Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P08101 (FCGR2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 143. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Low affinity immunoglobulin gamma Fc region receptor II
Alternative name(s):
Fc gamma receptor IIB
Short name=Fc-gamma RII
Short name=Fc-gamma-RIIB
Short name=FcRII
IgG Fc receptor II beta
Lymphocyte antigen 17
Short name=Ly-17
CD_antigen=CD32
Gene names
Name:Fcgr2
Synonyms:Fcgr2b, Ly-17
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length330 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of antigen-antibody complexes from the circulation and modulation of antibody production by B-cells. Isoform IIB1 and isoform IIB1' form caps but fail to mediate endocytosis or phagocytosis. Isoform IIB2 can mediate the endocytosis of soluble immune complexes via clathrin-coated pits. Isoform IIB1 and isoform IIB2 can down-regulate B-cell, T-cell, and mast cell activation when coaggregated to B-cell receptors for AG (BCR), T-cell receptors for AG (TCR), and Fc receptors, respectively.

Subunit structure

Interacts with FGR By similarity. Interacts with LYN. Ref.10

Subcellular location

Cell membrane; Single-pass type I membrane protein.

Isoform IIB1: Cytoplasmcytoskeleton. Note: Binds the cytoskeleton and is not localized in endocytotic pits.

Isoform IIB3: Secreted. Note: Released as a soluble molecule.

Tissue specificity

Widely expressed by cells of hemopoietic origin. The isoforms are differentially expressed. Isoform IIB1 is preferentially expressed by cells of the lymphoid lineage, isoform IIB2 by cells of the myeloid lineage, and isoform IIB3 is released by macrophages and is present in the serum. Isoform IIB1' is expressed in myeloid and lymphoid cell lines, in normal spleen cells, and in resting or LPS-activated B-cells but is not detected in mesenteric lymph node cells.

Domain

Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. Another tyrosine-containing sequence, more C-terminal, accounts for the ability of isoform IIB2 to trigger the phagocytosis of particulate immuno complexes.

Post-translational modification

Glycosylated.

When coaggregated to BCR, isoform IIB1 and isoform IIB1' become tyrosine phosphorylated and bind to the SH2 domains of the protein tyrosine phosphatase PTPC1. Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN and SYK By similarity. Ref.10 Ref.11

Polymorphism

Ly-17 alloantigenic system involves residues 116 and 161. Ly-17.1 mice are Pro-116 and Glu-161; Ly-17.2 mice are Leu-116 and Leu-161. These polymorphisms do not affect IgG binding.

Sequence similarities

Contains 2 Ig-like C2-type (immunoglobulin-like) domains.

Sequence caution

The sequence CAA28309.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentCell membrane
Cytoplasm
Cytoskeleton
Membrane
Secreted
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainImmunoglobulin domain
Repeat
Signal
Transmembrane
Transmembrane helix
   LigandIgG-binding protein
   Molecular functionReceptor
   PTMDisulfide bond
Glycoprotein
Phosphoprotein
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processantigen processing and presentation of exogenous peptide antigen via MHC class II

Inferred from mutant phenotype PubMed 14643301. Source: MGI

cell surface receptor signaling pathway

Inferred from mutant phenotype PubMed 8552190. Source: MGI

cellular response to molecule of bacterial origin

Inferred from mutant phenotype PubMed 12385742. Source: MGI

defense response

Inferred from mutant phenotype PubMed 11994421. Source: MGI

immune response

Inferred from mutant phenotype PubMed 11994421. Source: MGI

immunoglobulin mediated immune response

Inferred from mutant phenotype PubMed 10395649PubMed 14643301. Source: MGI

intracellular signal transduction

Traceable author statement PubMed 11994421. Source: GOC

negative regulation of B cell proliferation

Inferred from mutant phenotype PubMed 12385742PubMed 8552190. Source: MGI

negative regulation of acute inflammatory response to antigenic stimulus

Inferred from mutant phenotype PubMed 12385742. Source: MGI

negative regulation of humoral immune response mediated by circulating immunoglobulin

Inferred from mutant phenotype PubMed 12385742. Source: MGI

negative regulation of immune response

Inferred from mutant phenotype PubMed 10395649PubMed 8552190. Source: MGI

negative regulation of immunoglobulin production

Inferred from mutant phenotype PubMed 12385742. Source: MGI

negative regulation of inflammatory response to antigenic stimulus

Inferred from mutant phenotype PubMed 16492738. Source: MGI

negative regulation of interleukin-10 production

Inferred from mutant phenotype PubMed 12385742. Source: MGI

negative regulation of phagocytosis

Inferred from mutant phenotype PubMed 12385742. Source: MGI

negative regulation of type I hypersensitivity

Inferred from mutant phenotype PubMed 8552190. Source: MGI

phagocytosis, engulfment

Inferred from direct assay PubMed 8769481. Source: MGI

positive regulation of phagocytosis

Inferred from direct assay PubMed 8769481. Source: MGI

response to bacterium

Inferred from mutant phenotype PubMed 12385742. Source: MGI

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-KW

cytoskeleton

Inferred from electronic annotation. Source: UniProtKB-SubCell

external side of plasma membrane

Inferred from direct assay PubMed 8552190PubMed 8769481. Source: MGI

extracellular region

Inferred from electronic annotation. Source: UniProtKB-SubCell

integral component of membrane

Inferred from direct assay PubMed 8552190. Source: MGI

integral component of plasma membrane

Inferred by curator PubMed 8552190. Source: MGI

   Molecular_functionIgG binding

Inferred from direct assay PubMed 9551950. Source: MGI

receptor signaling protein activity

Traceable author statement PubMed 11994421. Source: MGI

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform IIB1 (identifier: P08101-1)

Also known as: Beta-1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform IIB2 (identifier: P08101-2)

Also known as: Beta-2;

The sequence of this isoform differs from the canonical sequence as follows:
     243-290: ALPGNPDHREMGETLPEEVGEYRQPSGGSVPVSPGPPSGLEPTSSSPY → D
Isoform IIB1' (identifier: P08101-3)

Also known as: Beta-1';

The sequence of this isoform differs from the canonical sequence as follows:
     262-290: GEYRQPSGGSVPVSPGPPSGLEPTSSSPY → D
Isoform IIB3 (identifier: P08101-4)

Also known as: Beta-3;

The sequence of this isoform is not available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2929 Ref.1
Chain30 – 330301Low affinity immunoglobulin gamma Fc region receptor II
PRO_0000015143

Regions

Topological domain30 – 210181Extracellular Potential
Transmembrane211 – 23121Helical; Potential
Topological domain232 – 33099Cytoplasmic Potential
Domain50 – 10657Ig-like C2-type 1
Domain131 – 18959Ig-like C2-type 2
Motif307 – 3126ITIM motif

Amino acid modifications

Modified residue2901Phosphotyrosine Ref.11
Modified residue3091Phosphotyrosine; by SRC-type Tyr-kinases By similarity
Modified residue3261Phosphotyrosine Ref.11
Glycosylation651N-linked (GlcNAc...) Potential
Glycosylation921N-linked (GlcNAc...) Potential
Glycosylation1661N-linked (GlcNAc...) Potential
Glycosylation1731N-linked (GlcNAc...) Potential
Disulfide bond57 ↔ 99 By similarity
Disulfide bond138 ↔ 182 By similarity

Natural variations

Alternative sequence243 – 29048ALPGN…SSSPY → D in isoform IIB2.
VSP_002640
Alternative sequence262 – 29029GEYRQ…SSSPY → D in isoform IIB1'.
VSP_002641
Natural variant1161S → L in strain: DBA/2; Ly17.2 allotype.
Natural variant1161S → P in strain: NZB; Ly17.1 allotype.
Natural variant1451L → P.
Natural variant1611H → L in strain: DBA/2; Ly17.2 allotype.
Natural variant1611H → Q in strain: NZB; Ly17.1 allotype.
Natural variant1901L → Q.
Natural variant1951P → T in strain: NZB.
Natural variant2871S → I in strain: NZB.

Experimental info

Sequence conflict270 – 2789GSVPVSPGP → LSACQPRA in AAA37608. Ref.1
Sequence conflict2991A → P Ref.3
Sequence conflict2991A → P Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform IIB1 (Beta-1) [UniParc].

Last modified November 1, 1997. Version 2.
Checksum: A463B9EFF2717511

FASTA33036,695
        10         20         30         40         50         60 
MESNWTVHVF SRTLCHMLLW TAVLNLAAGT HDLPKAVVKL EPPWIQVLKE DTVTLTCEGT 

        70         80         90        100        110        120 
HNPGNSSTQW FHNGRSIRSQ VQASYTFKAT VNDSGEYRCQ MEQTRLSDPV DLGVISDWLL 

       130        140        150        160        170        180 
LQTPQLVFLE GETITLRCHS WRNKLLNRIS FFHNEKSVRY HHYSSNFSIP KANHSHSGDY 

       190        200        210        220        230        240 
YCKGSLGRTL HQSKPVTITV QGPKSSRSLP VLTIVAAVTG IAVAAIVIIL VSLVYLKKKQ 

       250        260        270        280        290        300 
VPALPGNPDH REMGETLPEE VGEYRQPSGG SVPVSPGPPS GLEPTSSSPY NPPDLEEAAK 

       310        320        330 
TEAENTITYS LLKHPEALDE ETEHDYQNHI 

« Hide

Isoform IIB2 (Beta-2) [UniParc].

Checksum: 84718A2D4D82EC89
Show »

FASTA28331,881
Isoform IIB1' (Beta-1') [UniParc].

Checksum: 7706C4ADE2EF2CB9
Show »

FASTA30233,954
Isoform IIB3 (Beta-3) (Sequence not available).

References

[1]"Structural heterogeneity and functional domains of murine immunoglobulin G Fc receptors."
Ravetch J.V., Luster A.D., Weinshank R., Kochan J., Pavlovec A., Portnoy D.A., Hulmes J., Pan Y.-C.E., Unkeless J.C.
Science 234:718-725(1986) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 30-51 (ISOFORMS IIB1 AND IIB2).
[2]"A complementary DNA clone for a macrophage-lymphocyte Fc receptor."
Lewis V.A., Koch T., Plutner H., Mellman I.
Nature 324:372-375(1986) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIB2).
Tissue: Macrophage.
[3]"The mouse Fc receptor for IgG (Ly-17): molecular cloning and specificity."
Hogarth P.M., Hibbs M.L., Bonadonna L., Scott B.M., Witort E., Pietersz G.A., McKenzie I.F.C.
Immunogenetics 26:161-168(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE (ISOFORM IIB1).
[4]"Identification of the mouse beta Fc gamma RII polymorphism by direct sequencing of amplified genomic DNA."
Lah M., Quelch K., Deacon N.J., McKenzie I.F., Hogarth P.M.
Immunogenetics 31:202-206(1990) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM IIB1), VARIANTS.
Strain: BALB/c.
Tissue: Spleen.
[5]"Structure of the mouse beta Fc gamma receptor II gene."
Hogarth P.M., Witort E., Hulett M.D., Bonnerot C., Even J., Fridman W.H., McKenzie I.F.C.
J. Immunol. 146:369-376(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS IIB1 AND IIB2).
[6]"Identification, molecular cloning, biologic properties, and tissue distribution of a novel isoform of murine low-affinity IgG receptor homologous to human Fc gamma RIIB1."
Latour S., Fridman W.H., Daeron M.
J. Immunol. 157:189-197(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIB1').
Strain: DBA/2.
Tissue: Mast cell.
[7]"Nonsynonymous mutations in an Fc-receptor structural gene in NZB mice."
Sawchuk D.J., Mahmoudi M., Cairns E., Sinclair N.R.S.
Immunogenetics 43:112-113(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 30-330 (ISOFORMS IIB1 AND IIB2).
Strain: DBA/2 and NZB.
Tissue: Spleen.
[8]"The murine Fc receptor for immunoglobulin: purification, partial amino acid sequence, and isolation of cDNA clones."
Hibbs M.L., Walker I.D., Kirszbaum L., Peitersz G.A., Deacon N.J., Chambers G.W., McKenzie I.F.C., Hogarth P.M.
Proc. Natl. Acad. Sci. U.S.A. 83:6980-6984(1986) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-45.
[9]"Identification, in mouse macrophages and in serum, of a soluble receptor for the Fc portion of IgG (Fc gamma R) encoded by an alternatively spliced transcript of the Fc gamma RII gene."
Tartour E., de la Salle H., de la Salle C., Teillaud C., Camoin L., Galinha A., Latour S., Hanau D., Fridman W.H., Sautes C.
Int. Immunol. 5:859-868(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: CHARACTERIZATION OF ISOFORM IIB3.
Tissue: Macrophage.
[10]"Fc epsilon receptor I-associated lyn-dependent phosphorylation of Fc gamma receptor IIB during negative regulation of mast cell activation."
Malbec O., Fong D.C., Turner M., Tybulewicz V.L., Cambier J.C., Fridman W.H., Daeron M.
J. Immunol. 160:1647-1658(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION, INTERACTION WITH LYN.
[11]"Mutational analysis reveals multiple distinct sites within Fc gamma receptor IIB that function in inhibitory signaling."
Fong D.C., Brauweiler A., Minskoff S.A., Bruhns P., Tamir I., Mellman I., Daeron M., Cambier J.C.
J. Immunol. 165:4453-4462(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION AT TYR-290; TYR-309 AND TYR-326.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M16367 mRNA. Translation: AAA37608.1.
M14216 mRNA. Translation: AAA37609.1.
M17515 mRNA. Translation: AAA37607.1.
M31312 Genomic DNA. Translation: AAA37610.1.
X04648 mRNA. Translation: CAA28309.1. Different initiation.
U31801 mRNA. Translation: AAA92707.1.
U31802 mRNA. Translation: AAA92708.1.
U31803 mRNA. Translation: AAA92709.1.
U31804 mRNA. Translation: AAA92710.1.
M14276 mRNA. Translation: AAA37605.1.
U51629 mRNA. Translation: AAA97464.1.
PIRA40071.
FCMSG1. B40071.
I49660.
RefSeqNP_034317.1. NM_010187.2.
UniGeneMm.425062.

3D structure databases

ProteinModelPortalP08101.
SMRP08101. Positions 34-203.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid199619. 4 interactions.
IntActP08101. 1 interaction.
STRING10090.ENSMUSP00000027966.

Protein family/group databases

MEROPSI43.001.

PTM databases

PhosphoSiteP08101.
UniCarbKBP08101.

Proteomic databases

PaxDbP08101.
PRIDEP08101.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID14130.
KEGGmmu:14130.
UCSCuc007dms.2. mouse. [P08101-1]
uc007dmt.2. mouse. [P08101-2]

Organism-specific databases

CTD2213.
MGIMGI:95499. Fcgr2b.

Phylogenomic databases

eggNOGNOG25177.
HOVERGENHBG051602.
InParanoidP08101.
KOK12560.
PhylomeDBP08101.

Gene expression databases

ArrayExpressP08101.
BgeeP08101.
CleanExMM_FCGR2B.
GenevestigatorP08101.

Family and domain databases

Gene3D2.60.40.10. 2 hits.
InterProIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view]
SMARTSM00409. IG. 2 hits.
[Graphical view]
PROSITEPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio285226.
PROP08101.
SOURCESearch...

Entry information

Entry nameFCGR2_MOUSE
AccessionPrimary (citable) accession number: P08101
Secondary accession number(s): P08102 expand/collapse secondary AC list , P12316, P97917, Q60938, Q60939, Q60940, Q61170, Q61558
Entry history
Integrated into UniProtKB/Swiss-Prot: August 1, 1988
Last sequence update: November 1, 1997
Last modified: July 9, 2014
This is version 143 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot