPROSITE-ProRule annotationAdd
BLAST
Transmembranei293 – 31624HelicalPROSITE-ProRule annotationAdd
BLAST
Transmembranei331 – 35222HelicalPROSITE-ProRule annotationAdd
BLAST
Transmembranei712 – 73221HelicalPROSITE-ProRule annotationAdd
BLAST
Transmembranei757 – 77721HelicalPROSITE-ProRule annotationAdd
BLAST
Transmembranei833 – 85321HelicalPROSITE-ProRule annotationAdd
BLAST
Transmembranei855 – 87420HelicalPROSITE-ProRule annotationAdd
BLAST
Transmembranei935 – 95723HelicalPROSITE-ProRule annotationAdd
BLAST
Transmembranei974 – 99522HelicalPROSITE-ProRule annotationAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini51 – 357307ABC transmembrane type-1 1PROSITE-ProRule annotationAdd
BLAST
Domaini392 – 628237ABC transporter 1PROSITE-ProRule annotationAdd
BLAST
Domaini711 – 1000290ABC transmembrane type-1 2PROSITE-ProRule annotationAdd
BLAST
Domaini1035 – 1273239ABC transporter 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 ABC transmembrane type-1 domains.PROSITE-ProRule annotation
Contains 2 ABC transporter domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1132.
GeneTreeiENSGT00530000062896.
HOVERGENiHBG080809.
InParanoidiP08183.
KOiK05658.
OMAiITQNVAN.
OrthoDBiEOG7Z3F4H.
PhylomeDBiP08183.
TreeFamiTF105193.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR011527. ABC1_TM_dom.
IPR003439. ABC_transporter-like.
IPR017871. ABC_transporter_CS.
IPR001140. ABC_transptr_TM_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00664. ABC_membrane. 2 hits.
PF00005. ABC_tran. 2 hits.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
SSF90123. SSF90123. 2 hits.
PROSITEiPS50929. ABC_TM1F. 2 hits.
PS00211. ABC_TRANSPORTER_1. 2 hits.
PS50893. ABC_TRANSPORTER_2. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P08183-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLEGDRNGG AKKKNFFKLN NKSEKDKKEK KPTVSVFSMF RYSNWLDKLY
60 70 80 90 100
MVVGTLAAII HGAGLPLMML VFGEMTDIFA NAGNLEDLMS NITNRSDIND
110 120 130 140 150
TGFFMNLEED MTRYAYYYSG IGAGVLVAAY IQVSFWCLAA GRQIHKIRKQ
160 170 180 190 200
FFHAIMRQEI GWFDVHDVGE LNTRLTDDVS KINEGIGDKI GMFFQSMATF
210 220 230 240 250
FTGFIVGFTR GWKLTLVILA ISPVLGLSAA VWAKILSSFT DKELLAYAKA
260 270 280 290 300
GAVAEEVLAA IRTVIAFGGQ KKELERYNKN LEEAKRIGIK KAITANISIG
310 320 330 340 350
AAFLLIYASY ALAFWYGTTL VLSGEYSIGQ VLTVFFSVLI GAFSVGQASP
360 370 380 390 400
SIEAFANARG AAYEIFKIID NKPSIDSYSK SGHKPDNIKG NLEFRNVHFS
410 420 430 440 450
YPSRKEVKIL KGLNLKVQSG QTVALVGNSG CGKSTTVQLM QRLYDPTEGM
460 470 480 490 500
VSVDGQDIRT INVRFLREII GVVSQEPVLF ATTIAENIRY GRENVTMDEI
510 520 530 540 550
EKAVKEANAY DFIMKLPHKF DTLVGERGAQ LSGGQKQRIA IARALVRNPK
560 570 580 590 600
ILLLDEATSA LDTESEAVVQ VALDKARKGR TTIVIAHRLS TVRNADVIAG
610 620 630 640 650
FDDGVIVEKG NHDELMKEKG IYFKLVTMQT AGNEVELENA ADESKSEIDA
660 670 680 690 700
LEMSSNDSRS SLIRKRSTRR SVRGSQAQDR KLSTKEALDE SIPPVSFWRI
710 720 730 740 750
MKLNLTEWPY FVVGVFCAII NGGLQPAFAI IFSKIIGVFT RIDDPETKRQ
760 770 780 790 800
NSNLFSLLFL ALGIISFITF FLQGFTFGKA GEILTKRLRY MVFRSMLRQD
810 820 830 840 850
VSWFDDPKNT TGALTTRLAN DAAQVKGAIG SRLAVITQNI ANLGTGIIIS
860 870 880 890 900
FIYGWQLTLL LLAIVPIIAI AGVVEMKMLS GQALKDKKEL EGSGKIATEA
910 920 930 940 950
IENFRTVVSL TQEQKFEHMY AQSLQVPYRN SLRKAHIFGI TFSFTQAMMY
960 970 980 990 1000
FSYAGCFRFG AYLVAHKLMS FEDVLLVFSA VVFGAMAVGQ VSSFAPDYAK
1010 1020 1030 1040 1050
AKISAAHIIM IIEKTPLIDS YSTEGLMPNT LEGNVTFGEV VFNYPTRPDI
1060 1070 1080 1090 1100
PVLQGLSLEV KKGQTLALVG SSGCGKSTVV QLLERFYDPL AGKVLLDGKE
1110 1120 1130 1140 1150
IKRLNVQWLR AHLGIVSQEP ILFDCSIAEN IAYGDNSRVV SQEEIVRAAK
1160 1170 1180 1190 1200
EANIHAFIES LPNKYSTKVG DKGTQLSGGQ KQRIAIARAL VRQPHILLLD
1210 1220 1230 1240 1250
EATSALDTES EKVVQEALDK AREGRTCIVI AHRLSTIQNA DLIVVFQNGR
1260 1270 1280
VKEHGTHQQL LAQKGIYFSM VSVQAGTKRQ
Length:1,280
Mass (Da):141,479
Last modified:May 26, 2009 - v3
Checksum:iF0230744AB288C73
GO
Isoform 2 (identifier: P08183-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-177: RYAYYYSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTD → S

Show »
Length:1,216
Mass (Da):134,032
Checksum:i227233F5F2259A8C
GO

Sequence cautioni

The sequence AAM49149.1 differs from that shown. Reason: Erroneous gene model prediction.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti23 – 231S → R in CAA41558. (PubMed:2568832)Curated
Sequence conflicti336 – 3361Missing in AAB69423. (PubMed:9038218)Curated

Polymorphismi

Genetic variation in ABCB1 may play a role in patients who do not respond to drug treatment.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti17 – 171F → L.1 Publication
Corresponds to variant rs28381804 [ dbSNP | Ensembl ].
VAR_022276
Natural varianti21 – 211N → D.5 Publications
Corresponds to variant rs9282564 [ dbSNP | Ensembl ].
VAR_014704
Natural varianti44 – 441N → S.
Corresponds to variant rs1202183 [ dbSNP | Ensembl ].
VAR_055423
Natural varianti80 – 801A → E.
Corresponds to variant rs9282565 [ dbSNP | Ensembl ].
VAR_055424
Natural varianti103 – 1031F → L Rare polymorphism. 1 Publication
VAR_015001
Natural varianti108 – 1081E → K.1 Publication
VAR_018351
Natural varianti185 – 1851G → V in a colchicine-selected multidrug-resistant cell line; confers increased resistance to colchicine. 3 Publications
Corresponds to variant rs1128501 [ dbSNP | Ensembl ].
VAR_015002
Natural varianti261 – 2611I → V.
Corresponds to variant rs36008564 [ dbSNP | Ensembl ].
VAR_055425
Natural varianti400 – 4001S → N.3 Publications
Corresponds to variant rs2229109 [ dbSNP | Ensembl ].
VAR_015003
Natural varianti566 – 5661E → K.1 Publication
Corresponds to variant rs28381902 [ dbSNP | Ensembl ].
VAR_022277
Natural varianti593 – 5931R → C.1 Publication
Corresponds to variant rs28381914 [ dbSNP | Ensembl ].
VAR_022278
Natural varianti599 – 5991A → T.
Corresponds to variant rs2235036 [ dbSNP | Ensembl ].
VAR_055426
Natural varianti669 – 6691R → C.
Corresponds to variant rs35023033 [ dbSNP | Ensembl ].
VAR_055427
Natural varianti801 – 8011V → M.
Corresponds to variant rs2235039 [ dbSNP | Ensembl ].
VAR_055428
Natural varianti829 – 8291I → V.
Corresponds to variant rs2032581 [ dbSNP | Ensembl ].
VAR_055429
Natural varianti836 – 8361I → V.1 Publication
Corresponds to variant rs28381967 [ dbSNP | Ensembl ].
VAR_022279
Natural varianti887 – 8871K → N in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_035737
Natural varianti893 – 8931S → A Common allele; associated with susceptibility to IBD13; has decreased enzyme activity. 8 Publications
Corresponds to variant rs2032582 [ dbSNP | Ensembl ].
VAR_013361
Natural varianti893 – 8931S → T Rare allele. 3 Publications
Corresponds to variant rs2032582 [ dbSNP | Ensembl ].
VAR_013362
Natural varianti986 – 9861M → V.
VAR_018352
Natural varianti999 – 9991A → T.1 Publication
VAR_015004
Natural varianti1051 – 10511P → A.1 Publication
Corresponds to variant rs28401798 [ dbSNP | Ensembl ].
VAR_022280
Natural varianti1107 – 11071Q → P.1 Publication
Corresponds to variant rs55852620 [ dbSNP | Ensembl ].
VAR_015005
Natural varianti1141 – 11411S → T.1 Publication
Corresponds to variant rs2229107 [ dbSNP | Ensembl ].
VAR_022281
Natural varianti1251 – 12511V → I.2 Publications
Corresponds to variant rs28364274 [ dbSNP | Ensembl ].
VAR_018353

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei113 – 17765RYAYY…TRLTD → S in isoform 2. 1 PublicationVSP_055769Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M14758 mRNA. Translation: AAA59575.1.
M29447
, M29424, M29425, M29426, M29427, M29428, M29429, M29430, M29431, M29432, M29433, M29434, M29435, M29436, M29437, M29438, M29439, M29440, M29441, M29442, M29443, M29444, M29445, M29446 Genomic DNA. Translation: AAA59576.1.
AF016535 mRNA. Translation: AAB69423.1.
EU854148 mRNA. Translation: ACF94688.1.
AY910577 Genomic DNA. Translation: AAW82430.1.
AK290159 mRNA. Translation: BAF82848.1.
AC002457 Genomic DNA. Translation: AAM49149.1. Sequence problems.
AC005068 Genomic DNA. No translation available.
M37724 Genomic DNA. Translation: AAA88047.1.
M37725 Genomic DNA. Translation: AAA88048.1.
X58723 Genomic DNA. Translation: CAA41558.1.
CCDSiCCDS5608.1. [P08183-1]
PIRiA34914. DVHU1.
RefSeqiNP_000918.2. NM_000927.4. [P08183-1]
UniGeneiHs.489033.
Hs.737655.

Genome annotation databases

EnsembliENST00000265724; ENSP00000265724; ENSG00000085563. [P08183-1]
ENST00000543898; ENSP00000444095; ENSG00000085563. [P08183-2]
ENST00000622132; ENSP00000478255; ENSG00000085563. [P08183-1]
GeneIDi5243.
KEGGihsa:5243.
UCSCiuc003uiz.2. human. [P08183-1]

Polymorphism databases

DMDMi238054374.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
NIEHS-SNPs
SHMPD

The Singapore human mutation and polymorphism database

Wikipedia

P-glycoprotein entry

ABCMdb

Database for mutations in ABC proteins

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M14758 mRNA. Translation: AAA59575.1 .
M29447
, M29424 , M29425 , M29426 , M29427 , M29428 , M29429 , M29430 , M29431 , M29432 , M29433 , M29434 , M29435 , M29436 , M29437 , M29438 , M29439 , M29440 , M29441 , M29442 , M29443 , M29444 , M29445 , M29446 Genomic DNA. Translation: AAA59576.1 .
AF016535 mRNA. Translation: AAB69423.1 .
EU854148 mRNA. Translation: ACF94688.1 .
AY910577 Genomic DNA. Translation: AAW82430.1 .
AK290159 mRNA. Translation: BAF82848.1 .
AC002457 Genomic DNA. Translation: AAM49149.1 . Sequence problems.
AC005068 Genomic DNA. No translation available.
M37724 Genomic DNA. Translation: AAA88047.1 .
M37725 Genomic DNA. Translation: AAA88048.1 .
X58723 Genomic DNA. Translation: CAA41558.1 .
CCDSi CCDS5608.1. [P08183-1 ]
PIRi A34914. DVHU1.
RefSeqi NP_000918.2. NM_000927.4. [P08183-1 ]
UniGenei Hs.489033.
Hs.737655.

3D structure databases

ProteinModelPortali P08183.
SMRi P08183. Positions 32-630.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111262. 11 interactions.
IntActi P08183. 6 interactions.
MINTi MINT-5000901.
STRINGi 9606.ENSP00000265724.

Chemistry

BindingDBi P08183.
ChEMBLi CHEMBL4302.
DrugBanki DB01193. Acebutolol.
DB00316. Acetaminophen.
DB00945. Acetylsalicylic acid.
DB00171. Adenosine triphosphate.
DB05773. ado-trastuzumab emtansine.
DB08916. Afatinib.
DB00518. Albendazole.
DB00802. Alfentanil.
DB00523. Alitretinoin.
DB00915. Amantadine.
DB00345. Aminohippurate.
DB01118. Amiodarone.
DB00321. Amitriptyline.
DB00381. Amlodipine.
DB00701. Amprenavir.
DB00276. Amsacrine.
DB06605. Apixaban.
DB01169. Arsenic trioxide.
DB00637. Astemizole.
DB01072. Atazanavir.
DB00335. Atenolol.
DB01076. Atorvastatin.
DB06626. Axitinib.
DB00972. Azelastine.
DB00207. Azithromycin.
DB01086. Benzocaine.
DB01244. Bepridil.
DB00443. Betamethasone.
DB00810. Biperiden.
DB08873. Boceprevir.
DB06616. Bosutinib.
DB08870. Brentuximab vedotin.
DB01200. Bromocriptine.
DB00921. Buprenorphine.
DB00490. Buspirone.
DB06772. Cabazitaxel.
DB00201. Caffeine.
DB08907. Canagliflozin.
DB00796. Candesartan.
DB01197. Captopril.
DB00564. Carbamazepine.
DB08889. Carfilzomib.
DB01136. Carvedilol.
DB00520. Caspofungin.
DB00608. Chloroquine.
DB00477. Chlorpromazine.
DB00672. Chlorpropamide.
DB01239. Chlorprothixene.
DB01340. Cilazapril.
DB00501. Cimetidine.
DB00537. Ciprofloxacin.
DB00515. Cisplatin.
DB00215. Citalopram.
DB01211. Clarithromycin.
DB00349. Clobazam.
DB00845. Clofazimine.
DB00882. Clomifene.
DB01242. Clomipramine.
DB00575. Clonidine.
DB00758. Clopidogrel.
DB00257. Clotrimazole.
DB00363. Clozapine.
DB01394. Colchicine.
DB00286. Conjugated Estrogens.
DB08865. Crizotinib.
DB00531. Cyclophosphamide.
DB00091. Cyclosporine.
DB06695. Dabigatran etexilate.
DB08912. Dabrafenib.
DB00970. Dactinomycin.
DB06292. Dapagliflozin.
DB01254. Dasatinib.
DB00694. Daunorubicin.
DB04840. Debrisoquin.
DB01151. Desipramine.
DB00967. Desloratadine.
DB01234. Dexamethasone.
DB00514. Dextromethorphan.
DB00829. Diazepam.
DB00586. Diclofenac.
DB00255. Diethylstilbestrol.
DB01396. Digitoxin.
DB00390. Digoxin.
DB00320. Dihydroergotamine.
DB00343. Diltiazem.
DB00975. Dipyridamole.
DB01248. Docetaxel.
DB01184. Domperidone.
DB00590. Doxazosin.
DB01142. Doxepin.
DB00997. Doxorubicin.
DB00470. Dronabinol.
DB04855. Dronedarone.
DB00216. Eletriptan.
DB00584. Enalapril.
DB08899. Enzalutamide.
DB00751. Epinastine.
DB01253. Ergonovine.
DB00696. Ergotamine.
DB00530. Erlotinib.
DB00199. Erythromycin.
DB00783. Estradiol.
DB01196. Estramustine.
DB04573. Estriol.
DB00655. Estrone.
DB00977. Ethinyl Estradiol.
DB00773. Etoposide.
DB06414. Etravirine.
DB00973. Ezetimibe.
DB01023. Felodipine.
DB00813. Fentanyl.
DB06702. Fesoterodine.
DB00950. Fexofenadine.
DB08874. Fidaxomicin.
DB00196. Fluconazole.
DB00472. Fluoxetine.
DB00875. Flupentixol.
DB00623. Fluphenazine.
DB00690. Flurazepam.
DB08906. Fluticasone furoate.
DB00176. Fluvoxamine.
DB00317. Gefitinib.
DB00441. Gemcitabine.
DB01016. Glyburide.
DB00027. Gramicidin D.
DB00502. Haloperidol.
DB00741. Hydrocortisone.
DB01050. Ibuprofen.
DB00619. Imatinib.
DB00458. Imipramine.
DB05039. Indacaterol.
DB00224. Indinavir.
DB00328. Indomethacin.
DB00762. Irinotecan.
DB01167. Itraconazole.
DB08820. Ivacaftor.
DB00602. Ivermectin.
DB01221. Ketamine.
DB01587. Ketazolam.
DB01026. Ketoconazole.
DB00709. Lamivudine.
DB00555. Lamotrigine.
DB00448. Lansoprazole.
DB01259. Lapatinib.
DB00480. Lenalidomide.
DB01202. Levetiracetam.
DB01137. Levofloxacin.
DB08918. Levomilnacipran.
DB00451. Levothyroxine.
DB00281. Lidocaine.
DB08882. Linagliptin.
DB00279. Liothyronine.
DB01583. Liotrix.
DB00722. Lisinopril.
DB08827. Lomitapide.
DB00836. Loperamide.
DB01601. Lopinavir.
DB00455. Loratadine.
DB00678. Losartan.
DB00227. Lovastatin.
DB00742. Mannitol.
DB00934. Maprotiline.
DB00643. Mebendazole.
DB00358. Mefloquine.
DB00351. Megestrol acetate.
DB00371. Meprobamate.
DB00333. Methadone.
DB00563. Methotrexate.
DB00959. Methylprednisolone.
DB00264. Metoprolol.
DB01110. Miconazole.
DB00683. Midazolam.
DB00834. Mifepristone.
DB08893. Mirabegron.
DB00305. Mitomycin.
DB01204. Mitoxantrone.
DB00295. Morphine.
DB00688. Mycophenolate mofetil.
DB01203. Nadolol.
DB01183. Naloxone.
DB00704. Naltrexone.
DB01149. Nefazodone.
DB00220. Nelfinavir.
DB01400. Neostigmine.
DB00622. Nicardipine.
DB01115. Nifedipine.
DB04868. Nilotinib.
DB00401. Nisoldipine.
DB01595. Nitrazepam.
DB01054. Nitrendipine.
DB00585. Nizatidine.
DB00717. Norethindrone.
DB00334. Olanzapine.
DB00338. Omeprazole.
DB01229. Paclitaxel.
DB00213. Pantoprazole.
DB00715. Paroxetine.
DB06589. Pazopanib.
DB00790. Perindopril.
DB01174. Phenobarbital.
DB00252. Phenytoin.
DB01100. Pimozide.
DB08860. Pitavastatin.
DB08910. Pomalidomide.
DB08901. Ponatinib.
DB01263. Posaconazole.
DB00175. Pravastatin.
DB00457. Prazosin.
DB00860. Prednisolone.
DB00635. Prednisone.
DB01032. Probenecid.
DB00396. Progesterone.
DB01069. Promethazine.
DB01182. Propafenone.
DB00571. Propranolol.
DB00344. Protriptyline.
DB01224. Quetiapine.
DB01103. Quinacrine.
DB00908. Quinidine.
DB00468. Quinine.
DB00863. Ranitidine.
DB00234. Reboxetine.
DB08896. Regorafenib.
DB00206. Reserpine.
DB01045. Rifampicin.
DB08864. Rilpivirine.
DB00734. Risperidone.
DB00503. Ritonavir.
DB06228. Rivaroxaban.
DB00778. Roxithromycin.
DB00936. Salicylic acid.
DB01232. Saquinavir.
DB00747. Scopolamine.
DB01037. Selegiline.
DB01104. Sertraline.
DB06207. Silodosin.
DB06290. SIMEPREVIR.
DB00641. Simvastatin.
DB00877. Sirolimus.
DB01261. Sitagliptin.
DB08934. SOFOSBUVIR.
DB00398. Sorafenib.
DB01208. Sparfloxacin.
DB00421. Spironolactone.
DB00428. Streptozocin.
DB01138. Sulfinpyrazone.
DB00669. Sumatriptan.
DB01268. Sunitinib.
DB00864. Tacrolimus.
DB00675. Tamoxifen.
DB05521. Telaprevir.
DB00966. Telmisartan.
DB06287. Temsirolimus.
DB01162. Terazosin.
DB00624. Testosterone.
DB08816. Ticagrelor.
DB00373. Timolol.
DB06212. Tolvaptan.
DB01030. Topotecan.
DB00539. Toremifene.
DB00656. Trazodone.
DB00831. Trifluoperazine.
DB00508. Triflupromazine.
DB00440. Trimethoprim.
DB00726. Trimipramine.
DB01361. Troleandomycin.
DB01339. Vecuronium.
DB00285. Venlafaxine.
DB00661. Verapamil.
DB00570. Vinblastine.
DB00541. Vincristine.
DB00361. Vinorelbine.
DB08828. Vismodegib.
DB04877. Voacamine.
DB00495. Zidovudine.

Protein family/group databases

TCDBi 3.A.1.201.1. the atp-binding cassette (abc) superfamily.

PTM databases

PhosphoSitei P08183.

Polymorphism databases

DMDMi 238054374.

Proteomic databases

MaxQBi P08183.
PaxDbi P08183.
PRIDEi P08183.

Protocols and materials databases

DNASUi 5243.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000265724 ; ENSP00000265724 ; ENSG00000085563 . [P08183-1 ]
ENST00000543898 ; ENSP00000444095 ; ENSG00000085563 . [P08183-2 ]
ENST00000622132 ; ENSP00000478255 ; ENSG00000085563 . [P08183-1 ]
GeneIDi 5243.
KEGGi hsa:5243.
UCSCi uc003uiz.2. human. [P08183-1 ]

Organism-specific databases

CTDi 5243.
GeneCardsi GC07M087132.
H-InvDB HIX0033521.
HGNCi HGNC:40. ABCB1.
HPAi CAB001716.
HPA002199.
MIMi 171050. gene.
612244. phenotype.
neXtProti NX_P08183.
Orphaneti 771. Ulcerative colitis.
PharmGKBi PA267.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1132.
GeneTreei ENSGT00530000062896.
HOVERGENi HBG080809.
InParanoidi P08183.
KOi K05658.
OMAi ITQNVAN.
OrthoDBi EOG7Z3F4H.
PhylomeDBi P08183.
TreeFami TF105193.

Enzyme and pathway databases

Reactomei REACT_120801. Abacavir transmembrane transport.
REACT_15480. ABC-family proteins mediated transport.

Miscellaneous databases

GeneWikii P-glycoprotein.
GenomeRNAii 5243.
NextBioi 20254.
PROi P08183.
SOURCEi Search...

Gene expression databases

Bgeei P08183.
CleanExi HS_ABCB1.
ExpressionAtlasi P08183. baseline and differential.
Genevestigatori P08183.

Family and domain databases

Gene3Di 3.40.50.300. 2 hits.
InterProi IPR003593. AAA+_ATPase.
IPR011527. ABC1_TM_dom.
IPR003439. ABC_transporter-like.
IPR017871. ABC_transporter_CS.
IPR001140. ABC_transptr_TM_dom.
IPR027417. P-loop_NTPase.
[Graphical view ]
Pfami PF00664. ABC_membrane. 2 hits.
PF00005. ABC_tran. 2 hits.
[Graphical view ]
SMARTi SM00382. AAA. 2 hits.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 2 hits.
SSF90123. SSF90123. 2 hits.
PROSITEi PS50929. ABC_TM1F. 2 hits.
PS00211. ABC_TRANSPORTER_1. 2 hits.
PS50893. ABC_TRANSPORTER_2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Internal duplication and homology with bacterial transport proteins in the mdr1 (P-glycoprotein) gene from multidrug-resistant human cells."
    Chen C.-J., Chin J.E., Ueda K., Clark D.P., Pastan I., Gottesman M.M., Roninson I.B.
    Cell 47:381-389(1986) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-185 AND ALA-893.
  2. "Genomic organization of the human multidrug resistance (MDR1) gene and origin of P-glycoproteins."
    Chen C.-J., Clark D.P., Ueda K., Pastan I., Gottesman M.M., Roninson I.B.
    J. Biol. Chem. 265:506-514(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-893.
  3. "Multidrug-resistant human sarcoma cells with a mutant P-glycoprotein, altered phenotype, and resistance to cyclosporins."
    Chen G., Duran G.E., Steger K.A., Lacayo N.J., Jaffrezou J.P., Dumontet C., Sikic B.I.
    J. Biol. Chem. 272:5974-5982(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-185 AND ALA-893.
  4. "Cloning of P-glycoprotein cDNA sequence from breast cancer MCF7 cell line."
    Jiang Y., Sun Q., Xie Z., Liu F., Xu W., Wang Y.
    Submitted (JUN-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  5. NIEHS SNPs program
    Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASP-21.
    Tissue: Thalamus.
  7. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "mdr1/P-glycoprotein gene segments analyzed from various human leukemic cell lines exhibiting different multidrug resistance profiles."
    Gekeler V., Weger S., Probst H.
    Biochem. Biophys. Res. Commun. 169:796-802(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 178-215 AND 800-856.
  9. "P-glycoprotein gene (MDR1) cDNA from human adrenal: normal P-glycoprotein carries Gly185 with an altered pattern of multidrug resistance."
    Kioka N., Tsubota J., Kakehi Y., Komano T., Gottesman M.M., Pastan I., Ueda K.
    Biochem. Biophys. Res. Commun. 162:224-231(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-23 (ISOFORM 1/2).
  10. "ABC drug transporters: hereditary polymorphisms and pharmacological impact in MDR1, MRP1 and MRP2."
    Kerb R., Hoffmeyer S., Brinkmann U.
    Pharmacogenomics 2:51-64(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  11. "Cytoplasmic domains of the transporter associated with antigen processing and P-glycoprotein interact with subunits of the proteasome."
    Begley G.S., Horvath A.R., Taylor J.C., Higgins C.F.
    Mol. Immunol. 42:137-141(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PSMB5.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "Protein phosphatase complex PP5/PPP2R3C dephosphorylates P-glycoprotein/ABCB1 and down-regulates the expression and function."
    Katayama K., Yamaguchi M., Noguchi K., Sugimoto Y.
    Cancer Lett. 345:124-131(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PPP2R3C.
  15. "An altered pattern of cross-resistance in multidrug-resistant human cells results from spontaneous mutations in the mdr1 (P-glycoprotein) gene."
    Choi K.H., Chen C.-J., Kriegler M., Roninson I.B.
    Cell 53:519-529(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT VAL-185.
  16. "Genetic polymorphism in MDR-1: a tool for examining allelic expression in normal cells, unselected and drug-selected cell lines, and human tumors."
    Mickley L.A., Lee J.-S., Weng Z., Zhan Z., Alvarez M., Wilson W., Bates S.E., Fojo T.
    Blood 91:1749-1756(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS ALA-893 AND THR-999.
  17. "A new polymorphism (N21D) in the exon 2 of the human MDR1 gene encoding the P-glycoprotein."
    Decleves X., Chevillard S., Charpentier C., Vielh P., Laplanche J.-L.
    Hum. Mutat. 15:486-486(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ASP-21.
  18. "Functional polymorphisms of the human multidrug-resistance gene: multiple sequence variations and correlation of one allele with P-glycoprotein expression and activity in vivo."
    Hoffmeyer S., Burk O., von Richter O., Arnold H.P., Brockmoeller J., Johne A., Cascorbi I., Gerloff T., Roots I., Eichelbaum M., Brinkmann U.
    Proc. Natl. Acad. Sci. U.S.A. 97:3473-3478(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS ASP-21; LEU-103 AND ASN-400.
  19. "Frequency of single nucleotide polymorphisms in the P-glycoprotein drug transporter MDR1 gene in white subjects."
    Cascorbi I., Gerloff T., Johne A., Meisel C., Hoffmeyer S., Schwab M., Schaeffeler E., Eichelbaum M., Brinkmann U., Roots I.
    Clin. Pharmacol. Ther. 69:169-174(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS ASP-21; ASN-400; ALA-893; THR-893 AND PRO-1107.
  20. "Polymorphism of MDR1 gene in healthy Japanese subjects: a novel SNP with an amino acid substitution (Glu108Lys)."
    Honda T., Dan Y., Koyabu N., Ieiri I., Otsubo K., Higuchi S., Ohtani H., Sawada J.
    Drug Metab. Pharmacokinet. 17:479-481(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT LYS-108.
  21. "Twelve novel single nucleotide polymorphisms in ABCB1/MDR1 among Japanese patients with ventricular tachycardia who were administered amiodarone."
    Itoda M., Saito Y., Komamura K., Ueno K., Kamakura S., Ozawa S., Sawada J.
    Drug Metab. Pharmacokinet. 17:566-571(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ILE-1251.
  22. "Three hundred twenty-six genetic variations in genes encoding nine members of ATP-binding cassette, subfamily B (ABCB/MDR/TAP), in the Japanese population."
    Saito S., Iida A., Sekine A., Miura Y., Ogawa C., Kawauchi S., Higuchi S., Nakamura Y.
    J. Hum. Genet. 47:38-50(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS ALA-893 AND THR-893.
  23. Cited for: VARIANTS ALA-893 AND THR-893, ASSOCIATION WITH SUSCEPTIBILITY TO IBD13.
  24. Cited for: VARIANT [LARGE SCALE ANALYSIS] ASN-887.

Entry informationi

Entry nameiMDR1_HUMAN
AccessioniPrimary (citable) accession number: P08183
Secondary accession number(s): A8K294
, B5AK60, Q12755, Q14812
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1988
Last sequence update: May 26, 2009
Last modified: October 29, 2014
This is version 175 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3