P07949 (RET_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 169.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Proto-oncogene tyrosine-protein kinase receptor Ret EC=2.7.10.1 Alternative name(s): Cadherin family member 12 Proto-oncogene c-Ret Cleaved into the following 2 chains: | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1114 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor tyrosine-protein kinase involved in numerous cellular mechanisms including cell proliferation, neuronal navigation, cell migration, and cell differentiation upon binding with glial cell derived neurotrophic factor family ligands. Phosphorylates PTK2/FAK1. Regulates both cell death/survival balance and positional information. Required for the molecular mechanisms orchestration during intestine organogenesis; involved in the development of enteric nervous system and renal organogenesis during embryonic life, and promotes the formation of Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue. Modulates cell adhesion via its cleavage by caspase in sympathetic neurons and mediates cell migration in an integrin (e.g. ITGB1 and ITGB3)-dependent manner. Involved in the development of the neural crest. Active in the absence of ligand, triggering apoptosis through a mechanism that requires receptor intracellular caspase cleavage. Act as a dependence receptor; in the presence of the ligand GDNF in somatotrophs (within pituitary), promotes survival and down regulates growth hormone (GH) production, but triggers apoptosis in absence of GDNF. Regulates nociceptor survival and size. Triggers the differentiation of rapidly adapting (RA) mechanoreceptors. Mediator of several diseases such as neuroendocrine cancers; these diseases are characterized by aberrant integrins-regulated cell migration. Ref.22 Ref.25 Ref.26 Ref.29 Ref.30 |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. |
| Enzyme regulation | Repressed by 4-(3-hydroxyanilino)-quinolines derivatives, indolin-2-one-derivatives, 2-(alkylsulfanyl)-4-(3-thienyl) nicotinonitrile analogs, 3- and 4-substituted beta-carbolin-1-ones, vandetanib, motesanib, sorafenib (BAY 43-9006), cabozantinib (XL184), sunitinib, and withaferin A (WA). Inactivation by sorafenib both reduces kinase activity and promotes lysosomal degradation. Ref.16 Ref.17 Ref.18 Ref.23 Ref.24 Ref.28 Ref.32 |
| Subunit structure | Phosphorylated form interacts with the PBT domain of DOK2, DOK4 and DOK5. The phosphorylated form interacts with PLCG1 and GRB7 By similarity. Interacts (not phosphorylated) with CC PTK2/FAK1 (via FERM domain). Extracellular cell-membrane anchored RET cadherin fragments form complex in neurons with reduced trophic status, preferentially at the contact sites between somas. Interacts with AIP in the pituitary gland; this interaction prevents the formation of the AIP-survivin complex. Binds to ARTN. Ref.19 Ref.29 Ref.30 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein Ref.27. |
| Induction | Positively regulated by NKX2-1, PHOX2B, SOX10 and PAX3. Ref.16 Ref.17 Ref.18 Ref.20 Ref.23 Ref.24 Ref.28 Ref.32 |
| Post-translational modification | Autophosphorylated on C-terminal tyrosine residues upon ligand stimulation. Dephosphorylated by PTPRJ on Tyr-905, Tyr-1015 and Tyr-1062. Ref.12 Ref.13 Ref.15 Ref.21 Ref.30 Ref.31 Ref.32 Proteolytically cleaved by caspase-3. The soluble RET kinase fragment is able to induce cell death. The extracellular cell-membrane anchored RET cadherin fragment accelerates cell adhesion in sympathetic neurons. Ref.29 |
| Polymorphism | The Cys-982 polymorphism may be associated with an increased risk for developing Hirschsprung disease. |
| Involvement in disease | Defects in RET may be a cause of colorectal cancer (CRC) [MIM:114500]. Defects in RET are a cause of Hirschsprung disease type 1 (HSCR1) [MIM:142623]. HSCR1 is a disorder of neural crest development characterized by the absence of intramural ganglion cells in the myenteric and submucosal plexuses of the gastrointestinal tract, often resulting in intestinal obstruction. Total colonic aganglionosis and total intestinal Hirschsprung disease also occur. Occasionally, MEN2A or FMTC occur in association with HSCR1. Ref.38 Ref.43 Ref.45 Ref.46 Ref.50 Ref.51 Ref.55 Ref.56 Ref.61 Ref.62 Ref.65 Ref.71 Ref.76 Ref.77 Ref.82 Defects in RET are the cause of medullary thyroid carcinoma (MTC) [MIM:155240]. MTC is a rare tumor derived from the C cells of the thyroid. Three hereditary forms are known, that are transmitted in an autosomal dominant fashion: (a) multiple neoplasia type 2A (MEN2A), (b) multiple neoplasia type IIB (MEN2B) and (c) familial MTC (FMTC), which occurs in 25-30% of MTC cases and where MTC is the only clinical manifestation. Ref.41 Ref.42 Ref.43 Ref.48 Ref.53 Ref.54 Ref.57 Ref.58 Ref.62 Ref.64 Ref.66 Ref.69 Ref.73 Ref.74 Ref.75 Ref.78 Ref.80 Ref.83 Defects in RET are the cause of multiple neoplasia type 2B (MEN2B) [MIM:162300]. MEN2B is an uncommon inherited cancer syndrome characterized by predisposition to MTC and phaeochromocytoma which is associated with marfanoid habitus, mucosal neuromas, skeletal and ophtalmic abnormalities, and ganglioneuromas of the intestine tract. Then the disease progresses rapidly with the development of metastatic MTC and a pheochromocytome in 50% of cases. Ref.39 Ref.44 Ref.47 Ref.48 Ref.52 Ref.58 Ref.63 Ref.66 Ref.67 Defects in RET are a cause of susceptibility to pheochromocytoma (PCC) [MIM:171300]. A catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent. Defects in RET are the cause of multiple neoplasia type 2A (MEN2A) [MIM:171400]; also known as multiple neoplasia type 2 (MEN2). MEN2A is the most frequent form of medullary thyroid cancer (MTC). It is an inherited cancer syndrome characterized by MTC, phaeochromocytoma and/or hyperparathyroidism. Defects in RET are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=Chromosomal aberrations involving RET are found in thyroid papillary carcinomas. Inversion inv(10)(q11.2;q21) generates the RET/CCDC6 (PTC1) oncogene; inversion inv(10)(q11.2;q11.2) generates the RET/NCOA4 (PTC3) oncogene; translocation t(10;14)(q11;q32) with GOLGA5 generates the RET/GOLGA5 (PTC5) oncogene; translocation t(8;10)(p21.3;q11.2) with PCM1 generates the PCM1/RET fusion; translocation t(6;10)(p21.3;q11.2) with RFP generates the Delta RFP/RET oncogene; translocation t(1;10)(p13;q11) with TRIM33 generates the TRIM33/RET (PTC7) oncogene; translocation t(7;10)(q32;q11) with TRIM24/TIF1 generates the TRIM24/RET (PTC6) oncogene. The PTC5 oncogene has been found in 2 cases of PACT in children exposed to radioactive fallout after Chernobyl. A chromosomal aberration involving TRIM27/RFP is found in thyroid papillary carcinomas. Translocation t(6;10)(p21.3;q11.2) with RET. The translocation generates TRIM27/RET and delta TRIM27/RET oncogenes. Defects in RET are a cause of renal adysplasia (RADYS) [MIM:191830]; also known as renal agenesis or renal aplasia. Renal agenesis refers to the absence of one (unilateral) or both (bilateral) kidneys at birth. Bilateral renal agenesis belongs to a group of perinatally lethal renal diseases, including severe bilateral renal dysplasia, unilateral renal agenesis with contralateral dysplasia and severe obstructive uropathy. Ref.89 Defects in RET are a cause of congenital central hypoventilation syndrome (CCHS) [MIM:209880]; also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. Ref.68 Ref.85 Ref.86 |
| Miscellaneous | Treatment with withaferin A (WA) leads tumor regression in medullary thyroid carcinomas (MTC). |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. Contains 1 cadherin domain. Contains 1 protein kinase domain. |
| Sequence caution | The sequence AAA36524.1 differs from that shown. Reason: Erroneous initiation. The sequence AAA36786.1 differs from that shown. Reason: Erroneous initiation. The sequence CAA33787.1 differs from that shown. Reason: Erroneous initiation. The sequence CAC14882.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P07949-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: P07949-2) The sequence of this isoform differs from the canonical sequence as follows: 1064-1114: MSDPNWPGESPVPLTRADGTNTGFPRYPNDSVYANWMLSPSAAKLMDTFDS → RISHAFTRF |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 28 | 28 | Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 29 – 1114 | 1086 | Proto-oncogene tyrosine-protein kinase receptor Ret | PRO_0000024450 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 29 – 707 | 679 | Extracellular cell-membrane anchored RET cadherin 120 kDa fragment | PRO_0000415292 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 708 – 1017 | 310 | Soluble RET kinase fragment | PRO_0000415293 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 29 – 635 | 607 | Extracellular Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 636 – 657 | 22 | Helical; Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 658 – 1114 | 457 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 168 – 272 | 105 | Cadherin | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 724 – 1016 | 293 | Protein kinase | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 730 – 738 | 9 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 805 – 807 | 3 | Inhibitors binding | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 874 | 1 | Proton acceptor By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 758 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 892 | 1 | Inhibitors | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 587 – 588 | 2 | Breakpoint for translocation to form the TRIM27/RET oncogene | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 707 – 708 | 2 | Cleavage; by caspase-3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 712 – 713 | 2 | Breakpoint for translocation to form PCM1-RET; RET-CCDC6; RET-GOLGA5; RET-TRIM24 and RET-TRIM33 oncogenes | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 1017 – 1018 | 2 | Cleavage; by caspase-3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 696 | 1 | Phosphoserine Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 806 | 1 | Phosphotyrosine; by autocatalysis Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 809 | 1 | Phosphotyrosine; by autocatalysis Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 900 | 1 | Phosphotyrosine; by autocatalysis Ref.13 Ref.31 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 905 | 1 | Phosphotyrosine; by autocatalysis Ref.13 Ref.15 Ref.31 Ref.32 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 981 | 1 | Phosphotyrosine; by autocatalysis Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1015 | 1 | Phosphotyrosine; by autocatalysis Ref.12 Ref.13 Ref.15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1062 | 1 | Phosphotyrosine; by autocatalysis Ref.12 Ref.13 Ref.15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1090 | 1 | Phosphotyrosine; by autocatalysis Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1096 | 1 | Phosphotyrosine; by autocatalysis Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 98 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 151 | 1 | N-linked (GlcNAc...) Ref.33 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 199 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 336 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 343 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 361 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 367 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 377 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 394 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 448 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 468 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 554 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 137 ↔ 142 | Ref.33 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1064 – 1114 | 51 | MSDPN…DTFDS → RISHAFTRF in isoform 2. | VSP_040735 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 20 | 1 | P → L in HSCR1; sporadic form. Ref.50 | VAR_009459 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 32 | 1 | S → L in HSCR1; familial form. Ref.46 Ref.82 | VAR_006295 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 40 | 1 | L → P in HSCR1. Ref.38 Ref.56 | VAR_009492 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 64 | 1 | P → L in HSCR1; familial form. Ref.46 | VAR_006296 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 67 | 1 | R → H in CCHS. Ref.86 | VAR_018153 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 77 | 1 | R → C in HSCR1. Ref.82 | VAR_009460 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 93 | 1 | G → S in HSCR1; could be a rare polymorphism. Ref.50 | VAR_006297 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 114 | 1 | R → H in CCHS. Ref.85 Ref.86 | VAR_018154 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 142 | 1 | C → S in HSCR1; sporadic form. | VAR_006298 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 145 | 1 | V → G in a colorectal cancer sample; somatic mutation. Ref.87 | VAR_035711 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 157 | 1 | C → Y in HSCR1; could be a polymorphism. Ref.55 | VAR_009461 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 163 | 1 | R → Q in a colorectal adenocarcinoma sample; somatic mutation. Ref.88 | VAR_041762 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 174 | 1 | F → S in HSCR1; sporadic form. Ref.65 | VAR_009462 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 180 | 1 | R → P in HSCR1; sporadic form. Ref.61 | VAR_009463 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 197 | 1 | C → Y in HSCR1; sporadic form. Ref.65 | VAR_009464 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 198 | 1 | P → T in RADYS; prevents phosphorylation in response to GDNF. Ref.89 | VAR_044392 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 231 | 1 | R → H in HSCR1; familial form. | VAR_006299 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 251 | 1 | E → K in HSCR1; familial form. | VAR_006300 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 278 | 1 | T → N. Ref.88 Corresponds to variant rs35118262 [ dbSNP | Ensembl ]. | VAR_041763 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 287 | 1 | R → Q in HSCR1; sporadic form. | VAR_006301 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 292 | 1 | V → M. Ref.88 Corresponds to variant rs34682185 [ dbSNP | Ensembl ]. | VAR_041764 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 313 | 1 | R → Q in HSCR1; sporadic form. Ref.61 | VAR_009465 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 330 | 1 | R → Q in HSCR1. Ref.46 Ref.50 | VAR_006302 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 359 | 1 | N → K in HSCR1; could be a polymorphism. Ref.55 | VAR_009466 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 360 | 1 | R → W in HSCR1. Ref.82 Ref.87 | VAR_009467 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 376 | 1 | V → A in RADYS; constitutively phosphorylated; expressed only the immature intracellular form. Ref.89 | VAR_044393 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 393 | 1 | F → L in HSCR1; familial form. Ref.46 | VAR_006303 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 394 | 1 | N → H in RADYS; prevents phosphorylation in response to GDNF. Ref.89 | VAR_044394 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 394 | 1 | N → K in HSCR1. Ref.82 | VAR_009468 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 399 | 1 | P → L in HSCR1; sporadic form. Ref.38 | VAR_006304 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 432 | 1 | A → E in CCHS. Ref.86 | VAR_018155 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 475 | 1 | R → Q in HSCR1; sporadic form. | VAR_006305 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 489 | 1 | D → N. Ref.86 Ref.88 Corresponds to variant rs9282834 [ dbSNP | Ensembl ]. | VAR_018156 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 531 | 1 | C → CEEC in MTC; familial form. | VAR_009469 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 593 | 1 | G → E in a colorectal cancer sample; somatic mutation. Ref.87 | VAR_035712 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 600 | 1 | R → Q. Ref.81 | VAR_008966 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 609 | 1 | C → G in MEN2A. | VAR_009470 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 609 | 1 | C → R in MEN2A. | VAR_009471 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 609 | 1 | C → W in HSCR1; familial form. Ref.43 | VAR_006307 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 609 | 1 | C → Y in MTC, MEN2A and HSCR1; familial and sporadic forms. Ref.41 Ref.50 Ref.55 Ref.71 | VAR_006306 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 611 | 1 | C → G in MTC; familial form. Ref.69 | VAR_009472 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 611 | 1 | C → R in MEN2A. | VAR_009473 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 611 | 1 | C → S in MEN2A. | VAR_009474 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 611 | 1 | C → W in MEN2A and MTC; familial form. Ref.36 | VAR_006308 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 611 | 1 | C → Y in MEN2A. | VAR_006309 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 618 | 1 | C → F in MEN2A and MTC; familial form. | VAR_006312 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 618 | 1 | C → G in MEN2A. Ref.37 | VAR_006310 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 618 | 1 | C → R in MEN2A, MTC and HSCR1. Ref.40 Ref.41 Ref.43 Ref.62 | VAR_006311 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 618 | 1 | C → S in MEN2A, HSCR1 and MTC; familial and sporadic forms. Ref.36 Ref.40 Ref.41 Ref.49 Ref.71 | VAR_006313 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 618 | 1 | C → Y in MEN2A and MTC; familial form. | VAR_006314 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 620 | 1 | C → F in MEN2A and MTC; familial form. Ref.40 | VAR_006318 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 620 | 1 | C → G in MEN2A and MTC; familial and sporadic forms. | VAR_006315 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 620 | 1 | C → R in MEN2A, MTC and HSCR1; familial and sporadic forms. Ref.36 Ref.40 Ref.43 Ref.50 Ref.55 Ref.61 Ref.71 | VAR_006316 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 620 | 1 | C → S in MEN2A and MTC; familial form. Ref.41 Ref.49 | VAR_006317 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 620 | 1 | C → W in MEN2A and HSCR1. Ref.71 | VAR_009475 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 620 | 1 | C → Y in MEN2A. Ref.36 | VAR_006319 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 626 | 1 | Q → K in HSCR1; sporadic form. Ref.76 | VAR_009476 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 630 | 1 | C → F in MEN2A and MTC; familial form. | VAR_006320 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 630 | 1 | C → S in MTC; sporadic form. | VAR_009477 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 630 | 1 | C → Y in MTC; familial and sporadic forms. | VAR_009478 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 631 | 1 | D → G in thyroid carcinoma; somatic mutation. | VAR_006321 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 632 – 634 | 3 | ELC → DVR in MEN2A. | VAR_006322 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 634 – 635 | 2 | CR → WG in MEN2A. | VAR_006329 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 634 | 1 | C → CHELC in MEN2A. | VAR_009479 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 634 | 1 | C → F in MEN2A and pheochromocytoma. Ref.37 Ref.40 Ref.84 | VAR_006324 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 634 | 1 | C → G in MEN2A and pheochromocytoma. Ref.37 Ref.40 Ref.84 | VAR_006323 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 634 | 1 | C → R in MEN2A, pheochromocytoma and MTC; familial form; also found as somatic mutation in a sporadic thyroid carcinoma. Ref.36 Ref.37 Ref.49 Ref.84 | VAR_006326 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 634 | 1 | C → S in MEN2A, pheochromocytoma and MTC; familial form. Ref.37 Ref.84 | VAR_006327 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 634 | 1 | C → W in MEN2A, pheochromocytoma and MTC; familial form. Ref.84 | VAR_006328 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 634 | 1 | C → Y in MEN2A, pheochromocytoma and MTC; familial form. Ref.37 Ref.40 Ref.49 Ref.84 | VAR_006325 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 636 | 1 | T → TCRT in MEN2A. | VAR_006330 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 639 | 1 | A → G in MTC; sporadic form. Ref.83 | VAR_012743 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 640 | 1 | A → G in MEN2A. Ref.79 | VAR_009480 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 641 | 1 | A → G in MTC; sporadic form. Ref.83 | VAR_012744 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 690 | 1 | S → P in HSCR1; sporadic form. | VAR_006331 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 691 | 1 | G → S. Ref.66 Ref.68 Ref.86 Ref.88 Corresponds to variant rs1799939 [ dbSNP | Ensembl ]. | VAR_006332 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 749 | 1 | R → T. Ref.88 Corresponds to variant rs34288963 [ dbSNP | Ensembl ]. | VAR_041765 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 762 | 1 | E → Q in HSCR1; sporadic form. Ref.38 | VAR_009481 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 765 | 1 | S → P in HSCR1. Ref.38 Ref.45 Ref.56 | VAR_009493 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 767 | 1 | S → R in HSCR1; sporadic form. | VAR_006334 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 768 | 1 | E → D in MTC; familial and sporadic forms. Ref.53 Ref.54 Ref.58 | VAR_006335 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 778 | 1 | V → I in RADYS; constitutively phosphorylated. Ref.89 | VAR_044395 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 790 | 1 | L → F in MEN2A and MTC; familial form. Ref.74 | VAR_009482 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 791 | 1 | Y → F in HSCR1, pheochromocytoma, MTC and MEN2A; familial form. Ref.61 Ref.74 Ref.84 | VAR_009483 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 804 | 1 | V → L in MTC; familial form. Ref.54 | VAR_006336 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 804 | 1 | V → M in MTC; familial form. Ref.73 Ref.80 | VAR_006337 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 813 | 1 | R → Q in HSCR1; sporadic form. Ref.76 | VAR_009484 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 826 | 1 | Y → S. Ref.88 Corresponds to variant rs34617196 [ dbSNP | Ensembl ]. | VAR_041766 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 844 | 1 | R → L in MTC; familial form. Ref.80 Ref.88 Corresponds to variant rs55947360 [ dbSNP | Ensembl ]. | VAR_011582 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 873 | 1 | R → Q in HSCR1; sporadic form. | VAR_006338 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 883 | 1 | A → F in MEN2B; somatic mutation in sporadic medullary thyroid carcinoma; requires 2 nucleotide substitutions. Ref.63 Ref.67 | VAR_009485 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 891 | 1 | S → A in MTC; familial form. Ref.64 | VAR_009486 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 893 | 1 | F → L in HSCR1; sporadic form. | VAR_006339 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 894 | 1 | G → S in RADYS; constitutively phosphorylated; expressed only the immature intracellular form. Ref.89 | VAR_044396 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 897 | 1 | R → Q in HSCR1; sporadic form. Ref.38 Ref.45 | VAR_006340 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 907 | 1 | K → E in HSCR1; sporadic form. | VAR_006341 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 918 | 1 | M → T in RADYS, MEN2B and MTC; sporadic form; somatic mutation. Ref.39 Ref.44 Ref.47 Ref.52 Ref.58 Ref.89 | VAR_006342 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 921 | 1 | E → K in HSCR1; sporadic form. | VAR_006343 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 922 | 1 | S → F in MTC; sporadic form. Ref.83 | VAR_012745 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 922 | 1 | S → Y Rare polymorphism. Ref.52 | VAR_009487 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 946 | 1 | T → M in MEN2B and MTC; familial form. | VAR_006345 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 972 | 1 | R → G in HSCR1; familial form. Ref.38 Ref.45 | VAR_006346 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 973 | 1 | P → L in HSCR1; familial form. Ref.38 | VAR_006347 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 980 | 1 | M → T in HSCR1; sporadic form. | VAR_006348 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 982 | 1 | R → C. Ref.3 Ref.50 Ref.70 Ref.86 Ref.88 Corresponds to variant rs17158558 [ dbSNP | Ensembl ]. | VAR_006349 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1039 | 1 | P → L in CCHS; with colonic aganglionosis. Ref.68 | VAR_018157 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1039 | 1 | P → Q. | VAR_009488 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1049 | 1 | P → L in RADYS; prevents phosphorylation in response to GDNF. Ref.89 | VAR_044397 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1059 | 1 | Missing in HSCR1. | VAR_009489 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1061 | 1 | L → P in HSCR1. Ref.55 Ref.77 | VAR_009490 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1064 | 1 | M → T in HSCR1; familial form. | VAR_009491 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1067 | 1 | P → S in RADYS; prevents phosphorylation in response to GDNF. Ref.89 | VAR_044398 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1112 | 1 | F → Y in a bladder transitional cell carcinoma sample; somatic mutation. Ref.88 | VAR_041767 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 707 | 1 | D → N: Impaired cleavage by caspase-3 and loss of induced cell death. Ref.29 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 708 – 1114 | 407 | Missing: Loss of induced cell death, but increased cell aggregation. Ref.29 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 758 | 1 | K → R: Loss of kinase activity. Ref.29 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 647 | 1 | I → V in AAA36786. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 664 | 1 | A → S in BAF84496. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 750 | 1 | A → G in AAA36524. Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 904 | 1 | S → P in AAA36786. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 705 – 710 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 715 – 717 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 721 – 723 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 724 – 732 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 734 – 744 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 746 – 748 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 750 – 759 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 766 – 779 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 790 – 794 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 796 – 799 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 801 – 805 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 812 – 818 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 819 – 821 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 848 – 867 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 877 – 879 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 880 – 883 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 884 – 886 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 887 – 890 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 900 – 902 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 915 – 917 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 920 – 925 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 930 – 945 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 957 – 959 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 960 – 965 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 978 – 987 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 992 – 994 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 998 – 1010 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Prostate. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT CYS-982. Tissue: Brain. |
| [4] | "Isolation of ret proto-oncogene cDNA with an amino-terminal signal sequence." Takahashi M. Oncogene 4:805-806(1989) [PubMed: 2660074] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-280 (ISOFORMS 1/2). |
| [5] | "Cloning and expression of the ret proto-oncogene encoding a tyrosine kinase with two potential transmembrane domains." Takahashi M., Buma Y., Iwamoto T., Inaguma Y., Ikeda H., Hiai H. Oncogene 3:571-578(1988) [PubMed: 3078962] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 255-1114 (ISOFORM 1). |
| [6] | "ret transforming gene encodes a fusion protein homologous to tyrosine kinases." Takahashi M., Cooper G.M. Mol. Cell. Biol. 7:1378-1385(1987) [PubMed: 3037315] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 588-1063 (ISOFORM 2), CHROMOSOMAL TRANSLOCATION WITH TRIM27. |
| [7] | "Activation of the ret-II oncogene without a sequence encoding a transmembrane domain and transforming activity of two ret-II oncogene products differing in carboxy-termini due to alternative splicing." Ishizaka Y., Ochiai M., Tahira T., Suhimura T., Nahao M. Oncogene 4:789-794(1989) [PubMed: 2734021] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 713-1114 (ISOFORM 1), CHROMOSOMAL TRANSLOCATION WITH GOLGA5. Tissue: Fibroblast. |
| [8] | Erratum Ishizaka Y., Ochiai M., Tahira T., Suhimura T., Nahao M. Oncogene 4:1415-1415(1989) |
| [9] | "PTC is a novel rearranged form of the ret proto-oncogene and is frequently detected in vivo in human thyroid papillary carcinomas." Grieco M., Santoro M., Berlingieri M.T., Melillo R.M., Donghi R., Bongarzone I., Pierotti M.A., Della Porta G., Fusco A., Vecchio G. Cell 60:557-563(1990) [PubMed: 2406025] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 713-1114 (ISOFORM 1), CHROMOSOMAL TRANSLOCATION WITH CCDC6. Tissue: Thyroid papillary carcinoma. |
| [10] | "RET/PCM-1: a novel fusion gene in papillary thyroid carcinoma." Corvi R., Berger N., Balczon R., Romeo G. Oncogene 19:4236-4242(2000) [PubMed: 10980597] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 713-770 (ISOFORMS 1/2), CHROMOSOMAL TRANSLOCATION WITH PCM1. |
| [11] | "The transcription coactivator HTIF1 and a related protein are fused to the RET receptor tyrosine kinase in childhood papillary thyroid carcinomas." Klugbauer S., Rabes H.M. Oncogene 18:4388-4393(1999) [PubMed: 10439047] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH TRIM33 AND TRIM24. |
| [12] | "Tyrosines 1015 and 1062 are in vivo autophosphorylation sites in ret and ret-derived oncoproteins." Salvatore D., Barone M.V., Salvatore G., Melillo R.M., Chiappetta G., Mineo A., Fenzi G., Vecchio G., Fusco A., Santoro M. J. Clin. Endocrinol. Metab. 85:3898-3907(2000) [PubMed: 11061555] [Abstract] Cited for: PHOSPHORYLATION AT TYR-1015 AND TYR-1062. |
| [13] | "Identification of RET autophosphorylation sites by mass spectrometry." Kawamoto Y., Takeda K., Okuno Y., Yamakawa Y., Ito Y., Taguchi R., Kato M., Suzuki H., Takahashi M., Nakashima I. J. Biol. Chem. 279:14213-14224(2004) [PubMed: 14711813] [Abstract] Cited for: PHOSPHORYLATION AT TYR-806; TYR-809; TYR-900; TYR-905; TYR-981; TYR-1015; TYR-1062; TYR-1090 AND TYR-1096. |
| [14] | "Novel tumorigenic rearrangement, Delta rfp/ret, in a papillary thyroid carcinoma from externally irradiated patient." Saenko V., Rogounovitch T., Shimizu-Yoshida Y., Abrosimov A., Lushnikov E., Roumiantsev P., Matsumoto N., Nakashima M., Meirmanov S., Ohtsuru A., Namba H., Tsyb A., Yamashita S. Mutat. Res. 527:81-90(2003) [PubMed: 12787916] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH TRIM27. |
| [15] | "The receptor-type protein tyrosine phosphatase J antagonizes the biochemical and biological effects of RET-derived oncoproteins." Iervolino A., Iuliano R., Trapasso F., Viglietto G., Melillo R.M., Carlomagno F., Santoro M., Fusco A. Cancer Res. 66:6280-6287(2006) [PubMed: 16778204] [Abstract] Cited for: AUTOPHOSPHORYLATION AT TYR-905; TYR-1015 AND TYR-1062, DEPHOSPHORYLATION BY PTPRJ AT TYR-905; TYR-1015 AND TYR-1062. |
| [16] | "The discovery of substituted 4-(3-hydroxyanilino)-quinolines as potent RET kinase inhibitors." Graham Robinett R., Freemerman A.J., Skinner M.A., Shewchuk L., Lackey K. Bioorg. Med. Chem. Lett. 17:5886-5893(2007) [PubMed: 17884497] [Abstract] Cited for: ENZYME REGULATION. |
| [17] | "Sorafenib functions to potently suppress RET tyrosine kinase activity by direct enzymatic inhibition and promoting RET lysosomal degradation independent of proteasomal targeting." Plaza-Menacho I., Mologni L., Sala E., Gambacorti-Passerini C., Magee A.I., Links T.P., Hofstra R.M.W., Barford D., Isacke C.M. J. Biol. Chem. 282:29230-29240(2007) [PubMed: 17664273] [Abstract] Cited for: ENZYME REGULATION BY SORAFENIB. |
| [18] | "Synthesis, modeling, and RET protein kinase inhibitory activity of 3- and 4-substituted beta-carbolin-1-ones." Cincinelli R., Cassinelli G., Dallavalle S., Lanzi C., Merlini L., Botta M., Tuccinardi T., Martinelli A., Penco S., Zunino F. J. Med. Chem. 51:7777-7787(2008) [PubMed: 19053769] [Abstract] Cited for: ENZYME REGULATION BY 3- AND 4-SUBSTITUTED BETA-CARBOLIN-1-ONES. |
| [19] | "The tyrosine kinase receptor RET interacts in vivo with aryl hydrocarbon receptor-interacting protein to alter survivin availability." Vargiolu M., Fusco D., Kurelac I., Dirnberger D., Baumeister R., Morra I., Melcarne A., Rimondini R., Romeo G., Bonora E. J. Clin. Endocrinol. Metab. 94:2571-2578(2009) [PubMed: 19366855] [Abstract] Cited for: INTERACTION WITH AIP. |
| [20] | "Transcriptional regulation of RET by Nkx2-1, Phox2b, Sox10, and Pax3." Leon T.Y.Y., Ngan E.S.W., Poon H.-C., So M.-T., Lui V.C.H., Tam P.K.H., Garcia-Barcelo M.M. J. Pediatr. Surg. 44:1904-1912(2009) [PubMed: 19853745] [Abstract] Cited for: INDUCTION BY NKX2-1; PHOX2B; SOX10 AND PAX3. |
| [21] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-696, MASS SPECTROMETRY. |
| [22] | "RETouching upon mechanoreceptors." Ma Q. Neuron 64:773-776(2009) [PubMed: 20064382] [Abstract] Cited for: FUNCTION IN DEVELOPMENT OF MECHANORECEPTORS. |
| [23] | "The evolving field of tyrosine kinase inhibitors in the treatment of endocrine tumors." Ye L., Santarpia L., Gagel R.F. Endocr. Rev. 31:578-599(2010) [PubMed: 20605972] [Abstract] Cited for: ENZYME REGULATION, REVIEW ON KINASE INHIBITORS. |
| [24] | "Inhibitors of the RET tyrosine kinase based on a 2-(alkylsulfanyl)-4-(3-thienyl)nicotinonitrile scaffold." Brandt W., Mologni L., Preu L., Lemcke T., Gambacorti-Passerini C., Kunick C. Eur. J. Med. Chem. 45:2919-2927(2010) [PubMed: 20409618] [Abstract] Cited for: ENZYME REGULATION. |
| [25] | "Functional role of the RET dependence receptor, GFRa co-receptors and ligands in the pituitary." Garcia-Lavandeira M., Diaz-Rodriguez E., Garcia-Rendueles M.E., Rodrigues J.S., Perez-Romero S., Bravo S.B., Alvarez C.V. Front. Horm. Res. 38:127-138(2010) [PubMed: 20616503] [Abstract] Cited for: FUNCTION IN PITUITARY. |
| [26] | "RET-mediated cell adhesion and migration require multiple integrin subunits." Cockburn J.G., Richardson D.S., Gujral T.S., Mulligan L.M. J. Clin. Endocrinol. Metab. 95:E342-E346(2010) [PubMed: 20702524] [Abstract] Cited for: FUNCTION IN CELL ADHESION/MIGRATION. |
| [27] | "Direct visualization of vesicle maturation and plasma membrane protein trafficking." Richardson D.S., Mulligan L.M. J. Fluoresc. 20:401-405(2010) [PubMed: 19823924] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [28] | "A novel RET inhibitor with potent efficacy against medullary thyroid cancer in vivo." Samadi A.K., Mukerji R., Shah A., Timmermann B.N., Cohen M.S. Surgery 148:1228-1236(2010) [PubMed: 21134556] [Abstract] Cited for: ENZYME REGULATION. |
| [29] | "RET modulates cell adhesion via its cleavage by caspase in sympathetic neurons." Cabrera J.R., Bouzas-Rodriguez J., Tauszig-Delamasure S., Mehlen P. J. Biol. Chem. 286:14628-14638(2011) [PubMed: 21357690] [Abstract] Cited for: FUNCTION IN CELL ADHESION, FUNCTION IN APOPTOSIS, PROTEOLYTIC PROCESSING BY CASPASE-3 AT ASP-707 AND ASP-1017, MUTAGENESIS OF ASP-707; LYS-758 AND 708-ALA--SER-1114, SUBUNIT. |
| [30] | "Focal adhesion kinase (FAK) binds RET kinase via its FERM domain, priming a direct and reciprocal RET-FAK transactivation mechanism." Plaza-Menacho I., Morandi A., Mologni L., Boender P., Gambacorti-Passerini C., Magee A.I., Hofstra R.M.W., Knowles P., McDonald N.Q., Isacke C.M. J. Biol. Chem. 286:17292-17302(2011) [PubMed: 21454698] [Abstract] Cited for: INTERACTION WITH PTK2/FAK1, FUNCTION IN PTK2/FAK1 PHOSPHORYLATION. |
| [31] | "Structure and chemical inhibition of the RET tyrosine kinase domain." Knowles P.P., Murray-Rust J., Kjaer S., Scott R.P., Hanrahan S., Santoro M., Ibanez C.F., McDonald N.Q. J. Biol. Chem. 281:33577-33587(2006) [PubMed: 16928683] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 705-1013 ALONE AND IN COMPLEX WITH INHIBITORS, MASS SPECTROMETRY, PHOSPHORYLATION AT TYR-900 AND TYR-905. |
| [32] | "Synthesis, structure-activity relationship and crystallographic studies of 3-substituted indolin-2-one RET inhibitors." Mologni L., Rostagno R., Brussolo S., Knowles P.P., Kjaer S., Murray-Rust J., Rosso E., Zambon A., Scapozza L., McDonald N.Q., Lucchini V., Gambacorti-Passerini C. Bioorg. Med. Chem. 18:1482-1496(2010) [PubMed: 20117004] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 705-1013 IN COMPLEX WITH INHIBITORS, ENZYME REGULATION, PHOSPHORYLATION AT TYR-905. |
| [33] | "Mammal-restricted elements predispose human RET to folding impairment by HSCR mutations." Kjaer S., Hanrahan S., Totty N., McDonald N.Q. Nat. Struct. Mol. Biol. 17:726-731(2010) [PubMed: 20473317] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 29-270, GLYCOSYLATION AT ASN-151, DISULFIDE BOND. |
| [34] | "Mutations in Hirschsprung disease: when does a mutation contribute to the phenotype." Hofstra R.M.W., Osinga J., Buys C.H.C.M. Eur. J. Hum. Genet. 5:180-185(1997) [PubMed: 9359036] [Abstract] Cited for: REVIEW ON HSCR VARIANTS. |
| [35] | "Mutations of the RET proto-oncogene in the multiple endocrine neoplasia type 2 syndromes, related sporadic tumours, and Hirschsprung disease." Eng C., Mulligan L.M. Hum. Mutat. 9:97-109(1997) [PubMed: 9067749] [Abstract] Cited for: REVIEW ON VARIANTS. |
| [36] | "Mutations in the RET proto-oncogene are associated with MEN 2A and FMTC." Donis-Keller H., Dou S., Chi D., Carlson K.M., Toshima K., Lairmore T.C., Howe J.R., Moley J.F., Goodfellow P., Wells S.A. Jr. Hum. Mol. Genet. 2:851-856(1993) [PubMed: 8103403] [Abstract] Cited for: VARIANTS MEN2A/MTC TRP-611; SER-618; ARG-620; TYR-620 AND ARG-634. |
| [37] | "Germ-line mutations of the RET proto-oncogene in multiple endocrine neoplasia type 2A." Mulligan L.M., Kwok J.B.J., Healey C.S., Elsdon M.J., Eng C., Gardner E., Love D.R., Mole S.E., Moore J.K., Papi L., Ponder M.A., Telenius H., Tunnacliffe A., Ponder B.A.J. Nature 363:458-460(1993) [PubMed: 8099202] [Abstract] Cited for: VARIANTS MEN2A GLY-618; 632-ASP--ARG-634; GLY-634; PHE-634; TYR-634 AND SER-634. |
| [38] | "Heterogeneity and low detection rate of RET mutations in Hirschsprung disease." Yin L., Barone V., Seri M., Bolino A., Bocciardi R., Ceccherini I., Pasini B., Tocco T., Lerone M., Cywes S., Moore S., Vanderwinden J.-M., Abramowicz M.J., Kristoffersson U., Larsson L.T., Hamel B.C.J., Silengo M., Martucciello G., Romeo G. Eur. J. Hum. Genet. 2:272-280(1994) [PubMed: 7704557] [Abstract] Cited for: VARIANTS HSCR1 PRO-40; LEU-399; GLN-762; PRO-765; GLN-897; GLY-972 AND LEU-973. |
| [39] | "Point mutation within the tyrosine kinase domain of the RET proto-oncogene in multiple endocrine neoplasia type 2B and related sporadic tumours." Eng C., Smith D.P., Mulligan L.M., Nagai M.A., Healey C.S., Ponder M.A., Gardner E., Scheumann G.F., Jackson C.E., Tunnacliffe A., Ponder B.A.J. Hum. Mol. Genet. 3:237-241(1994) [PubMed: 7911697] [Abstract] Cited for: VARIANT MEN2B THR-918. |
| [40] | "Germline RET mutations in MEN 2A and FMTC and their detection by simple DNA diagnostic tests." Xue F., Yu H., Maurer L.H., Memoli V.A., Nutile-Mcmenemy N., Schuster M.K., Browden D.W., Mao J.-I., Noll W.W. Hum. Mol. Genet. 3:635-638(1994) [PubMed: 7915165] [Abstract] Cited for: VARIANTS MEN2A/MTC ARG-618; SER-618; PHE-620; ARG-620; PHE-634; GLY-634 AND TYR-634. |
| [41] | "RET proto-oncogene mutations in inherited and sporadic medullary thyroid cancer." Blaugrund J.E., Johns M.M. Jr., Eby Y.J., Ball D.W., Baylin S.B., Hruban R.H., Sidransky D. Hum. Mol. Genet. 3:1895-1897(1994) [PubMed: 7849720] [Abstract] Cited for: VARIANTS MTC/MEN2A TYR-609; ARG-618; SER-618 AND SER-620. |
| [42] | "RET proto-oncogene mutations in French MEN 2A and FMTC families." Schuffenecker I., Billaud M., Calender A., Chambe B., Ginet N., Calmettes C., Modigliani E., Lenoir G.M. Hum. Mol. Genet. 3:1939-1943(1994) [PubMed: 7874109] [Abstract] Cited for: VARIANTS MTC, VARIANTS MEN2A. |
| [43] | "Diverse phenotypes associated with exon 10 mutations of the RET proto-oncogene." Mulligan L.M., Eng C., Attie T., Lyonnet S., Marsh D.J., Hyland V.J., Robinson B.G., Frilling A., Verellen-Dumoulin C., Safar A., Venter D.J., Munnich A., Ponder B.A.J. Hum. Mol. Genet. 3:2163-2167(1994) [PubMed: 7881414] [Abstract] Cited for: VARIANTS HSCR1 TRP-609; ARG-618 AND ARG-620, VARIANT MEN2A ARG-618, VARIANT MTC ARG-620. |
| [44] | "A mutation in the RET proto-oncogene associated with multiple endocrine neoplasia type 2B and sporadic medullary thyroid carcinoma." Hofstra R.M.W., Landsvater R.M., Ceccherini I., Stulp R.P., Stelwagen T., Luo Y., Pasini B., Hoeppener J.W.M., Ploos van Amstel H.K., Romeo G., Lips C.J.M., Buys C.H.C.M. Nature 367:375-376(1994) [PubMed: 7906866] [Abstract] Cited for: VARIANT MEN2B THR-918. |
| [45] | "Point mutations affecting the tyrosine kinase domain of the RET proto-oncogene in Hirschsprung's disease." Romeo G., Ronchetto P., Luo Y., Barone V., Seri M., Ceccherini I., Pasini B., Bocciardi R., Lerone M., Kaarlainen H., Martucciello G. Nature 367:377-378(1994) [PubMed: 8114938] [Abstract] Cited for: VARIANTS HSCR1 PRO-765; GLN-897 AND GLY-972. |
| [46] | "Mutations of the RET proto-oncogene in Hirschsprung's disease." Edery P., Lyonnet S., Mulligan L.M., Pelet A., Dow E., Abel L., Holder S., Nihoul-Fkete C., Ponder B.A.J., Munnich A. Nature 367:378-380(1994) [PubMed: 8114939] [Abstract] Cited for: VARIANTS HSCR1 LEU-32; LEU-64; GLN-330 AND LEU-393. |
| [47] | "Single missense mutation in the tyrosine kinase catalytic domain of the RET protooncogene is associated with multiple endocrine neoplasia type 2B." Carlson K.M., Dou S., Chi D., Scavarda N., Toshima K., Jackson C.E., Wells S.A. Jr., Goodfellow P.J., Donis-Keller H. Proc. Natl. Acad. Sci. U.S.A. 91:1579-1583(1994) [PubMed: 7906417] [Abstract] Cited for: VARIANT MEN2B THR-918. |
| [48] | "Analysis of RET protooncogene point mutations distinguishes heritable from nonheritable medullary thyroid carcinomas." Komminoth P., Kunz E.K., Matias-Guiu X., Hiort O., Christiansen G., Colomer A., Roth J., Heitz P.U. Cancer 76:479-489(1995) [PubMed: 8625130] [Abstract] Cited for: VARIANTS MTC; MEN2A AND MEN2B. |
| [49] | "Germline mutations of the RET proto-oncogene in eight Japanese patients with multiple endocrine neoplasia type 2A (MEN2A)." Takiguchi-Shirahama S., Koyama K., Miyauchi A., Wakasugi T., Oishi S., Takami H., Hikiji K., Nakamura Y. Hum. Genet. 95:187-190(1995) [PubMed: 7860065] [Abstract] Cited for: VARIANTS MEN2A SER-618; SER-620; ARG-634 AND TYR-634. |
| [50] | "Mutation analysis of the RET receptor tyrosine kinase in Hirschsprung disease." Angrist M., Bolk S., Thiel B., Puffenberger E.G., Hofstra R.M.W., Buys C.H.C.M., Cass D.T., Chakravarti A. Hum. Mol. Genet. 4:821-830(1995) [PubMed: 7633441] [Abstract] Cited for: VARIANTS HSCR1 LEU-20; SER-93; GLN-330; TYR-609 AND ARG-620, VARIANT CYS-982. Tissue: Blood. |
| [51] | "Diversity of RET proto-oncogene mutations in familial and sporadic Hirschsprung disease." Attie T., Pelet A., Edery P., Eng C., Mulligan L.M., Amiel J., Boutrand L., Beldjord C., Nihoul-Fekete C., Munnich A., Ponder B.A.J., Lyonnet S. Hum. Mol. Genet. 4:1381-1386(1995) [PubMed: 7581377] [Abstract] Cited for: VARIANTS HSCR1. Tissue: Leukocyte. |
| [52] | "Two maternally derived missense mutations in the tyrosine kinase domain of the RET protooncogene in a patient with de novo MEN 2B." Kitamura Y., Scavarda N., Wells S.A. Jr., Jackson C.E., Goodfellow P.J. Hum. Mol. Genet. 4:1987-1988(1995) [PubMed: 8595427] [Abstract] Cited for: VARIANT MEN2B THR-918, VARIANT TYR-922. |
| [53] | "A novel point mutation in the tyrosine kinase domain of the RET proto-oncogene in sporadic medullary thyroid carcinoma and in a family with FMTC." Eng C., Smith D.P., Mulligan L.M., Healey C.S., Zvelebil M.J., Stonehouse T.J., Ponder M.A., Jackson C.E., Waterfield M.D., Ponder B.A.J. Oncogene 10:509-513(1995) [PubMed: 7845675] [Abstract] Cited for: VARIANT MTC ASP-768. |
| [54] | "RET mutations in exons 13 and 14 of FMTC patients." Bolino A., Schuffenecker I., Luo Y., Seri M., Silengo M., Tocco T., Chabrier G., Houdent C., Murat A., Schlumberger M., Tournaire J., Lenoir G.M., Romeo G. Oncogene 10:2415-2419(1995) [PubMed: 7784092] [Abstract] Cited for: VARIANTS MTC ASP-768 AND LEU-804. |
| [55] | "Mutations in three genes are found associated with the development of Hirschsprung disease: RET, EDNRB and EDN3." Hofstra R.M.W., Osinga J., Stulp R.P., Scheffer H., Meijers C., Buys C.H.C.M. Am. J. Hum. Genet. 59:A263-A263(1996) Cited for: VARIANTS HSCR1 TYR-157; LYS-359; TYR-609; ARG-620; ASN-1059 DEL AND PRO-1061. |
| [56] | "Prevalence and parental origin of de novo RET mutations in Hirschsprung's disease." Yin L., Seri M., Barone V., Tocco T., Scaranari M., Romeo G. Eur. J. Hum. Genet. 4:356-358(1996) [PubMed: 9043870] [Abstract] Cited for: VARIANTS HSCR1 PRO-40 AND PRO-765. |
| [57] | "Mutation analysis of the RET proto-oncogene in Dutch families with MEN 2A, MEN 2B and FMTC: two novel mutations and one de novo mutation for MEN 2A." Landsvater R.M., Jansen R.P.M., Hofstra R.M.W., Buys C.H.C.M., Lips C.J.M., van Amstel H.K.P. Hum. Genet. 97:11-14(1996) [PubMed: 8557249] [Abstract] Cited for: VARIANTS MTC/MEN2A. |
| [58] | "Diagnosis of multiple endocrine neoplasia [MEN] 2A, 2B and familial medullary thyroid cancer [FMTC] by multiplex PCR and heteroduplex analyses of RET proto-oncogene mutations." Kambouris M., Jackson C.E., Feldman G.L. Hum. Mutat. 8:64-70(1996) [PubMed: 8807338] [Abstract] Cited for: VARIANTS MEN2A, VARIANT MTC ASP-768, VARIANT MEN2B THR-918. |
| [59] | "Mutations of the ret protooncogene in German multiple endocrine neoplasia families: relation between genotype and phenotype." Frank-Raue K., Hoeppner W., Frilling A., Kotzerke J., Dralle H., Haase R., Mann K., Seif F., Kirchner R., Rendl J., Deckart H.F., Ritter M.M., Hampel R., Klempa J., Scholz G.H., Raue F., Bogner U., Brabant G. Ziegler R.J. Clin. Endocrinol. Metab. 81:1780-1783(1996) [PubMed: 8626834] [Abstract] Cited for: VARIANTS MEN2A. |
| [60] | "A duplication of 12 bp in the critical cysteine rich domain of the RET proto-oncogene results in a distinct phenotype of multiple endocrine neoplasia type 2A." Hoeppner W., Ritter M.M. Hum. Mol. Genet. 6:587-590(1997) [PubMed: 9097963] [Abstract] Cited for: VARIANT MEN2A HIS-GLU-LEU-CYS-634 INS. |
| [61] | "Frequency of RET mutations in long- and short-segment Hirschsprung disease." Seri M., Yin L., Barone V., Bolino A., Celli I., Bocciardi R., Pasini B., Ceccherini I., Lerone M., Kristoffersson U., Larsson L.T., Casasa J.M., Cass D.T., Abramowicz M.J., Vanderwinden J.-M., Kravcenkiene I., Baric I., Silengo M., Martucciello G., Romeo G. Hum. Mutat. 9:243-249(1997) [PubMed: 9090527] [Abstract] Cited for: VARIANTS HSCR1 PRO-180; GLN-313; ARG-620 AND PHE-791. |
| [62] | "Cys 618 Arg mutation in the RET proto-oncogene associated with familial medullary thyroid carcinoma and maternally transmitted Hirschsprung's disease suggesting a role for imprinting." Peretz H., Luboshitsky R., Baron E., Biton A., Gershoni R., Usher S., Grynberg E., Yakobson E., Graff E., Lapidot M. Hum. Mutat. 10:155-159(1997) [PubMed: 9259198] [Abstract] Cited for: VARIANT MTC ARG-618, VARIANT HSCR1 ARG-618. |
| [63] | "Germline dinucleotide mutation in codon 883 of the RET proto-oncogene in multiple endocrine neoplasia type 2B without codon 918 mutation." Gimm O., Marsh D.J., Andrew S.D., Frilling A., Dahia P.L.M., Mulligan L.M., Zajac J.D., Robinson B.G., Eng C. J. Clin. Endocrinol. Metab. 82:3902-3904(1997) [PubMed: 9360560] [Abstract] Cited for: VARIANT MEN2B PHE-883. Tissue: Peripheral blood leukocyte. |
| [64] | "A novel point mutation in the intracellular domain of the ret protooncogene in a family with medullary thyroid carcinoma." Hofstra R.M.W., Fattoruso O., Quadro L., Wu Y., Libroia A., Verga U., Colantuoni V., Buys C.H.C.M. J. Clin. Endocrinol. Metab. 82:4176-4178(1997) [PubMed: 9398735] [Abstract] Cited for: VARIANT MTC ALA-891. |
| [65] | "Mutation analysis of the RET, the endothelin-B receptor, and the endothelin-3 genes in sporadic cases of Hirschsprung's disease." Kusafuka T., Wang Y., Puri P. J. Pediatr. Surg. 32:501-504(1997) [PubMed: 9094028] [Abstract] Cited for: VARIANTS HSCR1 SER-174 AND TYR-197. |
| [66] | "Novel germline RET proto-oncogene mutations associated with medullary thyroid carcinoma (MTC): mutation analysis in Japanese patients with MTC." Kitamura Y., Goodfellow P.J., Shimizu K., Nagahama M., Ito K., Kitagawa W., Akasu H., Takami H., Tanaka S., Wells S.A. Jr. Oncogene 14:3103-3106(1997) [PubMed: 9223675] [Abstract] Cited for: VARIANTS MTC; MEN2A AND MEN2B, VARIANT SER-691. |
| [67] | "Germline mutation of RET codon 883 in two cases of de novo MEN 2B." Smith D.P., Houghton C., Ponder B.A.J. Oncogene 15:1213-1217(1997) [PubMed: 9294615] [Abstract] Cited for: VARIANT MEN2B PHE-883. |
| [68] | "Mutations of the RET-GDNF signaling pathway in Ondine's curse." Amiel J., Salomon R., Attie T., Pelet A., Trang H., Mokhtari M., Gaultier C., Munnich A., Lyonnet S. Am. J. Hum. Genet. 62:715-717(1998) [PubMed: 9497256] [Abstract] Cited for: VARIANT CCHS LEU-1039, VARIANT SER-691. |
| [69] | "Novel point mutation in exon 10 of the RET proto-oncogene in a family with medullary thyroid carcinoma." Oriola J., Paramo C., Halperin I., Garcia-Mayor R.V., Rivera-Fillat F. Am. J. Med. Genet. 78:271-273(1998) [PubMed: 9677065] [Abstract] Cited for: VARIANT MTC GLY-611. |
| [70] | "Phenotypic variation in a family with mutations in two Hirschsprung-related genes (RET and endothelin receptor B)." Svensson P.J., Anvret M., Molander M.L., Nordenskjold A. Hum. Genet. 103:145-148(1998) [PubMed: 9760196] [Abstract] Cited for: VARIANT CYS-982. |
| [71] | "Hirschsprung disease in MEN 2A: increased spectrum of RET exon 10 genotypes and strong genotype-phenotype correlation." Decker R.A., Peacock M.L., Watson P. Hum. Mol. Genet. 7:129-134(1998) [PubMed: 9384613] [Abstract] Cited for: VARIANTS MEN2A TYR-609; SER-618; ARG-620 AND TRP-620, VARIANTS HSCR1 TYR-609; SER-618; ARG-620 AND TRP-620. |
| [72] | "Duplication of 9 base pairs in the critical cysteine-rich domain of the RET proto-oncogene causes multiple endocrine neoplasia type 2A." Hoeppner W., Dralle H., Brabant G. Hum. Mutat. Suppl. 1:S128-S130(1998) [PubMed: 9452064] [Abstract] Cited for: VARIANT MEN2A CYS-ARG-THR-636 INS. |
| [73] | "A GTG to ATG novel point mutation at codon 804 in exon 14 of the RET proto-oncogene in two families affected by familial medullary thyroid carcinoma." Fattoruso O., Quadro L., Libroia A., Verga U., Lupoli G., Cascone E., Colantuoni V. Hum. Mutat. Suppl. 1:S167-S171(1998) [PubMed: 9452077] [Abstract] Cited for: VARIANT MTC MET-804. |
| [74] | "A new hot spot for mutations in the ret protooncogene causing familial medullary thyroid carcinoma and multiple endocrine neoplasia type 2A." Berndt I., Reuter M., Saller B., Frank-Raue K., Groth P., Grussendorf M., Raue F., Ritter M.M., Hoeppner W. J. Clin. Endocrinol. Metab. 83:770-774(1998) [PubMed: 9506724] [Abstract] Cited for: VARIANTS MTC/MEN2A PHE-790 AND PHE-791. |
| [75] | "Mutational analysis of the RET proto-oncogene in 71 Japanese patients with medullary thyroid carcinoma." Shirahama S., Ogura K., Takami H., Ito K., Tohsen T., Miyauchi A., Nakamura Y. J. Hum. Genet. 43:101-106(1998) [PubMed: 9621513] [Abstract] Cited for: VARIANTS MTC AND MEN2A. |
| [76] | "Double heterozygosity for a RET substitution interfering with splicing and an EDNRB missense mutation in Hirschsprung disease." Auricchio A., Griseri P., Carpentieri M.L., Betsos N., Staiano A., Tozzi A., Priolo M., Thompson H., Bocciardi R., Romeo G., Ballabio A., Ceccherini I. Am. J. Hum. Genet. 64:1216-1221(1999) [PubMed: 10090908] [Abstract] Cited for: VARIANTS HSCR1 LYS-626 AND GLN-813. |
| [77] | "Two distinct mutations of the RET receptor causing Hirschsprung's disease impair the binding of signalling effectors to a multifunctional docking site." Geneste O., Bidaud C., De Vita G., Hofstra R.M.W., Tartare-Deckert S., Buys C.H.C.M., Lenoir G.M., Santoro M., Billaud M. Hum. Mol. Genet. 8:1989-1999(1999) [PubMed: 10484767] [Abstract] Cited for: VARIANTS HSCR1 ASN-1059 DEL AND PRO-1061. |
| [78] | "A novel 9-base pair duplication in RET exon 8 in familial medullary thyroid carcinoma." Pigny P., Bauters C., Wemeau J.-L., Houcke M.L., Crepin M., Caron P., Giraud S., Calender A., Buisine M.-P., Kerckaert J.-P., Porchet N. J. Clin. Endocrinol. Metab. 84:1700-1704(1999) [PubMed: 10323403] [Abstract] Cited for: VARIANT MTC GLU-GLU-CYS-531 INS. |
| [79] | "A novel case of multiple endocrine neoplasia type 2A associated with two de novo mutations of the RET protooncogene." Tessitore A., Sinisi A.A., Pasquali D., Cardone M., Vitale D., Bellastella A., Colantuoni V. J. Clin. Endocrinol. Metab. 84:3522-3527(1999) [PubMed: 10522989] [Abstract] Cited for: VARIANT MEN2A GLY-640. |
| [80] | "A RET double mutation in the germline of a kindred with FMTC." Bartsch D.K., Hasse C., Schug C., Barth P., Rothmund M., Hoeppner W. Exp. Clin. Endocrinol. Diabetes 108:128-132(2000) [PubMed: 10826520] [Abstract] Cited for: VARIANTS MTC MET-804 AND LEU-844. |
| [81] | "A new germline mutation, R600Q, within the coding region of RET proto-oncogene: a rare polymorphism or a MEN 2 causing mutation?" Saez M.E., Ruiz A., Cebrian A., Morales F., Robledo M., Antinolo G., Borrego S. Hum. Mutat. 15:122-122(2000) [PubMed: 10612852] [Abstract] Cited for: VARIANT GLN-600. |
| [82] | "A human model for multigenic inheritance: phenotypic expression in Hirschsprung disease requires both the RET gene and a new 9q31 locus." Bolk S., Pelet A., Hofstra R.M.W., Angrist M., Salomon R., Croaker D., Buys C.H.C.M., Lyonnet S., Chakravarti A. Proc. Natl. Acad. Sci. U.S.A. 97:268-273(2000) [PubMed: 10618407] [Abstract] Cited for: VARIANTS HSCR1 LEU-32; CYS-77; TRP-360 AND LYS-394. |
| [83] | "Three novel mutations in the RET proto-oncogene." Kalinin V.N., Amosenko F.A., Shabanov M.A., Lubchenko L.N., Hosch S.B., Garkavtseva R.F., Izbicki J.R. J. Mol. Med. 79:609-612(2001) [PubMed: 11692159] [Abstract] Cited for: VARIANTS MTC GLY-639; GLY-641 AND PHE-922. |
| [84] | "Germ-line mutations in nonsyndromic pheochromocytoma." The Freiburg-Warsaw-Columbus pheochromocytoma study group Neumann H.P.H., Bausch B., McWhinney S.R., Bender B.U., Gimm O., Franke G., Schipper J., Klisch J., Altehoefer C., Zerres K., Januszewicz A., Smith W.M., Munk R., Manz T., Glaesker S., Apel T.W., Treier M., Reineke M. Eng C.N. Engl. J. Med. 346:1459-1466(2002) [PubMed: 12000816] [Abstract] Cited for: VARIANTS PHEOCHROMOCYTOMA ARG-634; GLY-634; TYR-634; SER-634; PHE-634; TRP-634 AND PHE-791. |
| [85] | "Congenital central hypoventilation syndrome: a novel mutation of the RET gene in an isolated case." Kanai M., Numakura C., Sasaki A., Shirahata E., Akaba K., Hashimoto M., Hasegawa H., Shirasawa S., Hayasaka K. Tohoku J. Exp. Med. 196:241-246(2002) [PubMed: 12086152] [Abstract] Cited for: VARIANT CCHS HIS-114. |
| [86] | "Molecular analysis of congenital central hypoventilation syndrome." Sasaki A., Kanai M., Kijima K., Akaba K., Hashimoto M., Hasegawa H., Otaki S., Koizumi T., Kusuda S., Ogawa Y., Tuchiya K., Yamamoto W., Nakamura T., Hayasaka K. Hum. Genet. 114:22-26(2003) [PubMed: 14566559] [Abstract] Cited for: VARIANTS ASN-489; SER-691 AND CYS-982, VARIANTS CCHS HIS-67; HIS-114 AND GLU-432. |
| [87] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLY-145; TRP-360 AND GLU-593. |
| [88] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLN-163; ASN-278; MET-292; ASN-489; SER-691; THR-749; SER-826; LEU-844; CYS-982 AND TYR-1112. |
| [89] | "Renal aplasia in humans is associated with RET mutations." Skinner M.A., Safford S.D., Reeves J.G., Jackson M.E., Freemerman A.J. Am. J. Hum. Genet. 82:344-351(2008) [PubMed: 18252215] [Abstract] Cited for: VARIANTS RADYS THR-198; ALA-376; HIS-394; ILE-778; SER-894; THR-918; LEU-1049 AND SER-1067, CHARACTERIZATION OF VARIANTS RADYS THR-198; ALA-376; HIS-394; ILE-778; SER-894; LEU-1049 AND SER-1067. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK291807 mRNA. Translation: BAF84496.1. AC010864 Genomic DNA. No translation available. BC004257 mRNA. Translation: AAH04257.1. X15262 mRNA. Translation: CAA33333.1. X12949 mRNA. Translation: CAA31408.1. M16029 mRNA. Translation: AAA36786.1. Different initiation. X15786 mRNA. Translation: CAA33787.1. Different initiation. M31213 mRNA. Translation: AAA36524.1. Different initiation. AJ297349 mRNA. Translation: CAC14882.1. Different initiation. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00013983. IPI00479572. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | TVHURE. A27203. A34630. B34735. S05582. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_065681.1. NM_020630.4. NP_066124.1. NM_020975.4. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.350321. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P07949. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P07949. Positions 29-360, 713-1012. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-41449N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P07949. 3 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-265342. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P07949. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P07949. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 547807. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P07949. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000340058; ENSP00000344798; ENSG00000165731. ENST00000355710; ENSP00000347942; ENSG00000165731. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5979. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5979. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001jal.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 5979. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC10P043572. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:9967. RET. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB002581. CAB018342. HPA008356. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 114500. phenotype. 142623. phenotype. 155240. phenotype. 162300. phenotype. 164761. gene. 171300. phenotype. 171400. phenotype. 188550. phenotype. 191830. phenotype. 209880. phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P07949. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 1848. Bilateral renal agenesis. 388. Hirschsprung disease. 1332. Medullary thyroid carcinoma. 247698. Multiple endocrine neoplasia type 2A. 661. Ondine syndrome. 146. Papillary or follicular thyroid carcinoma. 93172. Unilateral renal dysplasia. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA34335. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG12621. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HBG444015. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG002609. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P07949. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | GCARVYF. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4P2Q1H. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P07949. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 2.7.10.1. 2681. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | ret_pathway. Signaling events regulated by Ret tyrosine kinase. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P07949. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P07949. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_RET. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P07949. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000165731. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR002126. Cadherin. IPR015919. Cadherin-like. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase. IPR008266. Tyr_kinase_AS. IPR020635. Tyr_kinase_cat_dom. IPR016249. Tyr_kinase_Ret_rcpt. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:2.60.40.60. Cadherin. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K05126. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00028. Cadherin. 1 hit. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF000631. TyrPK_receptor_Ret. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00109. TYRKINASE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00112. CA. 1 hit. SM00219. TyrKc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF49313. Cadherin. 1 hit. SSF56112. Kinase_like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50268. CADHERIN_2. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB01268. Sunitinib. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 23271. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | RET_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P07949 Secondary accession number(s): A8K6Z2 Q9H4A2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with