P07992 (ERCC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 137.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DNA excision repair protein ERCC-1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 297 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. |
| Subunit structure | Heterodimer composed of ERCC1 and XPF/ERRC4. |
| Subcellular location | |
| Involvement in disease | Cerebro-oculo-facio-skeletal syndrome 4 (COFS4) [MIM:610758]: A disorder of prenatal onset characterized by microcephaly, congenital cataracts, facial dysmorphism, neurogenic arthrogryposis, growth failure and severe psychomotor retardation. COFS is considered to be part of the nucleotide-excision repair disorders spectrum that include also xeroderma pigmentosum, trichothiodystrophy and Cockayne syndrome. |
| Sequence similarities | Belongs to the ERCC1/RAD10/SWI10 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| SLX4 | Q8IY92 | 6 | EBI-750962,EBI-2370740 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P07992-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P07992-2) The sequence of this isoform differs from the canonical sequence as follows: 235-258: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P07992-3) The sequence of this isoform differs from the canonical sequence as follows: 282-297: ARRLFDVLHEPFLKVP → VRALGKNPRSWGKERAPNKHNLRPQSFKVKKEPKTRHSGFRL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 297 | 297 | DNA excision repair protein ERCC-1 | PRO_0000087006 | |||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||
| DNA binding | 134 – 156 | 23 | Potential | ||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 17 – 23 | 7 | Nuclear localization signal Potential | ||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 235 – 258 | 24 | Missing in isoform 2. | VSP_042727 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 282 – 297 | 16 | ARRLF…FLKVP → VRALGKNPRSWGKERAPNKH NLRPQSFKVKKEPKTRHSGF RL in isoform 3. | VSP_043455 | |||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 231 | 1 | F → L in COFS4. Ref.10 | VAR_032776 | |||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 266 | 1 | A → T. Ref.8 Corresponds to variant rs3212977 [ dbSNP | Ensembl ]. | VAR_019167 | |||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 101 – 103 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 105 – 107 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 111 – 115 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 121 – 123 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 127 – 133 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 136 – 142 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 143 – 148 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 152 – 160 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 163 – 172 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 175 – 177 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 179 – 192 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 195 – 201 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 202 – 213 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 222 – 226 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 242 – 244 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 247 – 257 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 260 – 264 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 268 – 272 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 274 – 276 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 280 – 290 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 293 – 295 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular characterization of the human excision repair gene ERCC-1: cDNA cloning and amino acid homology with the yeast DNA repair gene RAD10." van Duin M., de Wit J., Odijk H., Westerveld A., Yasui A., Koken M.H.M., Hoeijmakers J.H.J., Bootsma D. Cell 44:913-923(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Identification of DNA repair genes in the human genome." Hoeijmakers J.H.J., van Duin M., Westerveld A., Yasui A., Bootsma D. Cold Spring Harb. Symp. Quant. Biol. 51:91-101(1986) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "A nucleotide polymorphism in ERCC1 in human ovarian cancer cell lines and tumor tissues." Yu J.J., Mu C.J., Lee K.B., Okamoto A., Reed E.L., Bostick-Bruton F., Mitchell K.C., Reed E. Mutat. Res. 382:13-20(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Human excision repair protein 1, transcript variant, mRNA." Hisatomi H., Nagao K., Ishikawa H., Yokoyama Y., Ishihara Y., Hikiji K., Iizuka T. Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [5] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | NIEHS SNPs program Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-266. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Lung and Uterus. |
| [10] | "First reported patient with human ERCC1 deficiency has cerebro-oculo-facio-skeletal syndrome with a mild defect in nucleotide excision repair and severe developmental failure." Jaspers N.G.J., Raams A., Silengo M.C., Wijgers N., Niedernhofer L.J., Robinson A.R., Giglia-Mari G., Hoogstraten D., Kleijer W.J., Hoeijmakers J.H.J., Vermeulen W. Am. J. Hum. Genet. 80:457-466(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT COFS4 LEU-231. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M13194 mRNA. Translation: AAA52394.1. M26163 Genomic DNA. Translation: AAA52395.1. M28650 mRNA. Translation: AAA35810.1. AF001925 mRNA. Translation: AAC16253.1. AB069681 mRNA. Translation: BAB62810.1. BT019806 mRNA. Translation: AAV38609.1. AF512555 Genomic DNA. Translation: AAM34796.1. AC092309 Genomic DNA. No translation available. AC138128 Genomic DNA. No translation available. AC138534 Genomic DNA. No translation available. AC139353 Genomic DNA. No translation available. CH471126 Genomic DNA. Translation: EAW57349.1. BC008930 mRNA. Translation: AAH08930.1. BC052813 mRNA. Translation: AAH52813.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00014040. IPI00045494. IPI00401902. | ||||||||||||||||||||||||||||||||||||
| PIR | A24781. A32875. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001159521.1. NM_001166049.1. NP_001974.1. NM_001983.3. NP_973730.1. NM_202001.2. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.435981. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P07992. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| DIP | DIP-24235N. | ||||||||||||||||||||||||||||||||||||
| IntAct | P07992. 4 interactions. | ||||||||||||||||||||||||||||||||||||
| MINT | MINT-1457664. | ||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000013807. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | P07992. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 119538. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | P07992. | ||||||||||||||||||||||||||||||||||||
| PRIDE | P07992. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| DNASU | 2067. | ||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000013807; ENSP00000013807; ENSG00000012061. ENST00000300853; ENSP00000300853; ENSG00000012061. ENST00000340192; ENSP00000345203; ENSG00000012061. ENST00000589165; ENSP00000468035; ENSG00000012061. | ||||||||||||||||||||||||||||||||||||
| GeneID | 2067. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:2067. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc002pbs.2. human. uc002pbt.2. human. uc002pbv.3. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 2067. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC19M045912. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:3433. ERCC1. | ||||||||||||||||||||||||||||||||||||
| HPA | CAB004390. HPA029773. | ||||||||||||||||||||||||||||||||||||
| MIM | 126380. gene. 610758. phenotype. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P07992. | ||||||||||||||||||||||||||||||||||||
| Orphanet | 1466. COFS syndrome. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA155. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | COG5241. | ||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000037440. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG051497. | ||||||||||||||||||||||||||||||||||||
| KO | K10849. | ||||||||||||||||||||||||||||||||||||
| OMA | HPDYIHQ. | ||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4R23VJ. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| Reactome | REACT_216. DNA Repair. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | P07992. | ||||||||||||||||||||||||||||||||||||
| Bgee | P07992. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_ERCC1. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | P07992. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000012061. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| InterPro | IPR004579. DNA_repair_Rad10. IPR000445. HhH_motif. IPR003583. Hlx-hairpin-Hlx_DNA-bd_motif. IPR011335. Restrct_endonuc-II-like. IPR010994. RuvA_2-like. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Pfam | PF00633. HHH. 1 hit. PF03834. Rad10. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProDom | PD013585. DNA_repair_Rad10. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||||||||||||||
| SMART | SM00278. HhH1. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF52980. Restrict_endonuc_II-like_core. 1 hit. SSF47781. RuvA_2_like. 1 hit. | ||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR00597. rad10. 1 hit. | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| ChiTaRS | ERCC1. human. | ||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P07992. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 2067. | ||||||||||||||||||||||||||||||||||||
| NextBio | 8403. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | ERCC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P07992 Secondary accession number(s): Q7Z7F5, Q96S40 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
