P07953 (F261_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 144.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Short name=6PF-2-K/Fru-2,6-P2ase 1 Short name=PFK/FBPase 1 Alternative name(s): 6PF-2-K/Fru-2,6-P2ase liver isozyme Including the following 2 domains:
| ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 471 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Synthesis and degradation of fructose 2,6-bisphosphate. |
| Catalytic activity | Beta-D-fructose 2,6-bisphosphate + H2O = D-fructose 6-phosphate + phosphate. ATP + D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate. |
| Enzyme regulation | Phosphorylation results in inhibition of the kinase activity. |
| Subunit structure | Homodimer. |
| Tissue specificity | Liver. |
| Sequence similarities | In the C-terminal section; belongs to the phosphoglycerate mutase family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 2 | EBI-709873,EBI-709873 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P07953-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P07953-2) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MSREMGELTQTRLQKIWIPHSSSSSVLQRRRGS → MEEKASKRTA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.8 | ||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 471 | 470 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 | PRO_0000179962 | |||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 49 – 56 | 8 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||
| Region | 2 – 250 | 249 | 6-phosphofructo-2-kinase | ||||||||||||||||||||||||||||||||||||||||||
| Region | 251 – 471 | 221 | Fructose-2,6-bisphosphatase | ||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||
| Active site | 131 | 1 | Potential | ||||||||||||||||||||||||||||||||||||||||||
| Active site | 161 | 1 | Potential | ||||||||||||||||||||||||||||||||||||||||||
| Active site | 259 | 1 | Tele-phosphohistidine intermediate | ||||||||||||||||||||||||||||||||||||||||||
| Active site | 328 | 1 | Potential | ||||||||||||||||||||||||||||||||||||||||||
| Active site | 393 | 1 | Proton donor | ||||||||||||||||||||||||||||||||||||||||||
| Binding site | 105 | 1 | Fructose-6-phosphate By similarity | ||||||||||||||||||||||||||||||||||||||||||
| Binding site | 196 | 1 | Fructose-6-phosphate By similarity | ||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylserine Ref.5 | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 33 | 1 | Phosphoserine; by PKA | ||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 33 | 33 | MSREM…RRRGS → MEEKASKRTA in isoform 2. | VSP_004674 | |||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 135 | 1 | T → Y Ref.3 | ||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 135 | 1 | T → Y Ref.4 | ||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 135 | 1 | T → Y Ref.5 | ||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 138 | 1 | E → F Ref.3 | ||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 257 | 1 | Missing AA sequence Ref.7 | ||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 253 – 258 | 6 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 263 – 267 | 5 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 278 – 292 | 15 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 300 – 306 | 7 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 307 – 314 | 8 | |||||||||||||||||||||||||||||||||||||||||||
| Turn | 315 – 317 | 3 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 321 – 323 | 3 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 324 – 326 | 3 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 332 – 334 | 3 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 339 – 345 | 7 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 347 – 355 | 9 | |||||||||||||||||||||||||||||||||||||||||||
| Turn | 357 – 359 | 3 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 368 – 374 | 7 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 376 – 383 | 8 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 386 – 392 | 7 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 394 – 404 | 11 | |||||||||||||||||||||||||||||||||||||||||||
| Turn | 409 – 411 | 3 | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 412 – 414 | 3 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 421 – 428 | 8 | |||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 431 – 438 | 8 | |||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Complete nucleotide sequence coding for rat liver 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase derived from a cDNA clone." Darville M.I., Crepin K.M., Vandekerckhove J., van Damme J., Octave J.-N., Rider M.H., Marchand M.J., Hue L., Rousseau G.G. FEBS Lett. 224:317-321(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1), PROTEIN SEQUENCE OF 16-29; 65-74; 90-105; 123-137; 189-195; 240-252; 259-266 AND 309-324 (ISOFORM 1). Strain: Wistar. Tissue: Liver. |
| [2] | "Isolation of a cDNA clone for rat liver 6-phosphofructo 2-kinase/fructose 2,6-bisphosphatase." Colosa A.D., Lively M.O., El-Maghrabi M.R., Pilkis S.J. Biochem. Biophys. Res. Commun. 143:1092-1098(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1). Strain: Sprague-Dawley. |
| [3] | "Characterization of distinct mRNAs coding for putative isozymes of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase." Crepin K.M., Darville M.I., Hue L., Rousseau G.G. Eur. J. Biochem. 183:433-440(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Strain: Wistar. Tissue: Liver. |
| [4] | "Induction of rat liver 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase mRNA by refeeding and insulin." Colosia A.D., Marker A.J., Lange A.J., El-Maghrabi M.R., Granner D.K., Tauler A., Pilkis J., Pilkis S.J. J. Biol. Chem. 263:18669-18677(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [5] | "Complete amino acid sequence of rat liver 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase." Lively M.O., El-Maghrabi M.R., Pilkis J., D'Angelo G., Colosia A.D., Ciavola J.A., Fraser B.A., Pilkis S.J. J. Biol. Chem. 263:839-849(1988) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE (ISOFORM 1), ACETYLATION AT SER-2. Tissue: Liver. |
| [6] | "Cloning and expression in Escherichia coli of a rat hepatoma cell cDNA coding for 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase." Crepin K.M., Darville M.I., Michel A., Hue L., Rousseau G.G. Biochem. J. 264:151-160(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 2). Strain: Wistar. Tissue: Liver. |
| [7] | "Active site sequence of hepatic fructose-2,6-bisphosphatase. Homology in primary structure with phosphoglycerate mutase." Pilkis S.J., Lively M.O., El-Maghrabi M.R. J. Biol. Chem. 262:12672-12675(1987) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 220-267. Tissue: Liver. |
| [8] | "5' flanking sequence and structure of a gene encoding rat 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase." Darville M.I., Crepin K.M., Hue L., Rousseau G.G. Proc. Natl. Acad. Sci. U.S.A. 86:6543-6547(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-32 (ISOFORM 1), PROTEIN SEQUENCE OF 2-10 (ISOFORM 2). |
| [9] | "Evolution of a bifunctional enzyme: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase." Bazan J.F., Fletterick R.J., Pilkis S.J. Proc. Natl. Acad. Sci. U.S.A. 86:9642-9646(1989) [PubMed] [Europe PMC] [Abstract] Cited for: DOMAINS. |
| [10] | "Catalytic site of rat liver and bovine heart fructose-6-phosphate,2-kinase:fructose-2,6-bisphosphatase. Identification of fructose 6-phosphate binding site." Kitamura K., Uyeda K., Hartman F.C., Kangawa K., Matsuo H. J. Biol. Chem. 264:6344-6348(1989) [PubMed] [Europe PMC] [Abstract] Cited for: FRUCTOSE-6-P BINDING SITES. |
| [11] | "Crystal structure of the rat liver fructose-2,6-bisphosphatase based on selenomethionine multiwavelength anomalous dispersion phases." Lee Y.-H., Ogata C., Pflugrath J.W., Levitt D.G., Sarma R., Banaszak L.J., Pilkis S.J. Biochemistry 35:6010-6019(1996) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS). Tissue: Liver. |
| [12] | "Crystal structure of a trapped phosphoenzyme during a catalytic reaction." Lee Y.-H., Olson T.W., Ogata C.M., Levitt D.G., Banaszak L.J., Lange A.J. Nat. Struct. Biol. 4:615-618(1997) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 251-441. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Y00702 mRNA. Translation: CAA68694.1. X15579 mRNA. Translation: CAA33606.1. X15580 mRNA. Translation: CAA33607.1. M26215 Genomic DNA. Translation: AAA02888.2. M26216 Genomic DNA. Translation: AAA02889.1. J04197 mRNA. Translation: AAA79008.1. M27886 Genomic DNA. Translation: AAA58780.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00327110. IPI00393624. | ||||||||||||||||||||||||||||||||||||
| PIR | KIRTFB. S11761. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_036753.4. NM_012621.4. | ||||||||||||||||||||||||||||||||||||
| UniGene | Rn.10115. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P07953. | ||||||||||||||||||||||||||||||||||||
| SMR | P07953. Positions 7-471. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| IntAct | P07953. 1 interaction. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | P07953. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PRIDE | P07953. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENSRNOT00000000178; ENSRNOP00000000178; ENSRNOG00000000165. ENSRNOT00000033656; ENSRNOP00000035212; ENSRNOG00000000165. | ||||||||||||||||||||||||||||||||||||
| GeneID | 24638. | ||||||||||||||||||||||||||||||||||||
| KEGG | rno:24638. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 5207. | ||||||||||||||||||||||||||||||||||||
| RGD | 3307. Pfkfb1. | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | COG0406. | ||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00390000018751. | ||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000181112. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG005628. | ||||||||||||||||||||||||||||||||||||
| InParanoid | P07953. | ||||||||||||||||||||||||||||||||||||
| KO | K01103. | ||||||||||||||||||||||||||||||||||||
| OMA | ESELNIR. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| BRENDA | 3.1.3.46. 5301. | ||||||||||||||||||||||||||||||||||||
| Reactome | REACT_113568. Metabolism. | ||||||||||||||||||||||||||||||||||||
| SABIO-RK | P07953. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | P07953. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | P07953. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSRNOG00000000165. Rattus norvegicus. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| InterPro | IPR003094. 6Pfruct_kin. IPR013079. 6Phosfructo_kin. IPR016260. Bifunct_6PFK/fruc_bisP_Ptase. IPR013078. His_Pase_superF_clade-1. IPR001345. PG/BPGM_mutase_AS. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR10606. PTHR10606. 1 hit. | ||||||||||||||||||||||||||||||||||||
| Pfam | PF01591. 6PF2K. 1 hit. PF00300. His_Phos_1. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF000709. 6PFK_2-Ptase. 1 hit. | ||||||||||||||||||||||||||||||||||||
| PRINTS | PR00991. 6PFRUCTKNASE. | ||||||||||||||||||||||||||||||||||||
| SMART | SM00855. PGAM. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS00175. PG_MUTASE. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P07953. | ||||||||||||||||||||||||||||||||||||
| NextBio | 603924. | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | F261_RAT | ||||||||
| Accession | Primary (citable) accession number: P07953 Secondary accession number(s): P16119 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
