ABCB1

Functionⁱ

Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Catalytic activityⁱ

ATP + H₂O + xenobiotic(In) = ADP + phosphate + xenobiotic(Out).

Regions

Feature key	Position(s)	Length	Description	Graphical view	Feature identifier	Actions
Nucleotide bindingⁱ	427 – 434	8	ATP 1PROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00434
Nucleotide bindingⁱ	1070 – 1077	8	ATP 2PROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00434

GO - Molecular functionⁱ

ATPase activity, coupled to transmembrane movement of substances
Source: ProtInc
Traceable author statementⁱ
- 3022150
ATP binding
Source: ProtInc
Traceable author statementⁱ
- 3768958
transporter activity
Source: ProtInc
Traceable author statementⁱ
- 3022150
xenobiotic-transporting ATPase activity Source: Reactome

Enzyme and pathway databases

BRENDAⁱ	3.6.3.44. 2681.
Reactomeⁱ	R-HSA-2161517. Abacavir transmembrane transport. R-HSA-382556. ABC-family proteins mediated transport.

Protein family/group databases

MoonProtⁱ	P08183.
TCDBⁱ	3.A.1.201.1. the atp-binding cassette (abc) superfamily.

Chemistry

SwissLipidsⁱ	SLP:000000385.

SwissLipidsⁱ

SLP:000000385.

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Multidrug resistance protein 1 (EC:3.6.3.44) Alternative name(s): ATP-binding cassette sub-family B member 1 P-glycoprotein 1 CD_antigen: CD243
Gene namesⁱ	Name:ABCB1 Synonyms:MDR1, PGY1
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 7

Organism-specific databases

HGNCⁱ	HGNC:40. ABCB1.

HGNCⁱ

HGNC:40. ABCB1.

Subcellular locationⁱ

Cell membrane By similarity; Multi-pass membrane protein
PROSITE-ProRule annotation
Manual assertion according to rulesⁱ
- PROSITE-ProRule:PRU00441

Topology

Feature key	Position(s)	Length	Description	Actions
Topological domainⁱ	1 – 44	44	CytoplasmicBy similarity	Add BLAST
Transmembraneⁱ	45 – 67	23	HelicalPROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Topological domainⁱ	68 – 116	49	ExtracellularBy similarity	Add BLAST
Transmembraneⁱ	117 – 137	21	HelicalPROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Topological domainⁱ	138 – 186	49	CytoplasmicBy similarity	Add BLAST
Transmembraneⁱ	187 – 208	22	HelicalPROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Topological domainⁱ	209 – 215	7	ExtracellularBy similarity
Transmembraneⁱ	216 – 236	21	HelicalPROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Topological domainⁱ	237 – 292	56	CytoplasmicBy similarity	Add BLAST
Transmembraneⁱ	293 – 316	24	HelicalPROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Topological domainⁱ	317 – 330	14	ExtracellularBy similarity	Add BLAST
Transmembraneⁱ	331 – 352	22	HelicalPROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Topological domainⁱ	353 – 711	359	CytoplasmicBy similarity	Add BLAST
Transmembraneⁱ	712 – 732	21	HelicalPROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Topological domainⁱ	733 – 756	24	ExtracellularBy similarity	Add BLAST
Transmembraneⁱ	757 – 777	21	HelicalPROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Topological domainⁱ	778 – 832	55	CytoplasmicBy similarity	Add BLAST
Transmembraneⁱ	833 – 853	21	HelicalPROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Topological domainⁱ	854 – 854	1	ExtracellularBy similarity
Transmembraneⁱ	855 – 874	20	HelicalPROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Topological domainⁱ	875 – 934	60	CytoplasmicBy similarity	Add BLAST
Transmembraneⁱ	935 – 957	23	HelicalPROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Topological domainⁱ	958 – 973	16	ExtracellularBy similarity	Add BLAST
Transmembraneⁱ	974 – 995	22	HelicalPROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Topological domainⁱ	996 – 1280	285	CytoplasmicBy similarity	Add BLAST

GO - Cellular componentⁱ

cell surface
Source: DFLAT
Inferred from direct assayⁱ
- 19384922
extracellular exosome
Source: UniProtKB
Inferred from direct assayⁱ
integral component of membrane
Source: ProtInc
Traceable author statementⁱ
- 3768958
membrane
Source: ProtInc
Traceable author statementⁱ
- 3022150
plasma membrane Source: Reactome

Complete GO annotation...

Keywords - Cellular componentⁱ

Cell membrane, Membrane

Pathology & Biotechⁱ

Involvement in diseaseⁱ

Inflammatory bowel disease 13 (IBD13)

Disease susceptibility is associated with variations affecting the gene represented in this entry.

Disease descriptionA chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.

Feature key	Position(s)	Length	Description	Graphical view	Feature identifier	Actions
Natural variantⁱ	893 – 893	1	S → A Common allele; associated with susceptibility to IBD13; has decreased enzyme activity. 8 Publications Manual assertion based on experiment inⁱ Ref.1 "Internal duplication and homology with bacterial transport proteins in the mdr1 (P-glycoprotein) gene from multidrug-resistant human cells." Chen C.-J., Chin J.E., Ueda K., Clark D.P., Pastan I., Gottesman M.M., Roninson I.B. Cell 47:381-389(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-185 AND ALA-893, POLYMORPHISM. Ref.2 "Genomic organization of the human multidrug resistance (MDR1) gene and origin of P-glycoproteins." Chen C.-J., Clark D.P., Ueda K., Pastan I., Gottesman M.M., Roninson I.B. J. Biol. Chem. 265:506-514(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-893. Ref.3 "Multidrug-resistant human sarcoma cells with a mutant P-glycoprotein, altered phenotype, and resistance to cyclosporins." Chen G., Duran G.E., Steger K.A., Lacayo N.J., Jaffrezou J.P., Dumontet C., Sikic B.I. J. Biol. Chem. 272:5974-5982(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-185 AND ALA-893, POLYMORPHISM. Ref.5 NIEHS SNPs program Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251. Ref.16 "Genetic polymorphism in MDR-1: a tool for examining allelic expression in normal cells, unselected and drug-selected cell lines, and human tumors." Mickley L.A., Lee J.-S., Weng Z., Zhan Z., Alvarez M., Wilson W., Bates S.E., Fojo T. Blood 91:1749-1756(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ALA-893 AND THR-999. Ref.19 "Frequency of single nucleotide polymorphisms in the P-glycoprotein drug transporter MDR1 gene in white subjects." Cascorbi I., Gerloff T., Johne A., Meisel C., Hoffmeyer S., Schwab M., Schaeffeler E., Eichelbaum M., Brinkmann U., Roots I. Clin. Pharmacol. Ther. 69:169-174(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASP-21; ASN-400; ALA-893; THR-893 AND PRO-1107. Ref.22 "Three hundred twenty-six genetic variations in genes encoding nine members of ATP-binding cassette, subfamily B (ABCB/MDR/TAP), in the Japanese population." Saito S., Iida A., Sekine A., Miura Y., Ogawa C., Kawauchi S., Higuchi S., Nakamura Y. J. Hum. Genet. 47:38-50(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ALA-893 AND THR-893. Ref.23 "MDR1 Ala893 polymorphism is associated with inflammatory bowel disease." Brant S.R., Panhuysen C.I.M., Nicolae D., Reddy D.M., Bonen D.K., Karaliukas R., Zhang L., Swanson E., Datta L.W., Moran T., Ravenhill G., Duerr R.H., Achkar J.-P., Karban A.S., Cho J.H. Am. J. Hum. Genet. 73:1282-1292(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ALA-893 AND THR-893, ASSOCIATION WITH SUSCEPTIBILITY TO IBD13. Corresponds to variant rs2032582 [ dbSNP \| Ensembl ].		VAR_013361

Organism-specific databases

MalaCardsⁱ	ABCB1.
MIMⁱ	612244. phenotype.
Orphanetⁱ	771. Ulcerative colitis.
PharmGKBⁱ	PA267.

Chemistry

ChEMBLⁱ	CHEMBL4302.
DrugBankⁱ	DB01193. Acebutolol. DB00316. Acetaminophen. DB00945. Acetylsalicylic acid. DB00171. Adenosine triphosphate. DB05773. ado-trastuzumab emtansine. DB08916. Afatinib. DB00518. Albendazole. DB11363. Alectinib. DB00802. Alfentanil. DB00523. Alitretinoin. DB00915. Amantadine. DB06403. Ambrisentan. DB00345. Aminohippurate. DB01118. Amiodarone. DB00321. Amitriptyline. DB00381. Amlodipine. DB00701. Amprenavir. DB00276. Amsacrine. DB06605. Apixaban. DB01169. Arsenic trioxide. DB00637. Astemizole. DB01072. Atazanavir. DB00335. Atenolol. DB01076. Atorvastatin. DB06626. Axitinib. DB00972. Azelastine. DB00207. Azithromycin. DB01086. Benzocaine. DB01244. Bepridil. DB00443. Betamethasone. DB00810. Biperiden. DB08873. Boceprevir. DB06616. Bosutinib. DB08870. Brentuximab vedotin. DB01200. Bromocriptine. DB00921. Buprenorphine. DB00490. Buspirone. DB06772. Cabazitaxel. DB00201. Caffeine. DB08907. Canagliflozin. DB00796. Candesartan. DB01197. Captopril. DB00564. Carbamazepine. DB08889. Carfilzomib. DB01136. Carvedilol. DB00520. Caspofungin. DB09063. Ceritinib. DB00608. Chloroquine. DB00477. Chlorpromazine. DB00672. Chlorpropamide. DB01239. Chlorprothixene. DB02659. Cholic Acid. DB01340. Cilazapril. DB00501. Cimetidine. DB00537. Ciprofloxacin. DB00515. Cisplatin. DB00215. Citalopram. DB01211. Clarithromycin. DB00349. Clobazam. DB00845. Clofazimine. DB00882. Clomifene. DB01242. Clomipramine. DB00575. Clonidine. DB00758. Clopidogrel. DB00257. Clotrimazole. DB00363. Clozapine. DB09065. Cobicistat. DB05239. Cobimetinib. DB01394. Colchicine. DB00286. Conjugated Estrogens. DB08865. Crizotinib. DB00531. Cyclophosphamide. DB00091. Cyclosporine. DB06695. Dabigatran etexilate. DB08912. Dabrafenib. DB09102. Daclatasvir. DB00970. Dactinomycin. DB06292. Dapagliflozin. DB01254. Dasatinib. DB00694. Daunorubicin. DB04840. Debrisoquin. DB01151. Desipramine. DB00967. Desloratadine. DB01234. Dexamethasone. DB00514. Dextromethorphan. DB00829. Diazepam. DB00586. Diclofenac. DB00255. Diethylstilbestrol. DB01396. Digitoxin. DB00390. Digoxin. DB00320. Dihydroergotamine. DB00343. Diltiazem. DB00975. Dipyridamole. DB01248. Docetaxel. DB01184. Domperidone. DB00590. Doxazosin. DB01142. Doxepin. DB00997. Doxorubicin. DB00470. Dronabinol. DB04855. Dronedarone. DB09075. Edoxaban. DB00216. Eletriptan. DB00584. Enalapril. DB08899. Enzalutamide. DB00751. Epinastine. DB01253. Ergonovine. DB00696. Ergotamine. DB00530. Erlotinib. DB00199. Erythromycin. DB00783. Estradiol. DB01196. Estramustine. DB04573. Estriol. DB00655. Estrone. DB00977. Ethinyl Estradiol. DB00773. Etoposide. DB06414. Etravirine. DB00973. Ezetimibe. DB01023. Felodipine. DB00813. Fentanyl. DB06702. Fesoterodine. DB00950. Fexofenadine. DB08874. Fidaxomicin. DB00196. Fluconazole. DB00472. Fluoxetine. DB00875. Flupentixol. DB00623. Fluphenazine. DB00690. Flurazepam. DB08906. Fluticasone furoate. DB00176. Fluvoxamine. DB00317. Gefitinib. DB00441. Gemcitabine. DB01016. Glyburide. DB00027. Gramicidin D. DB00502. Haloperidol. DB00741. Hydrocortisone. DB01050. Ibuprofen. DB09054. Idelalisib. DB00619. Imatinib. DB00458. Imipramine. DB05039. Indacaterol. DB00224. Indinavir. DB00328. Indomethacin. DB00762. Irinotecan. DB06636. Isavuconazonium. DB01167. Itraconazole. DB08820. Ivacaftor. DB00602. Ivermectin. DB01221. Ketamine. DB01587. Ketazolam. DB01026. Ketoconazole. DB00709. Lamivudine. DB00555. Lamotrigine. DB00448. Lansoprazole. DB01259. Lapatinib. DB00480. Lenalidomide. DB09078. Lenvatinib. DB01202. Levetiracetam. DB01137. Levofloxacin. DB08918. Levomilnacipran. DB00451. Levothyroxine. DB00281. Lidocaine. DB08882. Linagliptin. DB00279. Liothyronine. DB01583. Liotrix. DB00722. Lisinopril. DB08827. Lomitapide. DB00836. Loperamide. DB01601. Lopinavir. DB00455. Loratadine. DB00678. Losartan. DB00227. Lovastatin. DB00742. Mannitol. DB00934. Maprotiline. DB00643. Mebendazole. DB00358. Mefloquine. DB00351. Megestrol acetate. DB00371. Meprobamate. DB00333. Methadone. DB00563. Methotrexate. DB00959. Methylprednisolone. DB00264. Metoprolol. DB01110. Miconazole. DB00683. Midazolam. DB00834. Mifepristone. DB08893. Mirabegron. DB00305. Mitomycin. DB01204. Mitoxantrone. DB00295. Morphine. DB00688. Mycophenolate mofetil. DB01203. Nadolol. DB01183. Naloxone. DB00704. Naltrexone. DB01149. Nefazodone. DB00220. Nelfinavir. DB01400. Neostigmine. DB00622. Nicardipine. DB01115. Nifedipine. DB04868. Nilotinib. DB09079. Nintedanib. DB00401. Nisoldipine. DB01595. Nitrazepam. DB01054. Nitrendipine. DB00585. Nizatidine. DB00717. Norethisterone. DB00334. Olanzapine. DB00338. Omeprazole. DB09330. Osimertinib. DB01229. Paclitaxel. DB06603. Panobinostat. DB00213. Pantoprazole. DB00715. Paroxetine. DB06589. Pazopanib. DB00790. Perindopril. DB01174. Phenobarbital. DB00252. Phenytoin. DB01100. Pimozide. DB08860. Pitavastatin. DB08910. Pomalidomide. DB08901. Ponatinib. DB01263. Posaconazole. DB00175. Pravastatin. DB00457. Prazosin. DB00860. Prednisolone. DB00635. Prednisone. DB01032. Probenecid. DB00396. Progesterone. DB01069. Promethazine. DB01182. Propafenone. DB00571. Propranolol. DB00344. Protriptyline. DB01224. Quetiapine. DB01103. Quinacrine. DB00908. Quinidine. DB00468. Quinine. DB00863. Ranitidine. DB00234. Reboxetine. DB08896. Regorafenib. DB00206. Reserpine. DB01045. Rifampicin. DB08864. Rilpivirine. DB00734. Risperidone. DB00503. Ritonavir. DB06228. Rivaroxaban. DB09291. Rolapitant. DB06176. Romidepsin. DB00778. Roxithromycin. DB00936. Salicylic acid. DB01232. Saquinavir. DB00747. Scopolamine. DB01037. Selegiline. DB11362. Selexipag. DB01104. Sertraline. DB06207. Silodosin. DB06290. Simeprevir. DB00641. Simvastatin. DB00877. Sirolimus. DB01261. Sitagliptin. DB08934. Sofosbuvir. DB00398. Sorafenib. DB01208. Sparfloxacin. DB00421. Spironolactone. DB00428. Streptozocin. DB01138. Sulfinpyrazone. DB00669. Sumatriptan. DB01268. Sunitinib. DB00864. Tacrolimus. DB00675. Tamoxifen. DB05521. Telaprevir. DB00966. Telmisartan. DB06287. Temsirolimus. DB01162. Terazosin. DB00624. Testosterone. DB08816. Ticagrelor. DB00373. Timolol. DB06212. Tolvaptan. DB01030. Topotecan. DB00539. Toremifene. DB00656. Trazodone. DB00831. Trifluoperazine. DB00508. Triflupromazine. DB00440. Trimethoprim. DB00726. Trimipramine. DB01361. Troleandomycin. DB08867. Ulipristal. DB09076. Umeclidinium. DB01339. Vecuronium. DB00285. Venlafaxine. DB00661. Verapamil. DB00570. Vinblastine. DB00541. Vincristine. DB00361. Vinorelbine. DB08828. Vismodegib. DB04877. Voacamine. DB00495. Zidovudine.

ChEMBLⁱ

CHEMBL4302.

DrugBankⁱ

DB01193. Acebutolol.
DB00316. Acetaminophen.
DB00945. Acetylsalicylic acid.
DB00171. Adenosine triphosphate.
DB05773. ado-trastuzumab emtansine.
DB08916. Afatinib.
DB00518. Albendazole.
DB11363. Alectinib.
DB00802. Alfentanil.
DB00523. Alitretinoin.
DB00915. Amantadine.
DB06403. Ambrisentan.
DB00345. Aminohippurate.
DB01118. Amiodarone.
DB00321. Amitriptyline.
DB00381. Amlodipine.
DB00701. Amprenavir.
DB00276. Amsacrine.
DB06605. Apixaban.
DB01169. Arsenic trioxide.
DB00637. Astemizole.
DB01072. Atazanavir.
DB00335. Atenolol.
DB01076. Atorvastatin.
DB06626. Axitinib.
DB00972. Azelastine.
DB00207. Azithromycin.
DB01086. Benzocaine.
DB01244. Bepridil.
DB00443. Betamethasone.
DB00810. Biperiden.
DB08873. Boceprevir.
DB06616. Bosutinib.
DB08870. Brentuximab vedotin.
DB01200. Bromocriptine.
DB00921. Buprenorphine.
DB00490. Buspirone.
DB06772. Cabazitaxel.
DB00201. Caffeine.
DB08907. Canagliflozin.
DB00796. Candesartan.
DB01197. Captopril.
DB00564. Carbamazepine.
DB08889. Carfilzomib.
DB01136. Carvedilol.
DB00520. Caspofungin.
DB09063. Ceritinib.
DB00608. Chloroquine.
DB00477. Chlorpromazine.
DB00672. Chlorpropamide.
DB01239. Chlorprothixene.
DB02659. Cholic Acid.
DB01340. Cilazapril.
DB00501. Cimetidine.
DB00537. Ciprofloxacin.
DB00515. Cisplatin.
DB00215. Citalopram.
DB01211. Clarithromycin.
DB00349. Clobazam.
DB00845. Clofazimine.
DB00882. Clomifene.
DB01242. Clomipramine.
DB00575. Clonidine.
DB00758. Clopidogrel.
DB00257. Clotrimazole.
DB00363. Clozapine.
DB09065. Cobicistat.
DB05239. Cobimetinib.
DB01394. Colchicine.
DB00286. Conjugated Estrogens.
DB08865. Crizotinib.
DB00531. Cyclophosphamide.
DB00091. Cyclosporine.
DB06695. Dabigatran etexilate.
DB08912. Dabrafenib.
DB09102. Daclatasvir.
DB00970. Dactinomycin.
DB06292. Dapagliflozin.
DB01254. Dasatinib.
DB00694. Daunorubicin.
DB04840. Debrisoquin.
DB01151. Desipramine.
DB00967. Desloratadine.
DB01234. Dexamethasone.
DB00514. Dextromethorphan.
DB00829. Diazepam.
DB00586. Diclofenac.
DB00255. Diethylstilbestrol.
DB01396. Digitoxin.
DB00390. Digoxin.
DB00320. Dihydroergotamine.
DB00343. Diltiazem.
DB00975. Dipyridamole.
DB01248. Docetaxel.
DB01184. Domperidone.
DB00590. Doxazosin.
DB01142. Doxepin.
DB00997. Doxorubicin.
DB00470. Dronabinol.
DB04855. Dronedarone.
DB09075. Edoxaban.
DB00216. Eletriptan.
DB00584. Enalapril.
DB08899. Enzalutamide.
DB00751. Epinastine.
DB01253. Ergonovine.
DB00696. Ergotamine.
DB00530. Erlotinib.
DB00199. Erythromycin.
DB00783. Estradiol.
DB01196. Estramustine.
DB04573. Estriol.
DB00655. Estrone.
DB00977. Ethinyl Estradiol.
DB00773. Etoposide.
DB06414. Etravirine.
DB00973. Ezetimibe.
DB01023. Felodipine.
DB00813. Fentanyl.
DB06702. Fesoterodine.
DB00950. Fexofenadine.
DB08874. Fidaxomicin.
DB00196. Fluconazole.
DB00472. Fluoxetine.
DB00875. Flupentixol.
DB00623. Fluphenazine.
DB00690. Flurazepam.
DB08906. Fluticasone furoate.
DB00176. Fluvoxamine.
DB00317. Gefitinib.
DB00441. Gemcitabine.
DB01016. Glyburide.
DB00027. Gramicidin D.
DB00502. Haloperidol.
DB00741. Hydrocortisone.
DB01050. Ibuprofen.
DB09054. Idelalisib.
DB00619. Imatinib.
DB00458. Imipramine.
DB05039. Indacaterol.
DB00224. Indinavir.
DB00328. Indomethacin.
DB00762. Irinotecan.
DB06636. Isavuconazonium.
DB01167. Itraconazole.
DB08820. Ivacaftor.
DB00602. Ivermectin.
DB01221. Ketamine.
DB01587. Ketazolam.
DB01026. Ketoconazole.
DB00709. Lamivudine.
DB00555. Lamotrigine.
DB00448. Lansoprazole.
DB01259. Lapatinib.
DB00480. Lenalidomide.
DB09078. Lenvatinib.
DB01202. Levetiracetam.
DB01137. Levofloxacin.
DB08918. Levomilnacipran.
DB00451. Levothyroxine.
DB00281. Lidocaine.
DB08882. Linagliptin.
DB00279. Liothyronine.
DB01583. Liotrix.
DB00722. Lisinopril.
DB08827. Lomitapide.
DB00836. Loperamide.
DB01601. Lopinavir.
DB00455. Loratadine.
DB00678. Losartan.
DB00227. Lovastatin.
DB00742. Mannitol.
DB00934. Maprotiline.
DB00643. Mebendazole.
DB00358. Mefloquine.
DB00351. Megestrol acetate.
DB00371. Meprobamate.
DB00333. Methadone.
DB00563. Methotrexate.
DB00959. Methylprednisolone.
DB00264. Metoprolol.
DB01110. Miconazole.
DB00683. Midazolam.
DB00834. Mifepristone.
DB08893. Mirabegron.
DB00305. Mitomycin.
DB01204. Mitoxantrone.
DB00295. Morphine.
DB00688. Mycophenolate mofetil.
DB01203. Nadolol.
DB01183. Naloxone.
DB00704. Naltrexone.
DB01149. Nefazodone.
DB00220. Nelfinavir.
DB01400. Neostigmine.
DB00622. Nicardipine.
DB01115. Nifedipine.
DB04868. Nilotinib.
DB09079. Nintedanib.
DB00401. Nisoldipine.
DB01595. Nitrazepam.
DB01054. Nitrendipine.
DB00585. Nizatidine.
DB00717. Norethisterone.
DB00334. Olanzapine.
DB00338. Omeprazole.
DB09330. Osimertinib.
DB01229. Paclitaxel.
DB06603. Panobinostat.
DB00213. Pantoprazole.
DB00715. Paroxetine.
DB06589. Pazopanib.
DB00790. Perindopril.
DB01174. Phenobarbital.
DB00252. Phenytoin.
DB01100. Pimozide.
DB08860. Pitavastatin.
DB08910. Pomalidomide.
DB08901. Ponatinib.
DB01263. Posaconazole.
DB00175. Pravastatin.
DB00457. Prazosin.
DB00860. Prednisolone.
DB00635. Prednisone.
DB01032. Probenecid.
DB00396. Progesterone.
DB01069. Promethazine.
DB01182. Propafenone.
DB00571. Propranolol.
DB00344. Protriptyline.
DB01224. Quetiapine.
DB01103. Quinacrine.
DB00908. Quinidine.
DB00468. Quinine.
DB00863. Ranitidine.
DB00234. Reboxetine.
DB08896. Regorafenib.
DB00206. Reserpine.
DB01045. Rifampicin.
DB08864. Rilpivirine.
DB00734. Risperidone.
DB00503. Ritonavir.
DB06228. Rivaroxaban.
DB09291. Rolapitant.
DB06176. Romidepsin.
DB00778. Roxithromycin.
DB00936. Salicylic acid.
DB01232. Saquinavir.
DB00747. Scopolamine.
DB01037. Selegiline.
DB11362. Selexipag.
DB01104. Sertraline.
DB06207. Silodosin.
DB06290. Simeprevir.
DB00641. Simvastatin.
DB00877. Sirolimus.
DB01261. Sitagliptin.
DB08934. Sofosbuvir.
DB00398. Sorafenib.
DB01208. Sparfloxacin.
DB00421. Spironolactone.
DB00428. Streptozocin.
DB01138. Sulfinpyrazone.
DB00669. Sumatriptan.
DB01268. Sunitinib.
DB00864. Tacrolimus.
DB00675. Tamoxifen.
DB05521. Telaprevir.
DB00966. Telmisartan.
DB06287. Temsirolimus.
DB01162. Terazosin.
DB00624. Testosterone.
DB08816. Ticagrelor.
DB00373. Timolol.
DB06212. Tolvaptan.
DB01030. Topotecan.
DB00539. Toremifene.
DB00656. Trazodone.
DB00831. Trifluoperazine.
DB00508. Triflupromazine.
DB00440. Trimethoprim.
DB00726. Trimipramine.
DB01361. Troleandomycin.
DB08867. Ulipristal.
DB09076. Umeclidinium.
DB01339. Vecuronium.
DB00285. Venlafaxine.
DB00661. Verapamil.
DB00570. Vinblastine.
DB00541. Vincristine.
DB00361. Vinorelbine.
DB08828. Vismodegib.
DB04877. Voacamine.
DB00495. Zidovudine.

Polymorphism and mutation databases

BioMutaⁱ	ABCB1.
DMDMⁱ	238054374.

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	Length	Description	Graphical view	Feature identifier	Actions
Chainⁱ	1 – 1280	1280	Multidrug resistance protein 1		PRO_0000093332	Add BLAST

Amino acid modifications

Feature key	Position(s)	Length	Description
Glycosylationⁱ	91 – 91	1	N-linked (GlcNAc...)Sequence analysis
Glycosylationⁱ	94 – 94	1	N-linked (GlcNAc...)Sequence analysis
Glycosylationⁱ	99 – 99	1	N-linked (GlcNAc...)Sequence analysis

Keywords - PTMⁱ

Glycoprotein

Proteomic databases

EPDⁱ	P08183.
MaxQBⁱ	P08183.
PaxDbⁱ	P08183.
PeptideAtlasⁱ	P08183.
PRIDEⁱ	P08183.

PTM databases

iPTMnetⁱ	P08183.
PhosphoSiteⁱ	P08183.

Expressionⁱ

Tissue specificityⁱ

Expressed in liver, kidney, small intestine and brain.

Gene expression databases

Bgeeⁱ	ENSG00000085563.
CleanExⁱ	HS_ABCB1.
ExpressionAtlasⁱ	P08183. baseline and differential.
Genevisibleⁱ	P08183. HS.

Organism-specific databases

HPAⁱ	CAB001716. HPA002199.

Interactionⁱ

Subunit structureⁱ

Interacts with PSMB5. Finds in a complex with ABCB1, TFPI2 and PPP2R3C; leading to the dephosphorylation of ABCB1.2 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
LAPTM4B	Q86VI4	2	EBI-1057359,EBI-3267258
RNF2	Q99496	2	EBI-1057359,EBI-722416

With

Entry

#Exp.

IntAct

Notes

LAPTM4B

Q86VI4

2

EBI-1057359,EBI-3267258

RNF2

Q99496

2

EBI-1057359,EBI-722416

Protein-protein interaction databases

BioGridⁱ	111262. 14 interactions.
IntActⁱ	P08183. 6 interactions.
MINTⁱ	MINT-5000901.
STRINGⁱ	9606.ENSP00000265724.

Chemistry

BindingDBⁱ

P08183.

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P08183.
SMRⁱ	P08183. Positions 31-630.
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	Length	Description	Actions
Domainⁱ	51 – 357	307	ABC transmembrane type-1 1PROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Domainⁱ	392 – 628	237	ABC transporter 1PROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00434	Add BLAST
Domainⁱ	711 – 1000	290	ABC transmembrane type-1 2PROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00441	Add BLAST
Domainⁱ	1035 – 1273	239	ABC transporter 2PROSITE-ProRule annotation Manual assertion according to rulesⁱ PROSITE-ProRule:PRU00434	Add BLAST

Sequence similaritiesⁱ

Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily. [View classification]Curated

Contains 2 ABC transmembrane type-1 domains.PROSITE-ProRule annotation

Contains 2 ABC transporter domains.PROSITE-ProRule annotation

Keywords - Domainⁱ

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG0055. Eukaryota. COG1132. LUCA.
GeneTreeⁱ	ENSGT00530000062896.
HOVERGENⁱ	HBG080809.
InParanoidⁱ	P08183.
KOⁱ	K05658.
OMAⁱ	SQGQDRK.
OrthoDBⁱ	EOG091G0HVA.
PhylomeDBⁱ	P08183.
TreeFamⁱ	TF105193.

Family and domain databases

Gene3Dⁱ	3.40.50.300. 2 hits.
InterProⁱ	IPR003593. AAA+_ATPase. IPR011527. ABC1_TM_dom. IPR003439. ABC_transporter-like. IPR017871. ABC_transporter_CS. IPR027417. P-loop_NTPase. [Graphical view]
Pfamⁱ	PF00664. ABC_membrane. 2 hits. PF00005. ABC_tran. 2 hits. [Graphical view]
SMARTⁱ	SM00382. AAA. 2 hits. [Graphical view]
SUPFAMⁱ	SSF52540. SSF52540. 2 hits. SSF90123. SSF90123. 2 hits.
PROSITEⁱ	PS50929. ABC_TM1F. 2 hits. PS00211. ABC_TRANSPORTER_1. 2 hits. PS50893. ABC_TRANSPORTER_2. 2 hits. [Graphical view]

Sequences (2)ⁱ

Sequence statusⁱ: Complete.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket Added to basket

Isoform 1 (identifier: P08183-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLEGDRNGG AKKKNFFKLN NKSEKDKKEK KPTVSVFSMF RYSNWLDKLY 
        60         70         80         90        100
MVVGTLAAII HGAGLPLMML VFGEMTDIFA NAGNLEDLMS NITNRSDIND 
       110        120        130        140        150
TGFFMNLEED MTRYAYYYSG IGAGVLVAAY IQVSFWCLAA GRQIHKIRKQ 
       160        170        180        190        200
FFHAIMRQEI GWFDVHDVGE LNTRLTDDVS KINEGIGDKI GMFFQSMATF 
       210        220        230        240        250
FTGFIVGFTR GWKLTLVILA ISPVLGLSAA VWAKILSSFT DKELLAYAKA 
       260        270        280        290        300
GAVAEEVLAA IRTVIAFGGQ KKELERYNKN LEEAKRIGIK KAITANISIG 
       310        320        330        340        350
AAFLLIYASY ALAFWYGTTL VLSGEYSIGQ VLTVFFSVLI GAFSVGQASP 
       360        370        380        390        400
SIEAFANARG AAYEIFKIID NKPSIDSYSK SGHKPDNIKG NLEFRNVHFS 
       410        420        430        440        450
YPSRKEVKIL KGLNLKVQSG QTVALVGNSG CGKSTTVQLM QRLYDPTEGM 
       460        470        480        490        500
VSVDGQDIRT INVRFLREII GVVSQEPVLF ATTIAENIRY GRENVTMDEI 
       510        520        530        540        550
EKAVKEANAY DFIMKLPHKF DTLVGERGAQ LSGGQKQRIA IARALVRNPK 
       560        570        580        590        600
ILLLDEATSA LDTESEAVVQ VALDKARKGR TTIVIAHRLS TVRNADVIAG 
       610        620        630        640        650
FDDGVIVEKG NHDELMKEKG IYFKLVTMQT AGNEVELENA ADESKSEIDA 
       660        670        680        690        700
LEMSSNDSRS SLIRKRSTRR SVRGSQAQDR KLSTKEALDE SIPPVSFWRI 
       710        720        730        740        750
MKLNLTEWPY FVVGVFCAII NGGLQPAFAI IFSKIIGVFT RIDDPETKRQ 
       760        770        780        790        800
NSNLFSLLFL ALGIISFITF FLQGFTFGKA GEILTKRLRY MVFRSMLRQD 
       810        820        830        840        850
VSWFDDPKNT TGALTTRLAN DAAQVKGAIG SRLAVITQNI ANLGTGIIIS 
       860        870        880        890        900
FIYGWQLTLL LLAIVPIIAI AGVVEMKMLS GQALKDKKEL EGSGKIATEA 
       910        920        930        940        950
IENFRTVVSL TQEQKFEHMY AQSLQVPYRN SLRKAHIFGI TFSFTQAMMY 
       960        970        980        990       1000
FSYAGCFRFG AYLVAHKLMS FEDVLLVFSA VVFGAMAVGQ VSSFAPDYAK 
      1010       1020       1030       1040       1050
AKISAAHIIM IIEKTPLIDS YSTEGLMPNT LEGNVTFGEV VFNYPTRPDI 
      1060       1070       1080       1090       1100
PVLQGLSLEV KKGQTLALVG SSGCGKSTVV QLLERFYDPL AGKVLLDGKE 
      1110       1120       1130       1140       1150
IKRLNVQWLR AHLGIVSQEP ILFDCSIAEN IAYGDNSRVV SQEEIVRAAK 
      1160       1170       1180       1190       1200
EANIHAFIES LPNKYSTKVG DKGTQLSGGQ KQRIAIARAL VRQPHILLLD 
      1210       1220       1230       1240       1250
EATSALDTES EKVVQEALDK AREGRTCIVI AHRLSTIQNA DLIVVFQNGR 
      1260       1270       1280
VKEHGTHQQL LAQKGIYFSM VSVQAGTKRQ

Length:1,280

Mass (Da):141,479

Last modified:May 26, 2009 - v3

Checksum:ⁱF0230744AB288C73

GO

Isoform 2 (identifier: P08183-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
113-177: RYAYYYSGIGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTD → S

« Hide

        10         20         30         40         50
MDLEGDRNGG AKKKNFFKLN NKSEKDKKEK KPTVSVFSMF RYSNWLDKLY 
        60         70         80         90        100
MVVGTLAAII HGAGLPLMML VFGEMTDIFA NAGNLEDLMS NITNRSDIND 
       110        120        130        140        150
TGFFMNLEED MTSDVSKINE GIGDKIGMFF QSMATFFTGF IVGFTRGWKL 
       160        170        180        190        200
TLVILAISPV LGLSAAVWAK ILSSFTDKEL LAYAKAGAVA EEVLAAIRTV 
       210        220        230        240        250
IAFGGQKKEL ERYNKNLEEA KRIGIKKAIT ANISIGAAFL LIYASYALAF 
       260        270        280        290        300
WYGTTLVLSG EYSIGQVLTV FFSVLIGAFS VGQASPSIEA FANARGAAYE 
       310        320        330        340        350
IFKIIDNKPS IDSYSKSGHK PDNIKGNLEF RNVHFSYPSR KEVKILKGLN 
       360        370        380        390        400
LKVQSGQTVA LVGNSGCGKS TTVQLMQRLY DPTEGMVSVD GQDIRTINVR 
       410        420        430        440        450
FLREIIGVVS QEPVLFATTI AENIRYGREN VTMDEIEKAV KEANAYDFIM 
       460        470        480        490        500
KLPHKFDTLV GERGAQLSGG QKQRIAIARA LVRNPKILLL DEATSALDTE 
       510        520        530        540        550
SEAVVQVALD KARKGRTTIV IAHRLSTVRN ADVIAGFDDG VIVEKGNHDE 
       560        570        580        590        600
LMKEKGIYFK LVTMQTAGNE VELENAADES KSEIDALEMS SNDSRSSLIR 
       610        620        630        640        650
KRSTRRSVRG SQAQDRKLST KEALDESIPP VSFWRIMKLN LTEWPYFVVG 
       660        670        680        690        700
VFCAIINGGL QPAFAIIFSK IIGVFTRIDD PETKRQNSNL FSLLFLALGI 
       710        720        730        740        750
ISFITFFLQG FTFGKAGEIL TKRLRYMVFR SMLRQDVSWF DDPKNTTGAL 
       760        770        780        790        800
TTRLANDAAQ VKGAIGSRLA VITQNIANLG TGIIISFIYG WQLTLLLLAI 
       810        820        830        840        850
VPIIAIAGVV EMKMLSGQAL KDKKELEGSG KIATEAIENF RTVVSLTQEQ 
       860        870        880        890        900
KFEHMYAQSL QVPYRNSLRK AHIFGITFSF TQAMMYFSYA GCFRFGAYLV 
       910        920        930        940        950
AHKLMSFEDV LLVFSAVVFG AMAVGQVSSF APDYAKAKIS AAHIIMIIEK 
       960        970        980        990       1000
TPLIDSYSTE GLMPNTLEGN VTFGEVVFNY PTRPDIPVLQ GLSLEVKKGQ 
      1010       1020       1030       1040       1050
TLALVGSSGC GKSTVVQLLE RFYDPLAGKV LLDGKEIKRL NVQWLRAHLG 
      1060       1070       1080       1090       1100
IVSQEPILFD CSIAENIAYG DNSRVVSQEE IVRAAKEANI HAFIESLPNK 
      1110       1120       1130       1140       1150
YSTKVGDKGT QLSGGQKQRI AIARALVRQP HILLLDEATS ALDTESEKVV 
      1160       1170       1180       1190       1200
QEALDKAREG RTCIVIAHRL STIQNADLIV VFQNGRVKEH GTHQQLLAQK 
      1210 
GIYFSMVSVQ AGTKRQ

Show »

Length:1,216

Mass (Da):134,032

Checksum:ⁱ227233F5F2259A8C

GO

Sequence cautionⁱ

The sequence AAM49149 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature key	Position(s)	Length	Description	Graphical view	Feature identifier	Actions
Sequence conflictⁱ	23 – 23	1	S → R in CAA41558 (PubMed:2568832).Curated
Sequence conflictⁱ	336 – 336	1	Missing in AAB69423 (PubMed:9038218).Curated

Polymorphismⁱ

Genetic variation in ABCB1 may play a role in patients who do not respond to drug treatment.3 Publications

Natural variant

Feature key	Position(s)	Length	Description	Feature identifier
Natural variantⁱ	17 – 17	1	F → L.1 Publication Manual assertion based on experiment inⁱ Ref.5 NIEHS SNPs program Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251. Corresponds to variant rs28381804 [ dbSNP \| Ensembl ].	VAR_022276
Natural variantⁱ	21 – 21	1	N → D.5 Publications Manual assertion based on experiment inⁱ Ref.5 NIEHS SNPs program Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251. Ref.6 "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASP-21. Ref.17 "A new polymorphism (N21D) in the exon 2 of the human MDR1 gene encoding the P-glycoprotein." Decleves X., Chevillard S., Charpentier C., Vielh P., Laplanche J.-L. Hum. Mutat. 15:486-486(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ASP-21. Ref.18 "Functional polymorphisms of the human multidrug-resistance gene: multiple sequence variations and correlation of one allele with P-glycoprotein expression and activity in vivo." Hoffmeyer S., Burk O., von Richter O., Arnold H.P., Brockmoeller J., Johne A., Cascorbi I., Gerloff T., Roots I., Eichelbaum M., Brinkmann U. Proc. Natl. Acad. Sci. U.S.A. 97:3473-3478(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASP-21; LEU-103 AND ASN-400. Ref.19 "Frequency of single nucleotide polymorphisms in the P-glycoprotein drug transporter MDR1 gene in white subjects." Cascorbi I., Gerloff T., Johne A., Meisel C., Hoffmeyer S., Schwab M., Schaeffeler E., Eichelbaum M., Brinkmann U., Roots I. Clin. Pharmacol. Ther. 69:169-174(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASP-21; ASN-400; ALA-893; THR-893 AND PRO-1107. Corresponds to variant rs9282564 [ dbSNP \| Ensembl ].	VAR_014704
Natural variantⁱ	44 – 44	1	N → S. Corresponds to variant rs1202183 [ dbSNP \| Ensembl ].	VAR_055423
Natural variantⁱ	80 – 80	1	A → E. Corresponds to variant rs9282565 [ dbSNP \| Ensembl ].	VAR_055424
Natural variantⁱ	103 – 103	1	F → L Rare polymorphism. 1 Publication Manual assertion based on experiment inⁱ Ref.18 "Functional polymorphisms of the human multidrug-resistance gene: multiple sequence variations and correlation of one allele with P-glycoprotein expression and activity in vivo." Hoffmeyer S., Burk O., von Richter O., Arnold H.P., Brockmoeller J., Johne A., Cascorbi I., Gerloff T., Roots I., Eichelbaum M., Brinkmann U. Proc. Natl. Acad. Sci. U.S.A. 97:3473-3478(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASP-21; LEU-103 AND ASN-400.	VAR_015001
Natural variantⁱ	108 – 108	1	E → K.1 Publication Manual assertion based on experiment inⁱ Ref.20 "Polymorphism of MDR1 gene in healthy Japanese subjects: a novel SNP with an amino acid substitution (Glu108Lys)." Honda T., Dan Y., Koyabu N., Ieiri I., Otsubo K., Higuchi S., Ohtani H., Sawada J. Drug Metab. Pharmacokinet. 17:479-481(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LYS-108.	VAR_018351
Natural variantⁱ	185 – 185	1	G → V in a colchicine-selected multidrug-resistant cell line; confers increased resistance to colchicine. 3 Publications Manual assertion based on experiment inⁱ Ref.1 "Internal duplication and homology with bacterial transport proteins in the mdr1 (P-glycoprotein) gene from multidrug-resistant human cells." Chen C.-J., Chin J.E., Ueda K., Clark D.P., Pastan I., Gottesman M.M., Roninson I.B. Cell 47:381-389(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-185 AND ALA-893, POLYMORPHISM. Ref.3 "Multidrug-resistant human sarcoma cells with a mutant P-glycoprotein, altered phenotype, and resistance to cyclosporins." Chen G., Duran G.E., Steger K.A., Lacayo N.J., Jaffrezou J.P., Dumontet C., Sikic B.I. J. Biol. Chem. 272:5974-5982(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-185 AND ALA-893, POLYMORPHISM. Ref.15 "An altered pattern of cross-resistance in multidrug-resistant human cells results from spontaneous mutations in the mdr1 (P-glycoprotein) gene." Choi K.H., Chen C.-J., Kriegler M., Roninson I.B. Cell 53:519-529(1988) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT VAL-185, POLYMORPHISM. Corresponds to variant rs1128501 [ dbSNP \| Ensembl ].	VAR_015002
Natural variantⁱ	261 – 261	1	I → V. Corresponds to variant rs36008564 [ dbSNP \| Ensembl ].	VAR_055425
Natural variantⁱ	400 – 400	1	S → N.3 Publications Manual assertion based on experiment inⁱ Ref.5 NIEHS SNPs program Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251. Ref.18 "Functional polymorphisms of the human multidrug-resistance gene: multiple sequence variations and correlation of one allele with P-glycoprotein expression and activity in vivo." Hoffmeyer S., Burk O., von Richter O., Arnold H.P., Brockmoeller J., Johne A., Cascorbi I., Gerloff T., Roots I., Eichelbaum M., Brinkmann U. Proc. Natl. Acad. Sci. U.S.A. 97:3473-3478(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASP-21; LEU-103 AND ASN-400. Ref.19 "Frequency of single nucleotide polymorphisms in the P-glycoprotein drug transporter MDR1 gene in white subjects." Cascorbi I., Gerloff T., Johne A., Meisel C., Hoffmeyer S., Schwab M., Schaeffeler E., Eichelbaum M., Brinkmann U., Roots I. Clin. Pharmacol. Ther. 69:169-174(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASP-21; ASN-400; ALA-893; THR-893 AND PRO-1107. Corresponds to variant rs2229109 [ dbSNP \| Ensembl ].	VAR_015003
Natural variantⁱ	566 – 566	1	E → K.1 Publication Manual assertion based on experiment inⁱ Ref.5 NIEHS SNPs program Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251. Corresponds to variant rs28381902 [ dbSNP \| Ensembl ].	VAR_022277
Natural variantⁱ	593 – 593	1	R → C.1 Publication Manual assertion based on experiment inⁱ Ref.5 NIEHS SNPs program Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251. Corresponds to variant rs28381914 [ dbSNP \| Ensembl ].	VAR_022278
Natural variantⁱ	599 – 599	1	A → T. Corresponds to variant rs2235036 [ dbSNP \| Ensembl ].	VAR_055426
Natural variantⁱ	669 – 669	1	R → C. Corresponds to variant rs35023033 [ dbSNP \| Ensembl ].	VAR_055427
Natural variantⁱ	801 – 801	1	V → M. Corresponds to variant rs2235039 [ dbSNP \| Ensembl ].	VAR_055428
Natural variantⁱ	829 – 829	1	I → V. Corresponds to variant rs2032581 [ dbSNP \| Ensembl ].	VAR_055429
Natural variantⁱ	836 – 836	1	I → V.1 Publication Manual assertion based on experiment inⁱ Ref.5 NIEHS SNPs program Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251. Corresponds to variant rs28381967 [ dbSNP \| Ensembl ].	VAR_022279
Natural variantⁱ	887 – 887	1	K → N in a colorectal cancer sample; somatic mutation. 1 Publication Manual assertion based on experiment inⁱ Ref.24 "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E. Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] ASN-887.	VAR_035737
Natural variantⁱ	893 – 893	1	S → A Common allele; associated with susceptibility to IBD13; has decreased enzyme activity. 8 Publications Manual assertion based on experiment inⁱ Ref.1 "Internal duplication and homology with bacterial transport proteins in the mdr1 (P-glycoprotein) gene from multidrug-resistant human cells." Chen C.-J., Chin J.E., Ueda K., Clark D.P., Pastan I., Gottesman M.M., Roninson I.B. Cell 47:381-389(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-185 AND ALA-893, POLYMORPHISM. Ref.2 "Genomic organization of the human multidrug resistance (MDR1) gene and origin of P-glycoproteins." Chen C.-J., Clark D.P., Ueda K., Pastan I., Gottesman M.M., Roninson I.B. J. Biol. Chem. 265:506-514(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ALA-893. Ref.3 "Multidrug-resistant human sarcoma cells with a mutant P-glycoprotein, altered phenotype, and resistance to cyclosporins." Chen G., Duran G.E., Steger K.A., Lacayo N.J., Jaffrezou J.P., Dumontet C., Sikic B.I. J. Biol. Chem. 272:5974-5982(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS VAL-185 AND ALA-893, POLYMORPHISM. Ref.5 NIEHS SNPs program Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251. Ref.16 "Genetic polymorphism in MDR-1: a tool for examining allelic expression in normal cells, unselected and drug-selected cell lines, and human tumors." Mickley L.A., Lee J.-S., Weng Z., Zhan Z., Alvarez M., Wilson W., Bates S.E., Fojo T. Blood 91:1749-1756(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ALA-893 AND THR-999. Ref.19 "Frequency of single nucleotide polymorphisms in the P-glycoprotein drug transporter MDR1 gene in white subjects." Cascorbi I., Gerloff T., Johne A., Meisel C., Hoffmeyer S., Schwab M., Schaeffeler E., Eichelbaum M., Brinkmann U., Roots I. Clin. Pharmacol. Ther. 69:169-174(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASP-21; ASN-400; ALA-893; THR-893 AND PRO-1107. Ref.22 "Three hundred twenty-six genetic variations in genes encoding nine members of ATP-binding cassette, subfamily B (ABCB/MDR/TAP), in the Japanese population." Saito S., Iida A., Sekine A., Miura Y., Ogawa C., Kawauchi S., Higuchi S., Nakamura Y. J. Hum. Genet. 47:38-50(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ALA-893 AND THR-893. Ref.23 "MDR1 Ala893 polymorphism is associated with inflammatory bowel disease." Brant S.R., Panhuysen C.I.M., Nicolae D., Reddy D.M., Bonen D.K., Karaliukas R., Zhang L., Swanson E., Datta L.W., Moran T., Ravenhill G., Duerr R.H., Achkar J.-P., Karban A.S., Cho J.H. Am. J. Hum. Genet. 73:1282-1292(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ALA-893 AND THR-893, ASSOCIATION WITH SUSCEPTIBILITY TO IBD13. Corresponds to variant rs2032582 [ dbSNP \| Ensembl ].	VAR_013361
Natural variantⁱ	893 – 893	1	S → T Rare allele. 3 Publications Manual assertion based on experiment inⁱ Ref.19 "Frequency of single nucleotide polymorphisms in the P-glycoprotein drug transporter MDR1 gene in white subjects." Cascorbi I., Gerloff T., Johne A., Meisel C., Hoffmeyer S., Schwab M., Schaeffeler E., Eichelbaum M., Brinkmann U., Roots I. Clin. Pharmacol. Ther. 69:169-174(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASP-21; ASN-400; ALA-893; THR-893 AND PRO-1107. Ref.22 "Three hundred twenty-six genetic variations in genes encoding nine members of ATP-binding cassette, subfamily B (ABCB/MDR/TAP), in the Japanese population." Saito S., Iida A., Sekine A., Miura Y., Ogawa C., Kawauchi S., Higuchi S., Nakamura Y. J. Hum. Genet. 47:38-50(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ALA-893 AND THR-893. Ref.23 "MDR1 Ala893 polymorphism is associated with inflammatory bowel disease." Brant S.R., Panhuysen C.I.M., Nicolae D., Reddy D.M., Bonen D.K., Karaliukas R., Zhang L., Swanson E., Datta L.W., Moran T., Ravenhill G., Duerr R.H., Achkar J.-P., Karban A.S., Cho J.H. Am. J. Hum. Genet. 73:1282-1292(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ALA-893 AND THR-893, ASSOCIATION WITH SUSCEPTIBILITY TO IBD13. Corresponds to variant rs2032582 [ dbSNP \| Ensembl ].	VAR_013362
Natural variantⁱ	986 – 986	1	M → V.	VAR_018352
Natural variantⁱ	999 – 999	1	A → T.1 Publication Manual assertion based on experiment inⁱ Ref.16 "Genetic polymorphism in MDR-1: a tool for examining allelic expression in normal cells, unselected and drug-selected cell lines, and human tumors." Mickley L.A., Lee J.-S., Weng Z., Zhan Z., Alvarez M., Wilson W., Bates S.E., Fojo T. Blood 91:1749-1756(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ALA-893 AND THR-999.	VAR_015004
Natural variantⁱ	1051 – 1051	1	P → A.1 Publication Manual assertion based on experiment inⁱ Ref.5 NIEHS SNPs program Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251. Corresponds to variant rs28401798 [ dbSNP \| Ensembl ].	VAR_022280
Natural variantⁱ	1107 – 1107	1	Q → P.1 Publication Manual assertion based on experiment inⁱ Ref.19 "Frequency of single nucleotide polymorphisms in the P-glycoprotein drug transporter MDR1 gene in white subjects." Cascorbi I., Gerloff T., Johne A., Meisel C., Hoffmeyer S., Schwab M., Schaeffeler E., Eichelbaum M., Brinkmann U., Roots I. Clin. Pharmacol. Ther. 69:169-174(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ASP-21; ASN-400; ALA-893; THR-893 AND PRO-1107. Corresponds to variant rs55852620 [ dbSNP \| Ensembl ].	VAR_015005
Natural variantⁱ	1141 – 1141	1	S → T.1 Publication Manual assertion based on experiment inⁱ Ref.5 NIEHS SNPs program Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251. Corresponds to variant rs2229107 [ dbSNP \| Ensembl ].	VAR_022281
Natural variantⁱ	1251 – 1251	1	V → I.2 Publications Manual assertion based on experiment inⁱ Ref.5 NIEHS SNPs program Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LEU-17; ASP-21; ASN-400; LYS-566; CYS-593; VAL-836; ALA-893; ALA-1051; THR-1141 AND ILE-1251. Ref.21 "Twelve novel single nucleotide polymorphisms in ABCB1/MDR1 among Japanese patients with ventricular tachycardia who were administered amiodarone." Itoda M., Saito Y., Komamura K., Ueno K., Kamakura S., Ozawa S., Sawada J. Drug Metab. Pharmacokinet. 17:566-571(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ILE-1251. Corresponds to variant rs28364274 [ dbSNP \| Ensembl ].	VAR_018353

Alternative sequence

Feature key	Position(s)	Length	Description	Graphical view	Feature identifier	Actions
Alternative sequenceⁱ	113 – 177	65	RYAYY…TRLTD → S in isoform 2. 1 Publication Manual assertion based on opinion inⁱ Ref.4 "Cloning of P-glycoprotein cDNA sequence from breast cancer MCF7 cell line." Jiang Y., Sun Q., Xie Z., Liu F., Xu W., Wang Y. Submitted (JUN-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).		VSP_055769	Add BLAST

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M14758 mRNA. Translation: AAA59575.1. M29447 M29446 Genomic DNA. Translation: AAA59576.1. AF016535 mRNA. Translation: AAB69423.1. EU854148 mRNA. Translation: ACF94688.1. AY910577 Genomic DNA. Translation: AAW82430.1. AK290159 mRNA. Translation: BAF82848.1. AC002457 Genomic DNA. Translation: AAM49149.1. Sequence problems. AC005068 Genomic DNA. No translation available. M37724 Genomic DNA. Translation: AAA88047.1. M37725 Genomic DNA. Translation: AAA88048.1. X58723 Genomic DNA. Translation: CAA41558.1.
CCDSⁱ	CCDS5608.1. [P08183-1]
PIRⁱ	A34914. DVHU1.
RefSeqⁱ	NP_000918.2. NM_000927.4. [P08183-1]
UniGeneⁱ	Hs.489033. Hs.689936. Hs.737655.

Genome annotation databases

Ensemblⁱ	ENST00000265724; ENSP00000265724; ENSG00000085563. [P08183-1] ENST00000543898; ENSP00000444095; ENSG00000085563. [P08183-2] ENST00000622132; ENSP00000478255; ENSG00000085563. [P08183-1]
GeneIDⁱ	5243.
KEGGⁱ	hsa:5243.
UCSCⁱ	uc003uiz.3. human. [P08183-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Cross-referencesⁱ

Web resourcesⁱ

Atlas of Genetics and Cytogenetics in Oncology and Haematology

NIEHS-SNPs

SHMPD

The Singapore human mutation and polymorphism database

Wikipedia

P-glycoprotein entry

ABCMdb

Database for mutations in ABC proteins

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M14758 mRNA. Translation: AAA59575.1. M29447 M29446 Genomic DNA. Translation: AAA59576.1. AF016535 mRNA. Translation: AAB69423.1. EU854148 mRNA. Translation: ACF94688.1. AY910577 Genomic DNA. Translation: AAW82430.1. AK290159 mRNA. Translation: BAF82848.1. AC002457 Genomic DNA. Translation: AAM49149.1. Sequence problems. AC005068 Genomic DNA. No translation available. M37724 Genomic DNA. Translation: AAA88047.1. M37725 Genomic DNA. Translation: AAA88048.1. X58723 Genomic DNA. Translation: CAA41558.1.
CCDSⁱ	CCDS5608.1. [P08183-1]
PIRⁱ	A34914. DVHU1.
RefSeqⁱ	NP_000918.2. NM_000927.4. [P08183-1]
UniGeneⁱ	Hs.489033. Hs.689936. Hs.737655.

3D structure databases

ProteinModelPortalⁱ	P08183.
SMRⁱ	P08183. Positions 31-630.
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	111262. 14 interactions.
IntActⁱ	P08183. 6 interactions.
MINTⁱ	MINT-5000901.
STRINGⁱ	9606.ENSP00000265724.

Chemistry

BindingDBⁱ	P08183.
ChEMBLⁱ	CHEMBL4302.
DrugBankⁱ	DB01193. Acebutolol. DB00316. Acetaminophen. DB00945. Acetylsalicylic acid. DB00171. Adenosine triphosphate. DB05773. ado-trastuzumab emtansine. DB08916. Afatinib. DB00518. Albendazole. DB11363. Alectinib. DB00802. Alfentanil. DB00523. Alitretinoin. DB00915. Amantadine. DB06403. Ambrisentan. DB00345. Aminohippurate. DB01118. Amiodarone. DB00321. Amitriptyline. DB00381. Amlodipine. DB00701. Amprenavir. DB00276. Amsacrine. DB06605. Apixaban. DB01169. Arsenic trioxide. DB00637. Astemizole. DB01072. Atazanavir. DB00335. Atenolol. DB01076. Atorvastatin. DB06626. Axitinib. DB00972. Azelastine. DB00207. Azithromycin. DB01086. Benzocaine. DB01244. Bepridil. DB00443. Betamethasone. DB00810. Biperiden. DB08873. Boceprevir. DB06616. Bosutinib. DB08870. Brentuximab vedotin. DB01200. Bromocriptine. DB00921. Buprenorphine. DB00490. Buspirone. DB06772. Cabazitaxel. DB00201. Caffeine. DB08907. Canagliflozin. DB00796. Candesartan. DB01197. Captopril. DB00564. Carbamazepine. DB08889. Carfilzomib. DB01136. Carvedilol. DB00520. Caspofungin. DB09063. Ceritinib. DB00608. Chloroquine. DB00477. Chlorpromazine. DB00672. Chlorpropamide. DB01239. Chlorprothixene. DB02659. Cholic Acid. DB01340. Cilazapril. DB00501. Cimetidine. DB00537. Ciprofloxacin. DB00515. Cisplatin. DB00215. Citalopram. DB01211. Clarithromycin. DB00349. Clobazam. DB00845. Clofazimine. DB00882. Clomifene. DB01242. Clomipramine. DB00575. Clonidine. DB00758. Clopidogrel. DB00257. Clotrimazole. DB00363. Clozapine. DB09065. Cobicistat. DB05239. Cobimetinib. DB01394. Colchicine. DB00286. Conjugated Estrogens. DB08865. Crizotinib. DB00531. Cyclophosphamide. DB00091. Cyclosporine. DB06695. Dabigatran etexilate. DB08912. Dabrafenib. DB09102. Daclatasvir. DB00970. Dactinomycin. DB06292. Dapagliflozin. DB01254. Dasatinib. DB00694. Daunorubicin. DB04840. Debrisoquin. DB01151. Desipramine. DB00967. Desloratadine. DB01234. Dexamethasone. DB00514. Dextromethorphan. DB00829. Diazepam. DB00586. Diclofenac. DB00255. Diethylstilbestrol. DB01396. Digitoxin. DB00390. Digoxin. DB00320. Dihydroergotamine. DB00343. Diltiazem. DB00975. Dipyridamole. DB01248. Docetaxel. DB01184. Domperidone. DB00590. Doxazosin. DB01142. Doxepin. DB00997. Doxorubicin. DB00470. Dronabinol. DB04855. Dronedarone. DB09075. Edoxaban. DB00216. Eletriptan. DB00584. Enalapril. DB08899. Enzalutamide. DB00751. Epinastine. DB01253. Ergonovine. DB00696. Ergotamine. DB00530. Erlotinib. DB00199. Erythromycin. DB00783. Estradiol. DB01196. Estramustine. DB04573. Estriol. DB00655. Estrone. DB00977. Ethinyl Estradiol. DB00773. Etoposide. DB06414. Etravirine. DB00973. Ezetimibe. DB01023. Felodipine. DB00813. Fentanyl. DB06702. Fesoterodine. DB00950. Fexofenadine. DB08874. Fidaxomicin. DB00196. Fluconazole. DB00472. Fluoxetine. DB00875. Flupentixol. DB00623. Fluphenazine. DB00690. Flurazepam. DB08906. Fluticasone furoate. DB00176. Fluvoxamine. DB00317. Gefitinib. DB00441. Gemcitabine. DB01016. Glyburide. DB00027. Gramicidin D. DB00502. Haloperidol. DB00741. Hydrocortisone. DB01050. Ibuprofen. DB09054. Idelalisib. DB00619. Imatinib. DB00458. Imipramine. DB05039. Indacaterol. DB00224. Indinavir. DB00328. Indomethacin. DB00762. Irinotecan. DB06636. Isavuconazonium. DB01167. Itraconazole. DB08820. Ivacaftor. DB00602. Ivermectin. DB01221. Ketamine. DB01587. Ketazolam. DB01026. Ketoconazole. DB00709. Lamivudine. DB00555. Lamotrigine. DB00448. Lansoprazole. DB01259. Lapatinib. DB00480. Lenalidomide. DB09078. Lenvatinib. DB01202. Levetiracetam. DB01137. Levofloxacin. DB08918. Levomilnacipran. DB00451. Levothyroxine. DB00281. Lidocaine. DB08882. Linagliptin. DB00279. Liothyronine. DB01583. Liotrix. DB00722. Lisinopril. DB08827. Lomitapide. DB00836. Loperamide. DB01601. Lopinavir. DB00455. Loratadine. DB00678. Losartan. DB00227. Lovastatin. DB00742. Mannitol. DB00934. Maprotiline. DB00643. Mebendazole. DB00358. Mefloquine. DB00351. Megestrol acetate. DB00371. Meprobamate. DB00333. Methadone. DB00563. Methotrexate. DB00959. Methylprednisolone. DB00264. Metoprolol. DB01110. Miconazole. DB00683. Midazolam. DB00834. Mifepristone. DB08893. Mirabegron. DB00305. Mitomycin. DB01204. Mitoxantrone. DB00295. Morphine. DB00688. Mycophenolate mofetil. DB01203. Nadolol. DB01183. Naloxone. DB00704. Naltrexone. DB01149. Nefazodone. DB00220. Nelfinavir. DB01400. Neostigmine. DB00622. Nicardipine. DB01115. Nifedipine. DB04868. Nilotinib. DB09079. Nintedanib. DB00401. Nisoldipine. DB01595. Nitrazepam. DB01054. Nitrendipine. DB00585. Nizatidine. DB00717. Norethisterone. DB00334. Olanzapine. DB00338. Omeprazole. DB09330. Osimertinib. DB01229. Paclitaxel. DB06603. Panobinostat. DB00213. Pantoprazole. DB00715. Paroxetine. DB06589. Pazopanib. DB00790. Perindopril. DB01174. Phenobarbital. DB00252. Phenytoin. DB01100. Pimozide. DB08860. Pitavastatin. DB08910. Pomalidomide. DB08901. Ponatinib. DB01263. Posaconazole. DB00175. Pravastatin. DB00457. Prazosin. DB00860. Prednisolone. DB00635. Prednisone. DB01032. Probenecid. DB00396. Progesterone. DB01069. Promethazine. DB01182. Propafenone. DB00571. Propranolol. DB00344. Protriptyline. DB01224. Quetiapine. DB01103. Quinacrine. DB00908. Quinidine. DB00468. Quinine. DB00863. Ranitidine. DB00234. Reboxetine. DB08896. Regorafenib. DB00206. Reserpine. DB01045. Rifampicin. DB08864. Rilpivirine. DB00734. Risperidone. DB00503. Ritonavir. DB06228. Rivaroxaban. DB09291. Rolapitant. DB06176. Romidepsin. DB00778. Roxithromycin. DB00936. Salicylic acid. DB01232. Saquinavir. DB00747. Scopolamine. DB01037. Selegiline. DB11362. Selexipag. DB01104. Sertraline. DB06207. Silodosin. DB06290. Simeprevir. DB00641. Simvastatin. DB00877. Sirolimus. DB01261. Sitagliptin. DB08934. Sofosbuvir. DB00398. Sorafenib. DB01208. Sparfloxacin. DB00421. Spironolactone. DB00428. Streptozocin. DB01138. Sulfinpyrazone. DB00669. Sumatriptan. DB01268. Sunitinib. DB00864. Tacrolimus. DB00675. Tamoxifen. DB05521. Telaprevir. DB00966. Telmisartan. DB06287. Temsirolimus. DB01162. Terazosin. DB00624. Testosterone. DB08816. Ticagrelor. DB00373. Timolol. DB06212. Tolvaptan. DB01030. Topotecan. DB00539. Toremifene. DB00656. Trazodone. DB00831. Trifluoperazine. DB00508. Triflupromazine. DB00440. Trimethoprim. DB00726. Trimipramine. DB01361. Troleandomycin. DB08867. Ulipristal. DB09076. Umeclidinium. DB01339. Vecuronium. DB00285. Venlafaxine. DB00661. Verapamil. DB00570. Vinblastine. DB00541. Vincristine. DB00361. Vinorelbine. DB08828. Vismodegib. DB04877. Voacamine. DB00495. Zidovudine.
SwissLipidsⁱ	SLP:000000385.

Protein family/group databases

MoonProtⁱ	P08183.
TCDBⁱ	3.A.1.201.1. the atp-binding cassette (abc) superfamily.

PTM databases

iPTMnetⁱ	P08183.
PhosphoSiteⁱ	P08183.

Polymorphism and mutation databases

BioMutaⁱ	ABCB1.
DMDMⁱ	238054374.

Proteomic databases

EPDⁱ	P08183.
MaxQBⁱ	P08183.
PaxDbⁱ	P08183.
PeptideAtlasⁱ	P08183.
PRIDEⁱ	P08183.

Protocols and materials databases

DNASUⁱ	5243.
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000265724; ENSP00000265724; ENSG00000085563. [P08183-1] ENST00000543898; ENSP00000444095; ENSG00000085563. [P08183-2] ENST00000622132; ENSP00000478255; ENSG00000085563. [P08183-1]
GeneIDⁱ	5243.
KEGGⁱ	hsa:5243.
UCSCⁱ	uc003uiz.3. human. [P08183-1]

Organism-specific databases

CTDⁱ	5243.
GeneCardsⁱ	ABCB1.
H-InvDB	HIX0033521.
HGNCⁱ	HGNC:40. ABCB1.
HPAⁱ	CAB001716. HPA002199.
MalaCardsⁱ	ABCB1.
MIMⁱ	171050. gene. 612244. phenotype.
neXtProtⁱ	NX_P08183.
Orphanetⁱ	771. Ulcerative colitis.
PharmGKBⁱ	PA267.
GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG0055. Eukaryota. COG1132. LUCA.
GeneTreeⁱ	ENSGT00530000062896.
HOVERGENⁱ	HBG080809.
InParanoidⁱ	P08183.
KOⁱ	K05658.
OMAⁱ	SQGQDRK.
OrthoDBⁱ	EOG091G0HVA.
PhylomeDBⁱ	P08183.
TreeFamⁱ	TF105193.

Enzyme and pathway databases

BRENDAⁱ	3.6.3.44. 2681.
Reactomeⁱ	R-HSA-2161517. Abacavir transmembrane transport. R-HSA-382556. ABC-family proteins mediated transport.

Miscellaneous databases

ChiTaRSⁱ	ABCB1. human.
GeneWikiⁱ	P-glycoprotein.
GenomeRNAiⁱ	5243.
PROⁱ	P08183.
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000085563.
CleanExⁱ	HS_ABCB1.
ExpressionAtlasⁱ	P08183. baseline and differential.
Genevisibleⁱ	P08183. HS.

Family and domain databases

Gene3Dⁱ	3.40.50.300. 2 hits.
InterProⁱ	IPR003593. AAA+_ATPase. IPR011527. ABC1_TM_dom. IPR003439. ABC_transporter-like. IPR017871. ABC_transporter_CS. IPR027417. P-loop_NTPase. [Graphical view]
Pfamⁱ	PF00664. ABC_membrane. 2 hits. PF00005. ABC_tran. 2 hits. [Graphical view]
SMARTⁱ	SM00382. AAA. 2 hits. [Graphical view]
SUPFAMⁱ	SSF52540. SSF52540. 2 hits. SSF90123. SSF90123. 2 hits.
PROSITEⁱ	PS50929. ABC_TM1F. 2 hits. PS00211. ABC_TRANSPORTER_1. 2 hits. PS50893. ABC_TRANSPORTER_2. 2 hits. [Graphical view]
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ

MDR1_HUMAN

Accessionⁱ

Primary (citable) accession number: P08183
Secondary accession number(s): A8K294

Q14812

Entry historyⁱ

Integrated into UniProtKB/Swiss-Prot:	August 1, 1988
Last sequence update:	May 26, 2009
Last modified:	September 7, 2016
This is version 196 of the entry and version 3 of the sequence. [Complete history]

Entry statusⁱ

Reviewed (UniProtKB/Swiss-Prot)

Annotation program

Chordata Protein Annotation Program

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

Human cell differentiation molecules
CD nomenclature of surface proteins of human leucocytes and list of entries
Human chromosome 7
Human chromosome 7: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
SIMILARITY comments
Index of protein domains and families

Similar proteinsⁱ

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:

100%	UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%	UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%	UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P08183 (MDR1_HUMAN)

UniProt

P08183 - MDR1_HUMAN

Your basket is currently empty.

Multidrug resistance protein 1

Select a section on the left to see content.

<p>Provides any useful information about the protein, mostly biological knowledge.</p><p><a href='../manual/function_section' target='_top'>More...</a></p>Functioni

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:</p><p><a href='../manual/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:</p><p><a href='../manual/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Protein family/group databases

Chemistry

<p>Provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.</p><p><a href='../manual/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>Provides information on the location and the topology of the mature protein in the cell.</p><p><a href='../manual/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:</p><p><a href='../manual/gene_ontology' target='_top'>More...</a></p>GO - Cellular componenti

<p>Provides information on the disease(s) and phenotype(s) associated with a protein.</p><p><a href='../manual/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Inflammatory bowel disease 13 (IBD13)

Organism-specific databases

Chemistry

Polymorphism and mutation databases

<p>Describes post-translational modifications (PTMs) and/or processing events.</p><p><a href='../manual/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Proteomic databases

PTM databases

<p>Provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.</p><p><a href='../manual/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>Provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.</p><p><a href='../manual/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Chemistry

<p>Provides information on the tertiary and secondary structure of a protein.</p><p><a href='../manual/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>Provides information on sequence similarities with other proteins and the domain(s) present in a protein.</p><p><a href='../manual/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

<p>Provides information about the sequence similarity with other proteins.</p><p><a href='../manual/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

<p>Displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including length and molecular weight.</p><p><a href='../manual/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>Reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.</p><p><a href='../manual/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

<p>Is used to point to information related to entries and found in data collections other than UniProtKB.</p><p><a href='../manual/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>Provides links to various web resources that are relevant for a specific protein.</p><p><a href='../manual/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry

Protein family/group databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>Provides general information on the entry.</p><p><a href='../manual/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>Contains any relevant information that doesn’t fit in any other defined sections</p><p><a href='../manual/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Documents

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Sequences (2)ⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ