Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P08101

- FCGR2_MOUSE

UniProt

P08101 - FCGR2_MOUSE

Protein

Low affinity immunoglobulin gamma Fc region receptor II

Gene

Fcgr2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 145 (01 Oct 2014)
      Sequence version 2 (01 Nov 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of antigen-antibody complexes from the circulation and modulation of antibody production by B-cells. Isoform IIB1 and isoform IIB1' form caps but fail to mediate endocytosis or phagocytosis. Isoform IIB2 can mediate the endocytosis of soluble immune complexes via clathrin-coated pits. Isoform IIB1 and isoform IIB2 can down-regulate B-cell, T-cell, and mast cell activation when coaggregated to B-cell receptors for AG (BCR), T-cell receptors for AG (TCR), and Fc receptors, respectively.

    GO - Molecular functioni

    1. IgG binding Source: MGI
    2. receptor signaling protein activity Source: MGI

    GO - Biological processi

    1. antigen processing and presentation of exogenous peptide antigen via MHC class II Source: MGI
    2. cell surface receptor signaling pathway Source: MGI
    3. cellular response to molecule of bacterial origin Source: MGI
    4. defense response Source: MGI
    5. immune response Source: MGI
    6. immunoglobulin mediated immune response Source: MGI
    7. intracellular signal transduction Source: GOC
    8. negative regulation of acute inflammatory response to antigenic stimulus Source: MGI
    9. negative regulation of B cell proliferation Source: MGI
    10. negative regulation of humoral immune response mediated by circulating immunoglobulin Source: MGI
    11. negative regulation of immune response Source: MGI
    12. negative regulation of immunoglobulin production Source: MGI
    13. negative regulation of inflammatory response to antigenic stimulus Source: MGI
    14. negative regulation of interleukin-10 production Source: MGI
    15. negative regulation of phagocytosis Source: MGI
    16. negative regulation of type I hypersensitivity Source: MGI
    17. phagocytosis, engulfment Source: MGI
    18. positive regulation of phagocytosis Source: MGI
    19. response to bacterium Source: MGI

    Keywords - Molecular functioni

    Receptor

    Keywords - Ligandi

    IgG-binding protein

    Enzyme and pathway databases

    ReactomeiREACT_196487. FCGR activation.
    REACT_198374. Regulation of actin dynamics for phagocytic cup formation.
    REACT_210240. Role of phospholipids in phagocytosis.

    Protein family/group databases

    MEROPSiI43.001.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Low affinity immunoglobulin gamma Fc region receptor II
    Alternative name(s):
    Fc gamma receptor IIB
    Short name:
    Fc-gamma RII
    Short name:
    Fc-gamma-RIIB
    Short name:
    FcRII
    IgG Fc receptor II beta
    Lymphocyte antigen 17
    Short name:
    Ly-17
    CD_antigen: CD32
    Gene namesi
    Name:Fcgr2
    Synonyms:Fcgr2b, Ly-17
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Unplaced

    Organism-specific databases

    MGIiMGI:95499. Fcgr2b.

    Subcellular locationi

    Isoform IIB1 : Cytoplasmcytoskeleton
    Note: Binds the cytoskeleton and is not localized in endocytotic pits.
    Isoform IIB3 : Secreted
    Note: Released as a soluble molecule.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-KW
    2. cytoskeleton Source: UniProtKB-SubCell
    3. external side of plasma membrane Source: MGI
    4. extracellular region Source: UniProtKB-SubCell
    5. integral component of membrane Source: MGI
    6. integral component of plasma membrane Source: MGI

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2929Add
    BLAST
    Chaini30 – 330301Low affinity immunoglobulin gamma Fc region receptor IIPRO_0000015143Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi57 ↔ 99PROSITE-ProRule annotation
    Glycosylationi65 – 651N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi92 – 921N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi138 ↔ 182PROSITE-ProRule annotation
    Glycosylationi166 – 1661N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi173 – 1731N-linked (GlcNAc...)Sequence Analysis
    Modified residuei290 – 2901Phosphotyrosine2 Publications
    Modified residuei309 – 3091Phosphotyrosine; by SRC-type Tyr-kinasesBy similarity
    Modified residuei326 – 3261Phosphotyrosine2 Publications

    Post-translational modificationi

    Glycosylated.
    When coaggregated to BCR, isoform IIB1 and isoform IIB1' become tyrosine phosphorylated and bind to the SH2 domains of the protein tyrosine phosphatase PTPC1. Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN and SYK By similarity.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiP08101.
    PRIDEiP08101.

    PTM databases

    PhosphoSiteiP08101.
    UniCarbKBiP08101.

    Expressioni

    Tissue specificityi

    Widely expressed by cells of hemopoietic origin. The isoforms are differentially expressed. Isoform IIB1 is preferentially expressed by cells of the lymphoid lineage, isoform IIB2 by cells of the myeloid lineage, and isoform IIB3 is released by macrophages and is present in the serum. Isoform IIB1' is expressed in myeloid and lymphoid cell lines, in normal spleen cells, and in resting or LPS-activated B-cells but is not detected in mesenteric lymph node cells.

    Gene expression databases

    ArrayExpressiP08101.
    BgeeiP08101.
    CleanExiMM_FCGR2B.
    GenevestigatoriP08101.

    Interactioni

    Subunit structurei

    Interacts with FGR By similarity. Interacts with LYN.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi199619. 4 interactions.
    IntActiP08101. 1 interaction.
    STRINGi10090.ENSMUSP00000027966.

    Structurei

    3D structure databases

    ProteinModelPortaliP08101.
    SMRiP08101. Positions 34-203.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini30 – 210181ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini232 – 33099CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei211 – 23121HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini50 – 10657Ig-like C2-type 1Add
    BLAST
    Domaini131 – 18959Ig-like C2-type 2Add
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi307 – 3126ITIM motif

    Domaini

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG25177.
    HOVERGENiHBG051602.
    InParanoidiP08101.
    KOiK12560.
    PhylomeDBiP08101.

    Family and domain databases

    Gene3Di2.60.40.10. 2 hits.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    [Graphical view]
    SMARTiSM00409. IG. 2 hits.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform IIB1 (identifier: P08101-1) [UniParc]FASTAAdd to Basket

    Also known as: Beta-1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MESNWTVHVF SRTLCHMLLW TAVLNLAAGT HDLPKAVVKL EPPWIQVLKE    50
    DTVTLTCEGT HNPGNSSTQW FHNGRSIRSQ VQASYTFKAT VNDSGEYRCQ 100
    MEQTRLSDPV DLGVISDWLL LQTPQLVFLE GETITLRCHS WRNKLLNRIS 150
    FFHNEKSVRY HHYSSNFSIP KANHSHSGDY YCKGSLGRTL HQSKPVTITV 200
    QGPKSSRSLP VLTIVAAVTG IAVAAIVIIL VSLVYLKKKQ VPALPGNPDH 250
    REMGETLPEE VGEYRQPSGG SVPVSPGPPS GLEPTSSSPY NPPDLEEAAK 300
    TEAENTITYS LLKHPEALDE ETEHDYQNHI 330
    Length:330
    Mass (Da):36,695
    Last modified:November 1, 1997 - v2
    Checksum:iA463B9EFF2717511
    GO
    Isoform IIB2 (identifier: P08101-2) [UniParc]FASTAAdd to Basket

    Also known as: Beta-2

    The sequence of this isoform differs from the canonical sequence as follows:
         243-290: ALPGNPDHREMGETLPEEVGEYRQPSGGSVPVSPGPPSGLEPTSSSPY → D

    Show »
    Length:283
    Mass (Da):31,881
    Checksum:i84718A2D4D82EC89
    GO
    Isoform IIB1' (identifier: P08101-3) [UniParc]FASTAAdd to Basket

    Also known as: Beta-1'

    The sequence of this isoform differs from the canonical sequence as follows:
         262-290: GEYRQPSGGSVPVSPGPPSGLEPTSSSPY → D

    Show »
    Length:302
    Mass (Da):33,954
    Checksum:i7706C4ADE2EF2CB9
    GO
    Isoform IIB3 (identifier: P08101-4)

    Also known as: Beta-3

    Sequence is not available
    Length:
    Mass (Da):

    Sequence cautioni

    The sequence CAA28309.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti270 – 2789GSVPVSPGP → LSACQPRA in AAA37608. (PubMed:2946078)Curated
    Sequence conflicti299 – 2991A → P(PubMed:2957319)Curated
    Sequence conflicti299 – 2991A → P(PubMed:2138587)Curated

    Polymorphismi

    Ly-17 alloantigenic system involves residues 116 and 161. Ly-17.1 mice are Pro-116 and Glu-161; Ly-17.2 mice are Leu-116 and Leu-161. These polymorphisms do not affect IgG binding.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti116 – 1161S → L in strain: DBA/2; Ly17.2 allotype.
    Natural varianti116 – 1161S → P in strain: NZB; Ly17.1 allotype.
    Natural varianti145 – 1451L → P.
    Natural varianti161 – 1611H → L in strain: DBA/2; Ly17.2 allotype.
    Natural varianti161 – 1611H → Q in strain: NZB; Ly17.1 allotype.
    Natural varianti190 – 1901L → Q.
    Natural varianti195 – 1951P → T in strain: NZB.
    Natural varianti287 – 2871S → I in strain: NZB.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei243 – 29048ALPGN…SSSPY → D in isoform IIB2. 2 PublicationsVSP_002640Add
    BLAST
    Alternative sequencei262 – 29029GEYRQ…SSSPY → D in isoform IIB1'. 1 PublicationVSP_002641Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M16367 mRNA. Translation: AAA37608.1.
    M14216 mRNA. Translation: AAA37609.1.
    M17515 mRNA. Translation: AAA37607.1.
    M31312 Genomic DNA. Translation: AAA37610.1.
    X04648 mRNA. Translation: CAA28309.1. Different initiation.
    U31801 mRNA. Translation: AAA92707.1.
    U31802 mRNA. Translation: AAA92708.1.
    U31803 mRNA. Translation: AAA92709.1.
    U31804 mRNA. Translation: AAA92710.1.
    M14276 mRNA. Translation: AAA37605.1.
    U51629 mRNA. Translation: AAA97464.1.
    PIRiA40071.
    B40071. FCMSG1.
    I49660.
    RefSeqiNP_034317.1. NM_010187.2.
    UniGeneiMm.425062.

    Genome annotation databases

    GeneIDi14130.
    KEGGimmu:14130.
    UCSCiuc007dms.2. mouse. [P08101-1]
    uc007dmt.2. mouse. [P08101-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M16367 mRNA. Translation: AAA37608.1 .
    M14216 mRNA. Translation: AAA37609.1 .
    M17515 mRNA. Translation: AAA37607.1 .
    M31312 Genomic DNA. Translation: AAA37610.1 .
    X04648 mRNA. Translation: CAA28309.1 . Different initiation.
    U31801 mRNA. Translation: AAA92707.1 .
    U31802 mRNA. Translation: AAA92708.1 .
    U31803 mRNA. Translation: AAA92709.1 .
    U31804 mRNA. Translation: AAA92710.1 .
    M14276 mRNA. Translation: AAA37605.1 .
    U51629 mRNA. Translation: AAA97464.1 .
    PIRi A40071.
    B40071. FCMSG1.
    I49660.
    RefSeqi NP_034317.1. NM_010187.2.
    UniGenei Mm.425062.

    3D structure databases

    ProteinModelPortali P08101.
    SMRi P08101. Positions 34-203.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 199619. 4 interactions.
    IntActi P08101. 1 interaction.
    STRINGi 10090.ENSMUSP00000027966.

    Protein family/group databases

    MEROPSi I43.001.

    PTM databases

    PhosphoSitei P08101.
    UniCarbKBi P08101.

    Proteomic databases

    PaxDbi P08101.
    PRIDEi P08101.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 14130.
    KEGGi mmu:14130.
    UCSCi uc007dms.2. mouse. [P08101-1 ]
    uc007dmt.2. mouse. [P08101-2 ]

    Organism-specific databases

    CTDi 2213.
    MGIi MGI:95499. Fcgr2b.

    Phylogenomic databases

    eggNOGi NOG25177.
    HOVERGENi HBG051602.
    InParanoidi P08101.
    KOi K12560.
    PhylomeDBi P08101.

    Enzyme and pathway databases

    Reactomei REACT_196487. FCGR activation.
    REACT_198374. Regulation of actin dynamics for phagocytic cup formation.
    REACT_210240. Role of phospholipids in phagocytosis.

    Miscellaneous databases

    NextBioi 285226.
    PROi P08101.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P08101.
    Bgeei P08101.
    CleanExi MM_FCGR2B.
    Genevestigatori P08101.

    Family and domain databases

    Gene3Di 2.60.40.10. 2 hits.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    [Graphical view ]
    SMARTi SM00409. IG. 2 hits.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Structural heterogeneity and functional domains of murine immunoglobulin G Fc receptors."
      Ravetch J.V., Luster A.D., Weinshank R., Kochan J., Pavlovec A., Portnoy D.A., Hulmes J., Pan Y.-C.E., Unkeless J.C.
      Science 234:718-725(1986) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 30-51 (ISOFORMS IIB1 AND IIB2).
    2. "A complementary DNA clone for a macrophage-lymphocyte Fc receptor."
      Lewis V.A., Koch T., Plutner H., Mellman I.
      Nature 324:372-375(1986) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIB2).
      Tissue: Macrophage.
    3. "The mouse Fc receptor for IgG (Ly-17): molecular cloning and specificity."
      Hogarth P.M., Hibbs M.L., Bonadonna L., Scott B.M., Witort E., Pietersz G.A., McKenzie I.F.C.
      Immunogenetics 26:161-168(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE (ISOFORM IIB1).
    4. "Identification of the mouse beta Fc gamma RII polymorphism by direct sequencing of amplified genomic DNA."
      Lah M., Quelch K., Deacon N.J., McKenzie I.F., Hogarth P.M.
      Immunogenetics 31:202-206(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM IIB1), VARIANTS.
      Strain: BALB/c.
      Tissue: Spleen.
    5. "Structure of the mouse beta Fc gamma receptor II gene."
      Hogarth P.M., Witort E., Hulett M.D., Bonnerot C., Even J., Fridman W.H., McKenzie I.F.C.
      J. Immunol. 146:369-376(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS IIB1 AND IIB2).
    6. "Identification, molecular cloning, biologic properties, and tissue distribution of a novel isoform of murine low-affinity IgG receptor homologous to human Fc gamma RIIB1."
      Latour S., Fridman W.H., Daeron M.
      J. Immunol. 157:189-197(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIB1').
      Strain: DBA/2.
      Tissue: Mast cell.
    7. "Nonsynonymous mutations in an Fc-receptor structural gene in NZB mice."
      Sawchuk D.J., Mahmoudi M., Cairns E., Sinclair N.R.S.
      Immunogenetics 43:112-113(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 30-330 (ISOFORMS IIB1 AND IIB2).
      Strain: DBA/2 and NZB.
      Tissue: Spleen.
    8. "The murine Fc receptor for immunoglobulin: purification, partial amino acid sequence, and isolation of cDNA clones."
      Hibbs M.L., Walker I.D., Kirszbaum L., Peitersz G.A., Deacon N.J., Chambers G.W., McKenzie I.F.C., Hogarth P.M.
      Proc. Natl. Acad. Sci. U.S.A. 83:6980-6984(1986) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-45.
    9. "Identification, in mouse macrophages and in serum, of a soluble receptor for the Fc portion of IgG (Fc gamma R) encoded by an alternatively spliced transcript of the Fc gamma RII gene."
      Tartour E., de la Salle H., de la Salle C., Teillaud C., Camoin L., Galinha A., Latour S., Hanau D., Fridman W.H., Sautes C.
      Int. Immunol. 5:859-868(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION OF ISOFORM IIB3.
      Tissue: Macrophage.
    10. "Fc epsilon receptor I-associated lyn-dependent phosphorylation of Fc gamma receptor IIB during negative regulation of mast cell activation."
      Malbec O., Fong D.C., Turner M., Tybulewicz V.L., Cambier J.C., Fridman W.H., Daeron M.
      J. Immunol. 160:1647-1658(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION, INTERACTION WITH LYN.
    11. "Mutational analysis reveals multiple distinct sites within Fc gamma receptor IIB that function in inhibitory signaling."
      Fong D.C., Brauweiler A., Minskoff S.A., Bruhns P., Tamir I., Mellman I., Daeron M., Cambier J.C.
      J. Immunol. 165:4453-4462(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT TYR-290; TYR-309 AND TYR-326.

    Entry informationi

    Entry nameiFCGR2_MOUSE
    AccessioniPrimary (citable) accession number: P08101
    Secondary accession number(s): P08102
    , P12316, P97917, Q60938, Q60939, Q60940, Q61170, Q61558
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 1, 1988
    Last sequence update: November 1, 1997
    Last modified: October 1, 2014
    This is version 145 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3