Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P08101

- FCGR2_MOUSE

UniProt

P08101 - FCGR2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Low affinity immunoglobulin gamma Fc region receptor II

Gene

Fcgr2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of antigen-antibody complexes from the circulation and modulation of antibody production by B-cells. Isoform IIB1 and isoform IIB1' form caps but fail to mediate endocytosis or phagocytosis. Isoform IIB2 can mediate the endocytosis of soluble immune complexes via clathrin-coated pits. Isoform IIB1 and isoform IIB2 can down-regulate B-cell, T-cell, and mast cell activation when coaggregated to B-cell receptors for AG (BCR), T-cell receptors for AG (TCR), and Fc receptors, respectively.

GO - Molecular functioni

  1. IgG binding Source: MGI
  2. receptor signaling protein activity Source: MGI

GO - Biological processi

  1. antigen processing and presentation of exogenous peptide antigen via MHC class II Source: MGI
  2. cell surface receptor signaling pathway Source: MGI
  3. cellular response to molecule of bacterial origin Source: MGI
  4. defense response Source: MGI
  5. immune response Source: MGI
  6. immunoglobulin mediated immune response Source: MGI
  7. intracellular signal transduction Source: GOC
  8. negative regulation of acute inflammatory response to antigenic stimulus Source: MGI
  9. negative regulation of B cell proliferation Source: MGI
  10. negative regulation of humoral immune response mediated by circulating immunoglobulin Source: MGI
  11. negative regulation of immune response Source: MGI
  12. negative regulation of immunoglobulin production Source: MGI
  13. negative regulation of inflammatory response to antigenic stimulus Source: MGI
  14. negative regulation of interleukin-10 production Source: MGI
  15. negative regulation of phagocytosis Source: MGI
  16. negative regulation of type I hypersensitivity Source: MGI
  17. phagocytosis, engulfment Source: MGI
  18. positive regulation of phagocytosis Source: MGI
  19. response to bacterium Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

IgG-binding protein

Enzyme and pathway databases

ReactomeiREACT_196487. FCGR activation.
REACT_198374. Regulation of actin dynamics for phagocytic cup formation.
REACT_202937. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
REACT_210240. Role of phospholipids in phagocytosis.

Protein family/group databases

MEROPSiI43.001.

Names & Taxonomyi

Protein namesi
Recommended name:
Low affinity immunoglobulin gamma Fc region receptor II
Alternative name(s):
Fc gamma receptor IIB
Short name:
Fc-gamma RII
Short name:
Fc-gamma-RIIB
Short name:
FcRII
IgG Fc receptor II beta
Lymphocyte antigen 17
Short name:
Ly-17
CD_antigen: CD32
Gene namesi
Name:Fcgr2
Synonyms:Fcgr2b, Ly-17
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Unplaced

Organism-specific databases

MGIiMGI:95499. Fcgr2b.

Subcellular locationi

Isoform IIB1 : Cytoplasmcytoskeleton
Note: Binds the cytoskeleton and is not localized in endocytotic pits.
Isoform IIB3 : Secreted
Note: Released as a soluble molecule.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini30 – 210181ExtracellularSequence AnalysisAdd
BLAST
Transmembranei211 – 23121HelicalSequence AnalysisAdd
BLAST
Topological domaini232 – 33099CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. cytoskeleton Source: UniProtKB-KW
  3. external side of plasma membrane Source: MGI
  4. extracellular region Source: UniProtKB-KW
  5. integral component of membrane Source: MGI
  6. integral component of plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929Add
BLAST
Chaini30 – 330301Low affinity immunoglobulin gamma Fc region receptor IIPRO_0000015143Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi57 ↔ 99PROSITE-ProRule annotation
Glycosylationi65 – 651N-linked (GlcNAc...)Sequence Analysis
Glycosylationi92 – 921N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi138 ↔ 182PROSITE-ProRule annotation
Glycosylationi166 – 1661N-linked (GlcNAc...)Sequence Analysis
Glycosylationi173 – 1731N-linked (GlcNAc...)Sequence Analysis
Modified residuei290 – 2901Phosphotyrosine1 Publication
Modified residuei309 – 3091Phosphotyrosine; by SRC-type Tyr-kinasesBy similarity
Modified residuei326 – 3261Phosphotyrosine1 Publication

Post-translational modificationi

Glycosylated.
When coaggregated to BCR, isoform IIB1 and isoform IIB1' become tyrosine phosphorylated and bind to the SH2 domains of the protein tyrosine phosphatase PTPC1. Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN and SYK (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP08101.
PaxDbiP08101.
PRIDEiP08101.

PTM databases

PhosphoSiteiP08101.
UniCarbKBiP08101.

Expressioni

Tissue specificityi

Widely expressed by cells of hemopoietic origin. The isoforms are differentially expressed. Isoform IIB1 is preferentially expressed by cells of the lymphoid lineage, isoform IIB2 by cells of the myeloid lineage, and isoform IIB3 is released by macrophages and is present in the serum. Isoform IIB1' is expressed in myeloid and lymphoid cell lines, in normal spleen cells, and in resting or LPS-activated B-cells but is not detected in mesenteric lymph node cells.

Gene expression databases

BgeeiP08101.
CleanExiMM_FCGR2B.
ExpressionAtlasiP08101. baseline and differential.
GenevestigatoriP08101.

Interactioni

Subunit structurei

Interacts with FGR (By similarity). Interacts with LYN.By similarity1 Publication

Protein-protein interaction databases

BioGridi199619. 4 interactions.
IntActiP08101. 1 interaction.
STRINGi10090.ENSMUSP00000027966.

Structurei

3D structure databases

ProteinModelPortaliP08101.
SMRiP08101. Positions 34-203.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini50 – 10657Ig-like C2-type 1Add
BLAST
Domaini131 – 18959Ig-like C2-type 2Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi307 – 3126ITIM motif

Domaini

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG25177.
HOVERGENiHBG051602.
InParanoidiP08101.
KOiK12560.
PhylomeDBiP08101.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform IIB1 (identifier: P08101-1) [UniParc]FASTAAdd to Basket

Also known as: Beta-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESNWTVHVF SRTLCHMLLW TAVLNLAAGT HDLPKAVVKL EPPWIQVLKE
60 70 80 90 100
DTVTLTCEGT HNPGNSSTQW FHNGRSIRSQ VQASYTFKAT VNDSGEYRCQ
110 120 130 140 150
MEQTRLSDPV DLGVISDWLL LQTPQLVFLE GETITLRCHS WRNKLLNRIS
160 170 180 190 200
FFHNEKSVRY HHYSSNFSIP KANHSHSGDY YCKGSLGRTL HQSKPVTITV
210 220 230 240 250
QGPKSSRSLP VLTIVAAVTG IAVAAIVIIL VSLVYLKKKQ VPALPGNPDH
260 270 280 290 300
REMGETLPEE VGEYRQPSGG SVPVSPGPPS GLEPTSSSPY NPPDLEEAAK
310 320 330
TEAENTITYS LLKHPEALDE ETEHDYQNHI
Length:330
Mass (Da):36,695
Last modified:November 1, 1997 - v2
Checksum:iA463B9EFF2717511
GO
Isoform IIB2 (identifier: P08101-2) [UniParc]FASTAAdd to Basket

Also known as: Beta-2

The sequence of this isoform differs from the canonical sequence as follows:
     243-290: ALPGNPDHREMGETLPEEVGEYRQPSGGSVPVSPGPPSGLEPTSSSPY → D

Show »
Length:283
Mass (Da):31,881
Checksum:i84718A2D4D82EC89
GO
Isoform IIB1' (identifier: P08101-3) [UniParc]FASTAAdd to Basket

Also known as: Beta-1'

The sequence of this isoform differs from the canonical sequence as follows:
     262-290: GEYRQPSGGSVPVSPGPPSGLEPTSSSPY → D

Show »
Length:302
Mass (Da):33,954
Checksum:i7706C4ADE2EF2CB9
GO
Isoform IIB3 (identifier: P08101-4)

Also known as: Beta-3

Sequence is not available
Length:
Mass (Da):

Sequence cautioni

The sequence CAA28309.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti270 – 2789GSVPVSPGP → LSACQPRA in AAA37608. (PubMed:2946078)Curated
Sequence conflicti299 – 2991A → P(PubMed:2957319)Curated
Sequence conflicti299 – 2991A → P(PubMed:2138587)Curated

Polymorphismi

Ly-17 alloantigenic system involves residues 116 and 161. Ly-17.1 mice are Pro-116 and Glu-161; Ly-17.2 mice are Leu-116 and Leu-161. These polymorphisms do not affect IgG binding.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti116 – 1161S → L in strain: DBA/2; Ly17.2 allotype.
Natural varianti116 – 1161S → P in strain: NZB; Ly17.1 allotype.
Natural varianti145 – 1451L → P.
Natural varianti161 – 1611H → L in strain: DBA/2; Ly17.2 allotype.
Natural varianti161 – 1611H → Q in strain: NZB; Ly17.1 allotype.
Natural varianti190 – 1901L → Q.
Natural varianti195 – 1951P → T in strain: NZB.
Natural varianti287 – 2871S → I in strain: NZB.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei243 – 29048ALPGN…SSSPY → D in isoform IIB2. 2 PublicationsVSP_002640Add
BLAST
Alternative sequencei262 – 29029GEYRQ…SSSPY → D in isoform IIB1'. 1 PublicationVSP_002641Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M16367 mRNA. Translation: AAA37608.1.
M14216 mRNA. Translation: AAA37609.1.
M17515 mRNA. Translation: AAA37607.1.
M31312 Genomic DNA. Translation: AAA37610.1.
X04648 mRNA. Translation: CAA28309.1. Different initiation.
U31801 mRNA. Translation: AAA92707.1.
U31802 mRNA. Translation: AAA92708.1.
U31803 mRNA. Translation: AAA92709.1.
U31804 mRNA. Translation: AAA92710.1.
M14276 mRNA. Translation: AAA37605.1.
U51629 mRNA. Translation: AAA97464.1.
PIRiA40071.
B40071. FCMSG1.
I49660.
RefSeqiNP_034317.1. NM_010187.2.
UniGeneiMm.425062.

Genome annotation databases

GeneIDi14130.
KEGGimmu:14130.
UCSCiuc007dms.2. mouse. [P08101-1]
uc007dmt.2. mouse. [P08101-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M16367 mRNA. Translation: AAA37608.1 .
M14216 mRNA. Translation: AAA37609.1 .
M17515 mRNA. Translation: AAA37607.1 .
M31312 Genomic DNA. Translation: AAA37610.1 .
X04648 mRNA. Translation: CAA28309.1 . Different initiation.
U31801 mRNA. Translation: AAA92707.1 .
U31802 mRNA. Translation: AAA92708.1 .
U31803 mRNA. Translation: AAA92709.1 .
U31804 mRNA. Translation: AAA92710.1 .
M14276 mRNA. Translation: AAA37605.1 .
U51629 mRNA. Translation: AAA97464.1 .
PIRi A40071.
B40071. FCMSG1.
I49660.
RefSeqi NP_034317.1. NM_010187.2.
UniGenei Mm.425062.

3D structure databases

ProteinModelPortali P08101.
SMRi P08101. Positions 34-203.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 199619. 4 interactions.
IntActi P08101. 1 interaction.
STRINGi 10090.ENSMUSP00000027966.

Protein family/group databases

MEROPSi I43.001.

PTM databases

PhosphoSitei P08101.
UniCarbKBi P08101.

Proteomic databases

MaxQBi P08101.
PaxDbi P08101.
PRIDEi P08101.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 14130.
KEGGi mmu:14130.
UCSCi uc007dms.2. mouse. [P08101-1 ]
uc007dmt.2. mouse. [P08101-2 ]

Organism-specific databases

CTDi 2213.
MGIi MGI:95499. Fcgr2b.

Phylogenomic databases

eggNOGi NOG25177.
HOVERGENi HBG051602.
InParanoidi P08101.
KOi K12560.
PhylomeDBi P08101.

Enzyme and pathway databases

Reactomei REACT_196487. FCGR activation.
REACT_198374. Regulation of actin dynamics for phagocytic cup formation.
REACT_202937. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
REACT_210240. Role of phospholipids in phagocytosis.

Miscellaneous databases

NextBioi 285226.
PROi P08101.
SOURCEi Search...

Gene expression databases

Bgeei P08101.
CleanExi MM_FCGR2B.
ExpressionAtlasi P08101. baseline and differential.
Genevestigatori P08101.

Family and domain databases

Gene3Di 2.60.40.10. 2 hits.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view ]
SMARTi SM00409. IG. 2 hits.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Structural heterogeneity and functional domains of murine immunoglobulin G Fc receptors."
    Ravetch J.V., Luster A.D., Weinshank R., Kochan J., Pavlovec A., Portnoy D.A., Hulmes J., Pan Y.-C.E., Unkeless J.C.
    Science 234:718-725(1986) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 30-51 (ISOFORMS IIB1 AND IIB2).
  2. "A complementary DNA clone for a macrophage-lymphocyte Fc receptor."
    Lewis V.A., Koch T., Plutner H., Mellman I.
    Nature 324:372-375(1986) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIB2).
    Tissue: Macrophage.
  3. "The mouse Fc receptor for IgG (Ly-17): molecular cloning and specificity."
    Hogarth P.M., Hibbs M.L., Bonadonna L., Scott B.M., Witort E., Pietersz G.A., McKenzie I.F.C.
    Immunogenetics 26:161-168(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE (ISOFORM IIB1).
  4. "Identification of the mouse beta Fc gamma RII polymorphism by direct sequencing of amplified genomic DNA."
    Lah M., Quelch K., Deacon N.J., McKenzie I.F., Hogarth P.M.
    Immunogenetics 31:202-206(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM IIB1), VARIANTS.
    Strain: BALB/c.
    Tissue: Spleen.
  5. "Structure of the mouse beta Fc gamma receptor II gene."
    Hogarth P.M., Witort E., Hulett M.D., Bonnerot C., Even J., Fridman W.H., McKenzie I.F.C.
    J. Immunol. 146:369-376(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS IIB1 AND IIB2).
  6. "Identification, molecular cloning, biologic properties, and tissue distribution of a novel isoform of murine low-affinity IgG receptor homologous to human Fc gamma RIIB1."
    Latour S., Fridman W.H., Daeron M.
    J. Immunol. 157:189-197(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIB1').
    Strain: DBA/2.
    Tissue: Mast cell.
  7. "Nonsynonymous mutations in an Fc-receptor structural gene in NZB mice."
    Sawchuk D.J., Mahmoudi M., Cairns E., Sinclair N.R.S.
    Immunogenetics 43:112-113(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 30-330 (ISOFORMS IIB1 AND IIB2).
    Strain: DBA/2 and NZB.
    Tissue: Spleen.
  8. "The murine Fc receptor for immunoglobulin: purification, partial amino acid sequence, and isolation of cDNA clones."
    Hibbs M.L., Walker I.D., Kirszbaum L., Peitersz G.A., Deacon N.J., Chambers G.W., McKenzie I.F.C., Hogarth P.M.
    Proc. Natl. Acad. Sci. U.S.A. 83:6980-6984(1986) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 17-45.
  9. "Identification, in mouse macrophages and in serum, of a soluble receptor for the Fc portion of IgG (Fc gamma R) encoded by an alternatively spliced transcript of the Fc gamma RII gene."
    Tartour E., de la Salle H., de la Salle C., Teillaud C., Camoin L., Galinha A., Latour S., Hanau D., Fridman W.H., Sautes C.
    Int. Immunol. 5:859-868(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION OF ISOFORM IIB3.
    Tissue: Macrophage.
  10. "Fc epsilon receptor I-associated lyn-dependent phosphorylation of Fc gamma receptor IIB during negative regulation of mast cell activation."
    Malbec O., Fong D.C., Turner M., Tybulewicz V.L., Cambier J.C., Fridman W.H., Daeron M.
    J. Immunol. 160:1647-1658(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION, INTERACTION WITH LYN.
  11. "Mutational analysis reveals multiple distinct sites within Fc gamma receptor IIB that function in inhibitory signaling."
    Fong D.C., Brauweiler A., Minskoff S.A., Bruhns P., Tamir I., Mellman I., Daeron M., Cambier J.C.
    J. Immunol. 165:4453-4462(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT TYR-290; TYR-309 AND TYR-326.

Entry informationi

Entry nameiFCGR2_MOUSE
AccessioniPrimary (citable) accession number: P08101
Secondary accession number(s): P08102
, P12316, P97917, Q60938, Q60939, Q60940, Q61170, Q61558
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1988
Last sequence update: November 1, 1997
Last modified: November 26, 2014
This is version 147 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3