P08101 (FCGR2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 132.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Low affinity immunoglobulin gamma Fc region receptor II Alternative name(s): Fc gamma receptor IIB Short name=Fc-gamma RII Short name=Fc-gamma-RIIB Short name=FcRII IgG Fc receptor II beta Lymphocyte antigen 17 Short name=Ly-17 CD_antigen=CD32 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 330 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of antigen-antibody complexes from the circulation and modulation of antibody production by B-cells. Isoform IIB1 and isoform IIB1' form caps but fail to mediate endocytosis or phagocytosis. Isoform IIB2 can mediate the endocytosis of soluble immune complexes via clathrin-coated pits. Isoform IIB1 and isoform IIB2 can down-regulate B-cell, T-cell, and mast cell activation when coaggregated to B-cell receptors for AG (BCR), T-cell receptors for AG (TCR), and Fc receptors, respectively. |
| Subunit structure | Interacts with FGR By similarity. Interacts with LYN. Ref.10 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein. Isoform IIB1: Cytoplasm › cytoskeleton. Note: Binds the cytoskeleton and is not localized in endocytotic pits. Isoform IIB3: Secreted. Note: Released as a soluble molecule. |
| Tissue specificity | Widely expressed by cells of hemopoietic origin. The isoforms are differentially expressed. Isoform IIB1 is preferentially expressed by cells of the lymphoid lineage, isoform IIB2 by cells of the myeloid lineage, and isoform IIB3 is released by macrophages and is present in the serum. Isoform IIB1' is expressed in myeloid and lymphoid cell lines, in normal spleen cells, and in resting or LPS-activated B-cells but is not detected in mesenteric lymph node cells. |
| Domain | Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. Another tyrosine-containing sequence, more C-terminal, accounts for the ability of isoform IIB2 to trigger the phagocytosis of particulate immuno complexes. |
| Post-translational modification | Glycosylated. When coaggregated to BCR, isoform IIB1 and isoform IIB1' become tyrosine phosphorylated and bind to the SH2 domains of the protein tyrosine phosphatase PTPC1. Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN and SYK By similarity. Ref.10 |
| Polymorphism | Ly-17 alloantigenic system involves residues 116 and 161. Ly-17.1 mice are Pro-116 and Glu-161; Ly-17.2 mice are Leu-116 and Leu-161. These polymorphisms do not affect IgG binding. |
| Sequence similarities | Contains 2 Ig-like C2-type (immunoglobulin-like) domains. |
| Sequence caution | The sequence CAA28309.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform IIB1 (identifier: P08101-1) Also known as: Beta-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform IIB2 (identifier: P08101-2) Also known as: Beta-2; The sequence of this isoform differs from the canonical sequence as follows: 243-290: ALPGNPDHREMGETLPEEVGEYRQPSGGSVPVSPGPPSGLEPTSSSPY → D | ||||||
| Isoform IIB1' (identifier: P08101-3) Also known as: Beta-1'; The sequence of this isoform differs from the canonical sequence as follows: 262-290: GEYRQPSGGSVPVSPGPPSGLEPTSSSPY → D | ||||||
| Isoform IIB3 (identifier: P08101-4) Also known as: Beta-3; The sequence of this isoform is not available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 29 | 29 | Ref.1 | ||||||||
| Chain | 30 – 330 | 301 | Low affinity immunoglobulin gamma Fc region receptor II | PRO_0000015143 | |||||||
Regions | |||||||||||
| Topological domain | 30 – 210 | 181 | Extracellular Potential | ||||||||
| Transmembrane | 211 – 231 | 21 | Helical; Potential | ||||||||
| Topological domain | 232 – 330 | 99 | Cytoplasmic Potential | ||||||||
| Domain | 50 – 106 | 57 | Ig-like C2-type 1 | ||||||||
| Domain | 131 – 189 | 59 | Ig-like C2-type 2 | ||||||||
| Motif | 307 – 312 | 6 | ITIM motif | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 309 | 1 | Phosphotyrosine; by SRC-type Tyr-kinases By similarity | ||||||||
| Modified residue | 326 | 1 | Phosphotyrosine Ref.11 | ||||||||
| Glycosylation | 65 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 92 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 166 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 173 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 57 ↔ 99 | By similarity | |||||||||
| Disulfide bond | 138 ↔ 182 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 243 – 290 | 48 | ALPGN…SSSPY → D in isoform IIB2. | VSP_002640 | |||||||
| Alternative sequence | 262 – 290 | 29 | GEYRQ…SSSPY → D in isoform IIB1'. | VSP_002641 | |||||||
| Natural variant | 116 | 1 | S → L in strain: DBA/2; Ly17.2 allotype. | ||||||||
| Natural variant | 116 | 1 | S → P in strain: NZB; Ly17.1 allotype. | ||||||||
| Natural variant | 145 | 1 | L → P. | ||||||||
| Natural variant | 161 | 1 | H → L in strain: DBA/2; Ly17.2 allotype. | ||||||||
| Natural variant | 161 | 1 | H → Q in strain: NZB; Ly17.1 allotype. | ||||||||
| Natural variant | 190 | 1 | L → Q. | ||||||||
| Natural variant | 195 | 1 | P → T in strain: NZB. | ||||||||
| Natural variant | 287 | 1 | S → I in strain: NZB. | ||||||||
Experimental info | |||||||||||
| Sequence conflict | 270 – 278 | 9 | GSVPVSPGP → LSACQPRA in AAA37608. Ref.1 | ||||||||
| Sequence conflict | 299 | 1 | A → P Ref.3 | ||||||||
| Sequence conflict | 299 | 1 | A → P Ref.4 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structural heterogeneity and functional domains of murine immunoglobulin G Fc receptors." Ravetch J.V., Luster A.D., Weinshank R., Kochan J., Pavlovec A., Portnoy D.A., Hulmes J., Pan Y.-C.E., Unkeless J.C. Science 234:718-725(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 30-51 (ISOFORMS IIB1 AND IIB2). |
| [2] | "A complementary DNA clone for a macrophage-lymphocyte Fc receptor." Lewis V.A., Koch T., Plutner H., Mellman I. Nature 324:372-375(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIB2). Tissue: Macrophage. |
| [3] | "The mouse Fc receptor for IgG (Ly-17): molecular cloning and specificity." Hogarth P.M., Hibbs M.L., Bonadonna L., Scott B.M., Witort E., Pietersz G.A., McKenzie I.F.C. Immunogenetics 26:161-168(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE (ISOFORM IIB1). |
| [4] | "Identification of the mouse beta Fc gamma RII polymorphism by direct sequencing of amplified genomic DNA." Lah M., Quelch K., Deacon N.J., McKenzie I.F., Hogarth P.M. Immunogenetics 31:202-206(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM IIB1), VARIANTS. Strain: BALB/c. Tissue: Spleen. |
| [5] | "Structure of the mouse beta Fc gamma receptor II gene." Hogarth P.M., Witort E., Hulett M.D., Bonnerot C., Even J., Fridman W.H., McKenzie I.F.C. J. Immunol. 146:369-376(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS IIB1 AND IIB2). |
| [6] | "Identification, molecular cloning, biologic properties, and tissue distribution of a novel isoform of murine low-affinity IgG receptor homologous to human Fc gamma RIIB1." Latour S., Fridman W.H., Daeron M. J. Immunol. 157:189-197(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIB1'). Strain: DBA/2. Tissue: Mast cell. |
| [7] | "Nonsynonymous mutations in an Fc-receptor structural gene in NZB mice." Sawchuk D.J., Mahmoudi M., Cairns E., Sinclair N.R.S. Immunogenetics 43:112-113(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 30-330 (ISOFORMS IIB1 AND IIB2). Strain: DBA/2 and NZB. Tissue: Spleen. |
| [8] | "The murine Fc receptor for immunoglobulin: purification, partial amino acid sequence, and isolation of cDNA clones." Hibbs M.L., Walker I.D., Kirszbaum L., Peitersz G.A., Deacon N.J., Chambers G.W., McKenzie I.F.C., Hogarth P.M. Proc. Natl. Acad. Sci. U.S.A. 83:6980-6984(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-45. |
| [9] | "Identification, in mouse macrophages and in serum, of a soluble receptor for the Fc portion of IgG (Fc gamma R) encoded by an alternatively spliced transcript of the Fc gamma RII gene." Tartour E., de la Salle H., de la Salle C., Teillaud C., Camoin L., Galinha A., Latour S., Hanau D., Fridman W.H., Sautes C. Int. Immunol. 5:859-868(1993) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF ISOFORM IIB3. Tissue: Macrophage. |
| [10] | "Fc epsilon receptor I-associated lyn-dependent phosphorylation of Fc gamma receptor IIB during negative regulation of mast cell activation." Malbec O., Fong D.C., Turner M., Tybulewicz V.L., Cambier J.C., Fridman W.H., Daeron M. J. Immunol. 160:1647-1658(1998) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION, INTERACTION WITH LYN. |
| [11] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-326, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M16367 mRNA. Translation: AAA37608.1. M14216 mRNA. Translation: AAA37609.1. M17515 mRNA. Translation: AAA37607.1. M31312 Genomic DNA. Translation: AAA37610.1. X04648 mRNA. Translation: CAA28309.1. Different initiation. U31801 mRNA. Translation: AAA92707.1. U31802 mRNA. Translation: AAA92708.1. U31803 mRNA. Translation: AAA92709.1. U31804 mRNA. Translation: AAA92710.1. M14276 mRNA. Translation: AAA37605.1. U51629 mRNA. Translation: AAA97464.1. |
| IPI | IPI00129485. IPI00223490. IPI00762704. |
| PIR | A40071. FCMSG1. B40071. I49660. |
| RefSeq | NP_034317.1. NM_010187.2. |
| UniGene | Mm.425062. |
3D structure databases | |
| ProteinModelPortal | P08101. |
| SMR | P08101. Positions 34-203. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10090.ENSMUSP00000027966. |
Protein family/group databases | |
| MEROPS | I43.001. |
PTM databases | |
| GlycoSuiteDB | P08101. |
| PhosphoSite | P08101. |
Proteomic databases | |
| PaxDb | P08101. |
| PRIDE | P08101. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 14130. |
| KEGG | mmu:14130. |
| UCSC | uc007dmy.2. mouse. |
Organism-specific databases | |
| CTD | 2213. |
| MGI | MGI:95499. Fcgr2b. |
Phylogenomic databases | |
| eggNOG | NOG25177. |
| HOVERGEN | HBG051602. |
| InParanoid | P08101. |
| KO | K12560. |
| OrthoDB | EOG4ZS94D. |
Gene expression databases | |
| ArrayExpress | P08101. |
| Bgee | P08101. |
| CleanEx | MM_FCGR2B. |
| Genevestigator | P08101. |
| GermOnline | ENSMUSG00000026656. Mus musculus. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 2 hits. |
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR003599. Ig_sub. [Graphical view] |
| SMART | SM00409. IG. 2 hits. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 285226. |
| SOURCE | Search... |
Entry information
| Entry name | FCGR2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P08101 Secondary accession number(s): P08102 Q61558 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
